Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B029208.853ON1029102949350.0
Suva_13.4778.853ON96998917090.0
Skud_13.4608.853ON969101917080.0
YMR287C (DSS1)8.853ON96999017080.0
TDEL0B002208.853ON93598816790.0
Smik_13.5038.853ON96998916630.0
ZYRO0C14938g8.853ON966101016480.0
NCAS0C003008.853ON94099615530.0
KNAG0E011408.853ON92997915390.0
SAKL0D01078g8.853ON936101915360.0
Kwal_27.102138.853ON93698515080.0
KLTH0C03674g8.853ON94898114850.0
KAFR0L019708.853ON93299514560.0
CAGL0M07051g8.853ON92399814450.0
TPHA0I003508.853ON94398714410.0
NDAI0K003208.853ON962100414430.0
Kpol_237.48.853ON91688413951e-177
AFR448W8.853ON81789410971e-134
KLLA0C06314g8.853ON983102111001e-133
NDAI0H035601.367ON10124521381e-07
KLLA0A10835g1.367ON10084491301e-06
NCAS0D005901.367ON9984521282e-06
Kpol_1043.421.367ON9884451245e-06
KNAG0C019501.367ON9964521221e-05
TDEL0D023801.367ON9974611156e-05
TPHA0A023201.367ON10154531157e-05
Ecym_27151.367ON9884551131e-04
KLTH0H13420g1.367ON9864621131e-04
Suva_15.1471.367ON10014521121e-04
Skud_15.1371.367ON10304581112e-04
YOL021C (DIS3)1.367ON10014501103e-04
TBLA0D050701.367ON9975041093e-04
Smik_15.1451.367ON10014511060.001
CAGL0H04411g1.367ON10074491040.001
SAKL0D10186g1.367ON9884791000.004
ZYRO0G01166g1.367ON9934501000.004
KAFR0C045301.367ON1000451960.012
AEL031C1.367ON997450960.012
Kwal_34.162451.367ON986455940.019
Kwal_14.19578.202ON44454771.6
ZYRO0G16632g5.298ON165757728.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B02920
         (1029 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {...  1905   0.0  
Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {...   662   0.0  
Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {...   662   0.0  
YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON} ...   662   0.0  
TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}...   651   0.0  
Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {...   645   0.0  
ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]...   639   0.0  
NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853...   602   0.0  
KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {O...   597   0.0  
SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar ...   596   0.0  
Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {...   585   0.0  
KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {...   576   0.0  
KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {...   565   0.0  
CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa] ...   561   0.0  
TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}...   559   0.0  
NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.85...   560   0.0  
Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON} co...   541   e-177
AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic ...   427   e-134
KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {...   428   e-133
NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1....    58   1e-07
KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highl...    55   1e-06
NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON...    54   2e-06
Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON} (83527....    52   5e-06
KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.3...    52   1e-05
TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {O...    49   6e-05
TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {...    49   7e-05
Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {O...    48   1e-04
KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} high...    48   1e-04
Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa] ...    48   1e-04
Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa] ...    47   2e-04
YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}...    47   3e-04
TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON} Anc_1...    47   3e-04
Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa] ...    45   0.001
CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa] ...    45   0.001
SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly...    43   0.004
ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON...    43   0.004
KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1....    42   0.012
AEL031C Chr5 complement(574534..577527) [2994 bp, 997 aa] {ON} S...    42   0.012
Kwal_34.16245 s34 complement(260089..263049) [2961 bp, 986 aa] {...    41   0.019
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    34   1.6  
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    32   8.0  

>TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {ON}
            Anc_8.853 YMR287C
          Length = 1029

 Score = 1905 bits (4935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 954/1029 (92%), Positives = 954/1029 (92%)

Query: 1    MVRVSRSLNWHQSNWLLKNYPNSQNTKYDYPSRKAYTPPLHNNVTKHNKLSNEDIEKIKQ 60
            MVRVSRSLNWHQSNWLLKNYPNSQNTKYDYPSRKAYTPPLHNNVTKHNKLSNEDIEKIKQ
Sbjct: 1    MVRVSRSLNWHQSNWLLKNYPNSQNTKYDYPSRKAYTPPLHNNVTKHNKLSNEDIEKIKQ 60

