Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B032308.836ON3221935855e-73
Smik_13.218.836ON2421081182e-06
NCAS0B003308.836ON199891144e-06
TPHA0C047708.836ON314401103e-05
Suva_13.318.836ON251951093e-05
CAGL0B02277g8.836ON230371057e-05
Skud_13.288.836ON2421001058e-05
YML113W (DAT1)8.836ON248831013e-04
KAFR0A028108.836ON196104985e-04
TDEL0B006108.836ON21537950.001
ZYRO0G14102g8.836ON24037940.002
Ecym_46078.836ON19438900.005
NDAI0E003108.836ON28536910.006
Kpol_541.148.836ON29034880.014
Kwal_27.102868.836ON29549850.033
KLTH0C03960g8.836ON22234780.21
SAKL0D01562g8.836ON21834730.77
KLLA0D01837g8.836ON25647731.00
KNAG0G034008.836ON22329657.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B03230
         (322 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B03230 Chr2 complement(752972..753940) [969 bp, 322 aa] {ON...   229   5e-73
Smik_13.21 Chr13 (40315..41043) [729 bp, 242 aa] {ON} YML113W (R...    50   2e-06
NCAS0B00330 Chr2 (41882..42481) [600 bp, 199 aa] {ON} Anc_8.836 ...    49   4e-06
TPHA0C04770 Chr3 complement(1029507..1030451) [945 bp, 314 aa] {...    47   3e-05
Suva_13.31 Chr13 (43793..44548) [756 bp, 251 aa] {ON} YML113W (R...    47   3e-05
CAGL0B02277g Chr2 complement(216053..216745) [693 bp, 230 aa] {O...    45   7e-05
Skud_13.28 Chr13 (43675..44403) [729 bp, 242 aa] {ON} YML113W (R...    45   8e-05
YML113W Chr13 (44045..44791) [747 bp, 248 aa] {ON}  DAT1DNA bind...    44   3e-04
KAFR0A02810 Chr1 complement(584061..584651) [591 bp, 196 aa] {ON...    42   5e-04
TDEL0B00610 Chr2 (117113..117760) [648 bp, 215 aa] {ON}                41   0.001
ZYRO0G14102g Chr7 complement(1123672..1124394) [723 bp, 240 aa] ...    41   0.002
Ecym_4607 Chr4 complement(1184220..1184804) [585 bp, 194 aa] {ON...    39   0.005
NDAI0E00310 Chr5 (45261..46118) [858 bp, 285 aa] {ON}                  40   0.006
Kpol_541.14 s541 complement(38346..39218) [873 bp, 290 aa] {ON} ...    39   0.014
Kwal_27.10286 s27 (275677..276564) [888 bp, 295 aa] {ON} YML113W...    37   0.033
KLTH0C03960g Chr3 (346440..347108) [669 bp, 222 aa] {ON} weakly ...    35   0.21 
SAKL0D01562g Chr4 (126163..126819) [657 bp, 218 aa] {ON} some si...    33   0.77 
KLLA0D01837g Chr4 complement(160236..161006) [771 bp, 256 aa] {O...    33   1.00 
KNAG0G03400 Chr7 complement(730267..730938) [672 bp, 223 aa] {ON}      30   7.9  

>TBLA0B03230 Chr2 complement(752972..753940) [969 bp, 322 aa] {ON}
           Anc_8.836 YML113W
          Length = 322

 Score =  229 bits (585), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 124/193 (64%)

Query: 1   MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRKRRDGNISNENHLIHXXXXXXXXXXXX 60
           MAKTLAQ              TLREGRKPGSGRKRRDGNISNENHLIH            
Sbjct: 1   MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRKRRDGNISNENHLIHSNDTVTSTVNSS 60

Query: 61  XXXXXXXAFTEQDLEALQALNSLNKSSTSPRSTSANTSATNILPSIQMNTDSNSNNMFPN 120
                  AFTEQDLEALQALNSLNKSSTSPRSTSANTSATNILPSIQMNTDSNSNNMFPN
Sbjct: 61  RNGSVSNAFTEQDLEALQALNSLNKSSTSPRSTSANTSATNILPSIQMNTDSNSNNMFPN 120

Query: 121 AHNVFLXXXXXXXXXXXXXXXXXGLNIHSSIHMXXXXXXXXXXXXXXXXXXXPNGSANIQ 180
           AHNVFL                 GLNIHSSIHM                   PNGSANIQ
Sbjct: 121 AHNVFLNENTSNNNTENSITTNSGLNIHSSIHMSNSLSNGSTSTNATNGSQTPNGSANIQ 180

Query: 181 LPLPIPINNGMYG 193
           LPLPIPINNGMYG
Sbjct: 181 LPLPIPINNGMYG 193

 Score =  112 bits (280), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 55/55 (100%), Positives = 55/55 (100%)

Query: 268 QTSTTTYIESAKKIKKGDTVFDNKTTGNSVNSVNSKDIFKNLTPNFPKFNRSSTP 322
           QTSTTTYIESAKKIKKGDTVFDNKTTGNSVNSVNSKDIFKNLTPNFPKFNRSSTP
Sbjct: 268 QTSTTTYIESAKKIKKGDTVFDNKTTGNSVNSVNSKDIFKNLTPNFPKFNRSSTP 322