Query: 61   TFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWDSRTITPKFSKYML 120
            TFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWDSRTITPKFSKYML
Sbjct: 61   TFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWDSRTITPKFSKYML 120

Query: 121  NSTFSFDAWYQKIISNSFNLTFTKHSLELDPLNIGDLILLPDSSNLLMCVDIPHNTKDPR 180
            NSTFSFDAWYQKIISNSFNLTFTKHSLELDPLNIGDLILLPDSSNLLMCVDIPHNTKDPR
Sbjct: 121  NSTFSFDAWYQKIISNSFNLTFTKHSLELDPLNIGDLILLPDSSNLLMCVDIPHNTKDPR 180

Query: 181  YTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHGNNSIGTIKNTQNIKILL 240
            YTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHGNNSIGTIKNTQNIKILL
Sbjct: 181  YTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHGNNSIGTIKNTQNIKILL 240

Query: 241  PIIARQLVVRPILNNLNKSANDXXXXXXXXXXXXHRLIQNGNGPYQISXXXXXXXXXXXX 300
            PIIARQLVVRPILNNLNKSAND            HRLIQNGNGPYQIS            
Sbjct: 241  PIIARQLVVRPILNNLNKSANDKLSIILKKLELIHRLIQNGNGPYQISFFKLIKLIDILN 300

Query: 301  XXXXXXSKKFDINLNFXXXXXXXXXXXXXXXXXXDASTFLATYWAIRLQQQDFLWGKIQV 360
                  SKKFDINLNF                  DASTFLATYWAIRLQQQDFLWGKIQV
Sbjct: 301  LNDFDNSKKFDINLNFSKLLSSNEIESLNSSTEIDASTFLATYWAIRLQQQDFLWGKIQV 360

Query: 361  NKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDDXXXXXXXXXXXXXX 420
            NKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDD              
Sbjct: 361  NKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDDINNQSTTNTTNNNN 420

Query: 421  XXXXXXXXXXXXXKLDSSKNISQNYPEFINIFQNYCAGNFDDNSKIIALISKILRRLTKF 480
                         KLDSSKNISQNYPEFINIFQNYCAGNFDDNSKIIALISKILRRLTKF
Sbjct: 421  NTTIITTTTTNNNKLDSSKNISQNYPEFINIFQNYCAGNFDDNSKIIALISKILRRLTKF 480

Query: 481  KDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGTSKDTPNGINNQDPQ 540
            KDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGTSKDTPNGINNQDPQ
Sbjct: 481  KDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGTSKDTPNGINNQDPQ 540

Query: 541  FNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLTQFSKFHHDFNDLKVYCIDSETAHEI 600
            FNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLTQFSKFHHDFNDLKVYCIDSETAHEI
Sbjct: 541  FNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLTQFSKFHHDFNDLKVYCIDSETAHEI 600

Query: 601  DDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNMALSKSFTTYLPDLVSPML 660
            DDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNMALSKSFTTYLPDLVSPML
Sbjct: 601  DDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNMALSKSFTTYLPDLVSPML 660

Query: 661  PKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHNTFKVRLGIVSKFPSNTTYDN 720
            PKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHNTFKVRLGIVSKFPSNTTYDN
Sbjct: 661  PKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHNTFKVRLGIVSKFPSNTTYDN 720

Query: 721  VDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQNGNAVIFGEGFNKGLVTLS 780
            VDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQNGNAVIFGEGFNKGLVTLS
Sbjct: 721  VDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQNGNAVIFGEGFNKGLVTLS 780

Query: 781  CSKDGGPVINFKDQNDTKSVTLVTEMMILANSLAARLFKENKIPGIFRCYHELHLAKKAQ 840
            CSKDGGPVINFKDQNDTKSVTLVTEMMILANSLAARLFKENKIPGIFRCYHELHLAKKAQ
Sbjct: 781  CSKDGGPVINFKDQNDTKSVTLVTEMMILANSLAARLFKENKIPGIFRCYHELHLAKKAQ 840

Query: 841  LEFDILRENIKVNSHLPNIKEISKFGSLLNSSFYTDLPLPHQMIGAANYLTVTSPLRRFP 900
            LEFDILRENIKVNSHLPNIKEISKFGSLLNSSFYTDLPLPHQMIGAANYLTVTSPLRRFP
Sbjct: 841  LEFDILRENIKVNSHLPNIKEISKFGSLLNSSFYTDLPLPHQMIGAANYLTVTSPLRRFP 900

Query: 901  DLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKK 960
            DLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKK
Sbjct: 901  DLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKK 960

Query: 961  NPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLKPDLDFTPSIGDVIRNCKIDKIDAL 1020
            NPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLKPDLDFTPSIGDVIRNCKIDKIDAL
Sbjct: 961  NPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLKPDLDFTPSIGDVIRNCKIDKIDAL 1020

Query: 1021 DGRLDFSMV 1029
            DGRLDFSMV
Sbjct: 1021 DGRLDFSMV 1029

>Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {ON}
            YMR287C (REAL)
          Length = 969

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/989 (40%), Positives = 562/989 (56%), Gaps = 105/989 (10%)

Query: 53   EDIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWDSRTIT 112
            ++IE I + FL RIK L+P I +K+L +I  E+ KR+  R+++PS  W+++  W S T  
Sbjct: 68   KEIESINEDFLHRIKGLEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSN-SWRSLT-K 125

Query: 113  PKFSKYMLNSTFSFDAWYQKIISNSFNLTFTKHSLELDPLNIGDLILLPDSSN-LLMCVD 171
            PK   Y L    + D  +   + +S  + F    L  +PLN+GDL+LL    N L MCV 
Sbjct: 126  PKIPSYKL---INLDIHFDTKLESSKQMEFQPAQLMKNPLNVGDLVLLKSRPNELAMCVS 182

Query: 172  IPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHGNNSIGTIK 231
            +P +T DPRYTFAS DG + F T++ + LRIP KLP  + DS L+  E  H +  IGT+K
Sbjct: 183  LPSSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGI-DS-LVQPEDHHKHLPIGTVK 240

Query: 232  NTQNIKILLPIIARQLVVRPILNNLNKSANDXXXXXXXXXXXXHRLIQNGNGPYQISXXX 291
            N  N   +LPI+ARQ++       ++K A              HR +QN  GP+QI    
Sbjct: 241  NFSNQTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFT 300

Query: 292  XXXXXXXXXXXXXXXSKKFDINLNFXXXXXXXXXXXXXXXXXXDASTFLATYWAIRLQQQ 351
                           +K  D                       +++TF++TYWAI  QQ+
Sbjct: 301  LVGLVQKLDL-----NKALDNKNGVNYLADLVNSYKSADSVPMNSATFVSTYWAIVQQQE 355

Query: 352  DFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDDXXXXX 411
              LWGKI +N ALLSP SVT++PL   H YY   +++      N K + D F+       
Sbjct: 356  SNLWGKIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLE--ADNYKDI-DRFVKLVNERK 412

Query: 412  XXXXXXXXXXXXXXXXXXXXXXKLDSSKNISQNYPEFINIFQNYCAGNFDDNSKIIALIS 471
                                       ++IS  YP  I + +++ AGNF +N  I+ LIS
Sbjct: 413  Y--------------------------RDISSLYPSVIQLLKDFAAGNFHNNGIIVTLIS 446

Query: 472  KILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGTSKDTP 531
            KI R++  +K SD+T+D C++L++                                +  P
Sbjct: 447  KIFRKIELYKGSDITRDICQDLVN--------------------------------EILP 474

Query: 532  NGINNQDPQFNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLTQ----FSKFHHDFNDL 587
            N +       N L  N+++ALP SSKL + Q   Y L     + +     +   +DF DL
Sbjct: 475  NKM------INPLLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDL 528

Query: 588  KVYCIDSETAHEIDDGISIE-KLNNNLFTLHIHIADPSSIFLNHEKNSDIQ------NLL 640
            KV+CIDSETAHEIDDG+SIE    + L+TLHIHIADP+S+F    +++DI+      ++L
Sbjct: 529  KVFCIDSETAHEIDDGVSIENHKKDGLYTLHIHIADPASLF---PESTDIESQGITTDVL 585

Query: 641  NMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEV--DSNNESIKIL 698
            N+AL +SFTTYLPDLV PMLP+S C LSDLG   QKT T+SFSV+V+V   S  + I+I+
Sbjct: 586  NVALKRSFTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEII 645