>Smik_13.21 Chr13 (40315..41043) [729 bp, 242 aa] {ON} YML113W
           (REAL)
          Length = 242

 Score = 50.1 bits (118), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 53/108 (49%), Gaps = 15/108 (13%)

Query: 1   MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRKRRDGNISNENHLIHXXXXXXXXXXXX 60
           MAKTLAQ              TLREGRKPGSGR+RR  +I+ ++                
Sbjct: 1   MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRQ-DIAGKD------------TDGT 47

Query: 61  XXXXXXXAFTEQDLEALQALNSLNKSSTSPRSTSANTS--ATNILPSI 106
                  + + +D+EA+ AL  L  S +S    ++ T+  AT++LPS+
Sbjct: 48  QQDQESRSISSRDMEAVDALRELTHSPSSHAGHNSTTAAGATSLLPSL 95

>NCAS0B00330 Chr2 (41882..42481) [600 bp, 199 aa] {ON} Anc_8.836
          YML113W
          Length = 199

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 39/89 (43%), Gaps = 3/89 (3%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRKRRDGNISNENHL---IHXXXXXXXXX 57
          MAKTLAQ              TLREGRKPGSGRKRR+  ++N   L              
Sbjct: 1  MAKTLAQGRKPGSGRKPGKAKTLREGRKPGSGRKRREPALNNHTQLQSEAQIGTNKTLND 60

Query: 58 XXXXXXXXXXAFTEQDLEALQALNSLNKS 86
                     FT +D+EA+ AL  L  S
Sbjct: 61 NLTKSPTNELNFTLRDMEAVDALRGLTHS 89

>TPHA0C04770 Chr3 complement(1029507..1030451) [945 bp, 314 aa]
          {ON} Anc_8.836 YML113W
          Length = 314

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 26/40 (65%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRKRRDGNI 40
          MAKTLAQ              TLREGRKPGSGR+R+DG++
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRKDGSL 40

>Suva_13.31 Chr13 (43793..44548) [756 bp, 251 aa] {ON} YML113W
          (REAL)
          Length = 251

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 41/95 (43%), Gaps = 25/95 (26%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRKR------RDGNISNENHLIHXXXXXX 54
          MAKTLAQ              TLREGRKPGSGR+R      RD ++S ++          
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRQDIGGRDADVSQQDQ--------- 51

Query: 55 XXXXXXXXXXXXXAFTEQDLEALQALNSLNKSSTS 89
                         + +D+EA+ AL  L  S +S
Sbjct: 52 ----------ESRPISSRDMEAVDALRELTHSPSS 76

>CAGL0B02277g Chr2 complement(216053..216745) [693 bp, 230 aa]
          {ON} some similarities with uniprot|P13483
          Saccharomyces cerevisiae YML113w DAT1
          Length = 230

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRKRRD 37
          MAKTLAQ              TLREGRKPGSGR+RRD
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRD 37

>Skud_13.28 Chr13 (43675..44403) [729 bp, 242 aa] {ON} YML113W
          (REAL)
          Length = 242

 Score = 45.1 bits (105), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 45/100 (45%), Gaps = 14/100 (14%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRKRRDGNISNENHLIHXXXXXXXXXXXX 60
          MAKTLAQ              TLREGRKPGSGR+RR  +I  ++  I             
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRQ-DIGGKDADI------------T 47

Query: 61 XXXXXXXAFTEQDLEALQALNSLNKSSTS-PRSTSANTSA 99
                   + +D+EA+ AL  L  S +S P   SA  +A
Sbjct: 48 LQDQESRPISSRDMEAVDALRELTHSPSSHPAHNSAPVTA 87

>YML113W Chr13 (44045..44791) [747 bp, 248 aa] {ON}  DAT1DNA
          binding protein that recognizes oligo(dA).oligo(dT)
          tracts; Arg side chain in its N-terminal pentad
          Gly-Arg-Lys-Pro-Gly repeat is required for DNA-binding;
          not essential for viability
          Length = 248

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 33/83 (39%), Gaps = 13/83 (15%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRKRRDGNISNENHLIHXXXXXXXXXXXX 60
          MAKTLAQ              TLREGRKPGSGR+RR      E                 
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRRQDTGGKET-------------DGS 47

Query: 61 XXXXXXXAFTEQDLEALQALNSL 83
                   + +D+EA+ AL  L
Sbjct: 48 QQDQESRLISSRDMEAVDALREL 70

>KAFR0A02810 Chr1 complement(584061..584651) [591 bp, 196 aa] {ON}
           Anc_8.836 YML113W
          Length = 196

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 45/104 (43%), Gaps = 6/104 (5%)

Query: 1   MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRKRRDGNISNENHLIHXXXXXXXXXXXX 60
           MAKTLAQ              TL+EGRKPGSGR++R  + S  +  I             
Sbjct: 1   MAKTLAQGRKPGSGRKPGKAKTLKEGRKPGSGRRKRAVSASIASLAI---PPHTGARTRE 57