Query: 699  HNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKN 758
            +N+ K+R GIVS FP   TY++VDRILS +  E          + DL +LS IS LL++ 
Sbjct: 646  YNSLKIRKGIVSNFP-KATYNDVDRILSITDSE------APPFKEDLESLSMISKLLREL 698

Query: 759  RIQNGNAVIFGEGFNKGLVTLSCSKDGGPV-INFKDQNDTKSVTLVTEMMILANSLAARL 817
            RI+  NAVIFGEGFN+GLVTL+ +K+G    ++F DQ +T S  LV+EMMILAN+L  R 
Sbjct: 699  RIKKNNAVIFGEGFNRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRF 758

Query: 818  FKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISKFGSLLNSSFYTDL 877
            F ENKI G+FRCY +L L   AQ +++ L  + K     P +++I+K  SLLNSSFYT  
Sbjct: 759  FAENKISGVFRCYKQLPLDAIAQQQYNSLITSAK-KGVFPKLEDITKLSSLLNSSFYTGQ 817

Query: 878  PLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDII 937
            P  H+MIGA  YLTVTSPLRRFPDL+NH+QI   ++KKP  +S   I +++  IQSR  I
Sbjct: 818  PFRHEMIGANQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADI 877

Query: 938  IRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLKP 997
            ++  S   + Y+ LNYLK  +K NP +T+DV+ITSV   GF  C+ P+ S + G LKL P
Sbjct: 878  LKTASRNSSTYWTLNYLKTMMKSNPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNP 937

Query: 998  DLDFTPSIGDVIRNCKIDKIDALDGRLDF 1026
              +  P IGD ++ CKI KID L+G L+ 
Sbjct: 938  STEHYPMIGDTVKTCKILKIDCLEGILEL 966

>Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {ON}
            YMR287C (REAL)
          Length = 969

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/1019 (40%), Positives = 579/1019 (56%), Gaps = 106/1019 (10%)

Query: 26   TKYDYPSRKAYTPPLHNN----VTKHNKL-SNEDIEKIKQTFLIRIKELDPSITIKELPE 80
            TK    +++ YT  L N     VT ++ + S +DIE I + FL R K L+P+I +K+L +
Sbjct: 36   TKQQGKAQEDYTQLLDNGKVSEVTVNSSIKSAKDIESINKDFLHRTKGLEPNIELKQLSQ 95

Query: 81   ITNEYRKRFLQRFIIPSSKWFNSIEWDSRTITPKFSKY-MLNSTFSFDAWYQKIISNSFN 139
            I  E+++R+  R+I PS  W+ +  W S    PK S + ++NS    DA  Q   SN   
Sbjct: 96   IKEEFQQRYRDRYIKPSETWYTN-SWRSLA-KPKISSHNLINSNIQLDA--QLKFSNP-- 149

Query: 140  LTFTKHSLELDPLNIGDLILLPDSSN-LLMCVDIPHNTKDPRYTFASSDGKLFFKTRSNI 198
            L F    L   PLN+GDL+LL    N L MCV +P +T DPRYTF + DG + F T++ I
Sbjct: 150  LEFQPVQLMERPLNVGDLVLLRVRPNELAMCVSLPSSTMDPRYTFVAIDGSMCFATKNRI 209

Query: 199  PLRIPNKLPNYLMDSRLLFTEFDHGNNSIGTIKNTQNIKILLPIIARQLVVRPILNNLNK 258
             LRIP++LP  +  + L+  E  +G+  IGTIKN  N   +LPI ARQ++       ++K
Sbjct: 210  LLRIPHRLP--VGVNSLIQPEERYGHLPIGTIKNFSNQTNILPIAARQIITSRYPAQISK 267

Query: 259  SANDXXXXXXXXXXXXHRLIQNGNGPYQISXXXXXXXXXXXXXXXXXXSKKFDINLNFXX 318
             A              HR +Q+  GP+QI                   ++  D       
Sbjct: 268  LAWRDLPFTTKKLQLLHRSLQDYRGPWQIPFFTLVGLVQRLDL-----NEALDDKYGATY 322

Query: 319  XXXXXXXXXXXXXXXXDASTFLATYWAIRLQQQDFLWGKIQVNKALLSPISVTVLPLVLY 378
                             ++TF++TYWAI  QQ+   WG+I +N ALLSPISVTV+PL   
Sbjct: 323  LANLLGTHQTADNVPISSATFVSTYWAIMQQQESNFWGEIHLNTALLSPISVTVIPLKSR 382

Query: 379  HNYYNNFLQRSNNAIKNGKSLLDSFIDDXXXXXXXXXXXXXXXXXXXXXXXXXXXKLDSS 438
            H YY   + +      N  +     +++                                
Sbjct: 383  HLYYEQVVGKLEADDYNEINRFVKLVNERKY----------------------------- 413

Query: 439  KNISQNYPEFINIFQNYCAGNFDDNSKIIALISKILRRLTKFKDSDLTKDTCKELLDLCT 498
            ++IS  YP  I + +++ AGNF +N  I+ L+SKI R++ ++KD D+T+D C++L++   
Sbjct: 414  RDISTLYPSVIQMLKDFAAGNFHNNGIIVTLVSKIFRKIERYKDCDITRDICQDLIN--- 470

Query: 499  SKGTSKGTSGDASGDASRNTSKDSSQGTSKDTPNGINNQDPQFNLLHNNIEIALPNSSKL 558
                                         +  PN ++N       L  N+++ALP SSKL
Sbjct: 471  -----------------------------EILPNSMSNP------LLLNMDLALPASSKL 495

Query: 559  TKDQTLFYNLIEPPKLTQF----SKFHHDFNDLKVYCIDSETAHEIDDGISIEKLN-NNL 613
             + Q   Y+L     L +     S   +DF DLKV+CIDSETAHEIDDG+SIE    + L
Sbjct: 496  VRSQQKLYDLTNIEDLQRKNSDNSSERYDFGDLKVFCIDSETAHEIDDGVSIENHGTDGL 555

Query: 614  FTLHIHIADPSSIF---LNHEKNSDIQNLLNMALSKSFTTYLPDLVSPMLPKSFCKLSDL 670
            +TLHIHIADP+S+F    N++    I ++LN+AL +SFTTYLPD+V PMLPKS C LSDL
Sbjct: 556  YTLHIHIADPTSMFPESTNYDSEGIITDILNVALERSFTTYLPDVVVPMLPKSICNLSDL 615

Query: 671  GYDNQKTATISFSVNVEVDS--NNESIKILHNTFKVRLGIVSKFPSNTTYDNVDRILSNS 728
            G   QKT TISFSV+V+V S  + ES++I+ ++FK+R GIVS FP   TYD+VDRIL+  
Sbjct: 616  GKQGQKTKTISFSVDVKVMSKGDGESLEIMFDSFKIRKGIVSNFP-KVTYDDVDRILNTP 674

Query: 729  TEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQNGNAVIFGEGFNKGLVTLSCSKDGGPV 788
             +E       S ++ DL +LS +SNLL+  RI+N NAVIFGEGFNKGLVTL+ +++G   
Sbjct: 675  NDE------ASPVKKDLESLSMVSNLLRDRRIKNNNAVIFGEGFNKGLVTLNANEEGELT 728

Query: 789  -INFKDQNDTKSVTLVTEMMILANSLAARLFKENKIPGIFRCYHELHLAKKAQLEFDILR 847
             I+F DQ +T S  LV+EMMILAN+L  + F +NKI G+FRCY +L L   AQ ++D + 
Sbjct: 729  EISFSDQVETLSTVLVSEMMILANTLTGKYFADNKICGVFRCYKQLPLDIIAQEQYDSMI 788

Query: 848  ENIKVNSHLPNIKEISKFGSLLNSSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQ 907
             + K     P +K+I K  SLLNSSFYT  P  H+MIGA  YLTVTSPLRRFPDL+NH+Q
Sbjct: 789  TSTK-KGLFPQLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQ 847

Query: 908  IQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKKNPSQTFD 967
            I   ++KKP  +S   I +++  IQSR  I++      + Y+ LNYLK+  K +P +T+D
Sbjct: 848  IHRHLQKKPLCFSQVQIDRLIWPIQSRADILKRAGRNSSTYWTLNYLKKLKKLDPEKTYD 907