Query: 61  XXXXXXXAFTEQDLEALQALNSLNKSSTSPRSTSANTSATNILP 104
                    T +DLEA+ AL  L   + SP+  S  T A +  P
Sbjct: 58  ESNTYDHPITSRDLEAIDALREL---THSPQQMSQATKAMSQQP 98

>TDEL0B00610 Chr2 (117113..117760) [648 bp, 215 aa] {ON} 
          Length = 215

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 23/37 (62%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRKRRD 37
          MAKTLAQ              TLREGRKPGSGR+R++
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRRRKN 37

>ZYRO0G14102g Chr7 complement(1123672..1124394) [723 bp, 240 aa]
          {ON} some similarities with uniprot|P13483
          Saccharomyces cerevisiae YML113W
          Length = 240

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 22/37 (59%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRKRRD 37
          MAKTL+Q              TLR GRKPGSGR+RRD
Sbjct: 1  MAKTLSQGRKPGSGRKPGKGKTLRNGRKPGSGRRRRD 37

>Ecym_4607 Chr4 complement(1184220..1184804) [585 bp, 194 aa] {ON}
          similar to Saccharomyces cerevisiae YML113W DAT1
          Length = 194

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 21/38 (55%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRKRRDG 38
          MAKTLAQ              TL EGRKPGSGRK+R  
Sbjct: 1  MAKTLAQGRKPGSGRKPGKAKTLLEGRKPGSGRKKRQA 38

>NDAI0E00310 Chr5 (45261..46118) [858 bp, 285 aa] {ON} 
          Length = 285

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 22/36 (61%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRKRR 36
          MAKTLAQ              TL+EGRKPGSGR+R+
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLKEGRKPGSGRRRK 36

>Kpol_541.14 s541 complement(38346..39218) [873 bp, 290 aa] {ON}
          complement(38346..39218) [873 nt, 291 aa]
          Length = 290

 Score = 38.5 bits (88), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 20/34 (58%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRK 34
          MAKTLAQ              TLREGRKPGSGR+
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKPGSGRR 34

>Kwal_27.10286 s27 (275677..276564) [888 bp, 295 aa] {ON} YML113W
          (DAT1) - datin, an oligo(dA).oligo(dT)-binding protein
          [contig 37] FULL
          Length = 295

 Score = 37.4 bits (85), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRKR-RDGNISNENHLIH 48
          MAKTLAQ              TL +GRKPGSGRK    G +S ++ L H
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLAQGRKPGSGRKPGSKGQVSKKHALNH 49

>KLTH0C03960g Chr3 (346440..347108) [669 bp, 222 aa] {ON} weakly
          similar to uniprot|P13483 Saccharomyces cerevisiae
          YML113W DAT1 DNA binding protein that recognizes
          oligo(dA).oligo(dT) tracts
          Length = 222

 Score = 34.7 bits (78), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 19/34 (55%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRK 34
          MAKTLAQ              TL +GRKPGSGRK
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLAQGRKPGSGRK 34

>SAKL0D01562g Chr4 (126163..126819) [657 bp, 218 aa] {ON} some
          similarities with uniprot|P13483 Saccharomyces
          cerevisiae YML113W DAT1 DNA binding protein that
          recognizes oligo(dA).oligo(dT) tracts Arg side chain in
          its N-terminal pentad Gly-Arg-Lys-Pro-Gly repeat is
          required for DNA-binding
          Length = 218

 Score = 32.7 bits (73), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 18/34 (52%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRK 34
          MAKTLAQ              TL EGRK GSGRK
Sbjct: 1  MAKTLAQGRKPGSGRKPGKAKTLAEGRKVGSGRK 34

>KLLA0D01837g Chr4 complement(160236..161006) [771 bp, 256 aa]
          {ON} similar to uniprot|P13483 Saccharomyces cerevisiae
          YML113W DAT1 DNA binding protein that recognizes
          oligo(dA). oligo(dT) tracts; Arg side chain in its N-
          terminal pentad Gly-Arg-Lys-Pro-Gly repeat is required
          for DNA-binding; not essential for viability
          Length = 256

 Score = 32.7 bits (73), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 22/47 (46%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKPGSGRKRRDGNISNENHLI 47
          MAK L+               TL EGRKPGSGRK+   N+   N  +
Sbjct: 1  MAKKLSDGRKPGSGRKPGRAKTLAEGRKPGSGRKKGSKNLGISNGAV 47

>KNAG0G03400 Chr7 complement(730267..730938) [672 bp, 223 aa] {ON}
          
          Length = 223

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 15/29 (51%)

Query: 1  MAKTLAQXXXXXXXXXXXXXXTLREGRKP 29
          MAKTLAQ              TLREGRKP
Sbjct: 1  MAKTLAQGRKPGSGRKPGKGKTLREGRKP 29

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.124    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,844,220
Number of extensions: 612699
Number of successful extensions: 4853
Number of sequences better than 10.0: 39
Number of HSP's gapped: 4894
Number of HSP's successfully gapped: 40
Length of query: 322
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 212
Effective length of database: 40,868,139
Effective search space: 8664045468
Effective search space used: 8664045468
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)