Query: 968  VLITSVSNLGFIHCILPNFSSSMGILKLKPDLDFTPSIGDVIRNCKIDKIDALDGRLDF 1026
            V+IT+V   GF+ C+ P+ S + G LKL P     P IGD+++NCKI +ID L+G L+ 
Sbjct: 908  VMITAVPQNGFVSCVFPDLSFARGTLKLHPSAKHYPMIGDIVKNCKILRIDCLEGMLEL 966

>YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON}
            DSS13'-5' exoribonuclease, component of the mitochondrial
            degradosome along with the ATP-dependent RNA helicase
            Suv3p; the degradosome associates with the ribosome and
            mediates turnover of aberrant or unprocessed RNAs
          Length = 969

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/990 (40%), Positives = 557/990 (56%), Gaps = 105/990 (10%)

Query: 52   NEDIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWDSRTI 111
             +DIE I + FL R K L+P I +K+LP+I  E+ +R+  R++ PS  W+ +  W S T 
Sbjct: 67   EKDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDRYVKPSEDWYVN-SWRSLT- 124

Query: 112  TPKFSKY-MLNSTFSFDAWYQKIISNSFNLTFTKHSLELDPLNIGDLILLPDSSN-LLMC 169
             PK   Y ++NS F         +     + F    L   PLN+GD +LL    N L MC
Sbjct: 125  KPKIPLYKLINSDFQLIT----KLKAPNPMEFQPVQLMESPLNVGDFVLLKMRPNELAMC 180

Query: 170  VDIPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHGNNSIGT 229
            V +P +T DPRYTF + DG + F T++ + LRIP+KLP  +    L+  E  H +  IGT
Sbjct: 181  VSLPSSTMDPRYTFVTIDGTMCFATKNRVLLRIPHKLPAGI--HSLIQPESHHKHLPIGT 238

Query: 230  IKNTQNIKILLPIIARQLVVRPILNNLNKSANDXXXXXXXXXXXXHRLIQNGNGPYQISX 289
            +KN  N   +LPI+ARQL+       ++K A              HR +QN  GP+QI  
Sbjct: 239  VKNFSNQTNILPIVARQLITSRYPAQISKLAWKDLPITTKKLQLLHRSLQNYMGPWQIPF 298

Query: 290  XXXXXXXXXXXXXXXXXSKKFDINLNFXXXXXXXXXXXXXXXXXXDASTFLATYWAIRLQ 349
                             +K  D                       ++ TF++TYWAI  Q
Sbjct: 299  FTLVGLVQKLDL-----NKALDDKNGINYLTSLVNNYHTVNDIPINSPTFVSTYWAIMQQ 353

Query: 350  QQDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDDXXX 409
            Q+  LWG+I +N ALLSPISVT++PL   H YY   +++      N    ++ F+     
Sbjct: 354  QESNLWGEIHLNTALLSPISVTIIPLKSQHLYYAQVIEKLE---ANSYREVNKFVKLVNE 410

Query: 410  XXXXXXXXXXXXXXXXXXXXXXXXKLDSSKNISQNYPEFINIFQNYCAGNFDDNSKIIAL 469
                                         ++IS  YP  I + +++ AGNF +N  I+AL
Sbjct: 411  RKY--------------------------RDISALYPSVIQLLKDFAAGNFHNNGIIVAL 444

Query: 470  ISKILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGTSKD 529
            ISKI R++ ++KD D+T+D C++L++                                + 
Sbjct: 445  ISKIFRKIERYKDCDITRDICQDLIN--------------------------------EI 472

Query: 530  TPNGINNQDPQFNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLTQFSKF-----HHDF 584
            TPN I N       L  N+++ALP SSKL K Q   Y+L    +L Q+ K       +DF
Sbjct: 473  TPNSIPNP------LLLNMDLALPASSKLVKWQQKLYDLTNIEEL-QWKKSGTDDDRYDF 525

Query: 585  NDLKVYCIDSETAHEIDDGISIEKLN-NNLFTLHIHIADPSSIFLNHEKNSDIQ----NL 639
             DL+V+CIDSETAHEIDDG+S++    + L+TL+IHIADP+S+F     N DI+    ++
Sbjct: 526  GDLRVFCIDSETAHEIDDGVSVKNYGRDGLYTLYIHIADPTSMF-PESTNVDIEGISTDI 584

Query: 640  LNMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDS--NNESIKI 697
            LN+AL +SFTTYLPD V PMLP+S C LSDLG   Q+T TISFSV+V++ S  + +SI+I
Sbjct: 585  LNVALKRSFTTYLPDTVVPMLPQSICHLSDLGKQGQRTKTISFSVDVKITSKCSGKSIEI 644

Query: 698  LHNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKK 757
            ++++FK+R GIVS FP   TY++VDRIL     E       S ++ DL +LS IS LL++
Sbjct: 645  MYDSFKIRKGIVSNFP-KATYEDVDRILGTPNSE------ASPVKKDLESLSMISKLLRE 697

Query: 758  NRIQNGNAVIFGEGFNKGLVTLSCSKDGGPV-INFKDQNDTKSVTLVTEMMILANSLAAR 816
             RI+N NAVIFGEGFNKGLV L+   +G    + F DQ +T S  LV+EMMILAN+L  R
Sbjct: 698  QRIKNSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQEETLSTILVSEMMILANTLTGR 757

Query: 817  LFKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISKFGSLLNSSFYTD 876
             F ENKI G+FRCY +L L + AQ ++D +  + K     P +K+I K  SLLNSSFYT 
Sbjct: 758  YFAENKIGGVFRCYKQLPLGEVAQQQYDSMITSTK-KGIFPKLKDIVKLSSLLNSSFYTG 816

Query: 877  LPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDI 936
             P  H+MIGA  YLTVTSPLRRFPDL+NH+QI   ++KKP  ++ T I  ++  IQSR  
Sbjct: 817  RPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFNQTQIDSLIWPIQSRAD 876

Query: 937  IIRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLK 996
            I++  S   + Y+ LNYLK+  K  P +TFDV++TSV   GF  C+ P+ S + G LKL 
Sbjct: 877  ILKRASRNSSTYWTLNYLKKLTKLEPERTFDVMVTSVPQNGFTGCVFPDLSFARGTLKLH 936

Query: 997  PDLDFTPSIGDVIRNCKIDKIDALDGRLDF 1026
            P     P IGD+++NCKI KID L+G L+ 
Sbjct: 937  PSSMHYPMIGDIVKNCKISKIDCLEGMLEL 966

>TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}
            Anc_8.853 YMR287C
          Length = 935

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/988 (38%), Positives = 542/988 (54%), Gaps = 107/988 (10%)

Query: 49   KLSNEDIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWDS 108
            +LS EDIE+I   FL R K+L+P + +K+LP+I  E+R RF  R+  PS  WF    W +
Sbjct: 47   ELSPEDIERINLQFLSRTKDLEPGMEVKQLPQIGREFRDRFDARYYEPSKIWFEK-NWLN 105

Query: 109  RTITPKFSKYMLNSTFSFDAWYQKIISNSFNLTFTKHSLELDPLNIGDLILLPD-SSNLL 167
            RT   KFS+ MLN+         +         +   +L   PL++GDL+LL    S L 
Sbjct: 106  RT---KFSRKMLNAV-------PRKEDTKEVFQYKASALMAKPLDVGDLVLLKSHPSELS 155

Query: 168  MCVDIPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMD-SRLLFTEFDHGNNS 226
            MC+D+P +TKDPRY F + DG L F +RS + +RIP+ LP  L   + LL  E  HG   
Sbjct: 156  MCIDVPSSTKDPRYCFTTVDGSLKFGSRSLVLMRIPHSLPQELSKMAALLVREAKHGFEP 215

Query: 227  IGTIKNTQNIKILLPIIARQLVVRPILNNLNKSANDXXXXXXXXXXXXHRLIQNGNGPYQ 286
            IGTIKN  N  ++LP+IARQLV   +   ++KSA D            HR +Q+  GP  
Sbjct: 216  IGTIKNQANETLVLPVIARQLVTSCVTQRISKSAWDQLPVTIKKLELLHRRLQDSTGPVP 275

Query: 287  ISXXXXXXXXXXXXXXXXXXSKKFDINLNFXXXXXXXXXXXXXXXXXXDASTFLATYWAI 346
            +                   ++  +  +                    D+S  LATYWAI
Sbjct: 276  VPFFDLVMMIQSLDITKAISNRDGEPYIR-----DVIENSRTGSTSTIDSSCALATYWAI 330

Query: 347  RLQQQDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDD 406
              QQ++ L+G IQ++ ALLSP+SV +LP    H +Y+   ++  +   NG+  +  F   
Sbjct: 331  EAQQKNHLFGDIQISGALLSPVSVLILPFASQHLFYSELKEQLKS---NGQEAIQEF--- 384

Query: 407  XXXXXXXXXXXXXXXXXXXXXXXXXXXKLDSSKNISQNYPEFINIFQNYCAGNFDDNSKI 466
                                              ++  +P  I + + Y AGN  ++  I
Sbjct: 385  -----------------------SKLANKGKYTELTTRFPHIIQVLKGYAAGNLHNDEGI 421

Query: 467  IALISKILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGT 526
            ++LI+ I R++ +FKD+D+T+D C++LL                        S+   QGT
Sbjct: 422  VSLIAAIFRKIDEFKDNDITRDACEKLL------------------------SRTLPQGT 457

Query: 527  SKDTPNGINNQDPQFNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLTQFSKFHHDFND 586
             +             N ++ N  + LP+SS  ++ Q   Y+L +P    Q ++  HDF  
Sbjct: 458  VE-------------NPIYANFTLGLPDSSARSRTQQQVYDLSKPAS-AQSTENRHDFKH 503

Query: 587  LKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHE--KNSDIQN-LLNMA 643
            L+VYCIDSE AHEIDDGISIE   N  +TLHIHIADP+S+F   E  + S I + +L +A
Sbjct: 504  LRVYCIDSEEAHEIDDGISIEDCGNGKYTLHIHIADPASLFPESESSEQSGINDEVLKVA 563

Query: 644  LSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHNTFK 703
              + FTTYLPD+VSPMLP++F  + DLG+  +KT TI+FSV+V V   + +IKI  +++K
Sbjct: 564  AERCFTTYLPDVVSPMLPQTFTTVCDLGHQGKKTKTITFSVDVLV--KDGAIKIFFDSYK 621

Query: 704  VRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQNG 763
            +RLG+VS FP   TY+ VDR LS          V  +I  DL+ + +I+ +L++ RIQ  
Sbjct: 622  IRLGLVSNFP-KVTYETVDRYLSEP------KNVNEEILYDLKLMHKIAEILREARIQKD 674

Query: 764  NAVIFGEGFNKGLVTLSCSKDGGPV---INFKDQNDTKSVTLVTEMMILANSLAARLFKE 820
             A++FG GFN+GLV +S      PV   I+F DQ ++KS  LV+E MILANSLA R F E
Sbjct: 675  GAIVFGSGFNQGLVAVS------PVDQEISFFDQKESKSTLLVSEFMILANSLAGRFFAE 728

Query: 821  NKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISKFGSLLNSSFYTDLPLP 880
             +IPGIFR Y  L L  +A  E++ +++++K    LP  K+I+   SLLNSSFY + P  
Sbjct: 729  KEIPGIFRTYQPLTLRGQADQEYERMKKSVK-KGILPTTKDINMLSSLLNSSFYCEYPTA 787

Query: 881  HQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRE 940
            H MIGA+ YLTVTSPLRRFPD++NH+QI   ++  P  ++   + KML  IQ RD  +++
Sbjct: 788  HAMIGASQYLTVTSPLRRFPDIINHLQIHRVLRNLPLCFTEDALSKMLWHIQLRDAALKK 847

Query: 941  LSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLKPDLD 1000
             S     Y+ L Y+K  I+  P Q FDV ITSV  L    C+L NF S+ G+LKLKP   
Sbjct: 848  ASAHQASYWTLKYIKNLIRDTPHQRFDVTITSVPQLNVARCVLANFPSARGVLKLKPSAT 907

Query: 1001 FTPSIGDVIRNCKIDKIDALDGRLDFSM 1028
              P++GD ++ CK+ KID LD  L+  +
Sbjct: 908  NIPTVGDTVKGCKVSKIDCLDSLLELEL 935

>Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {ON}
            YMR287C (REAL)
          Length = 969

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/989 (38%), Positives = 557/989 (56%), Gaps = 101/989 (10%)

Query: 51   SNEDIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWDSRT 110
            + +DIE I + FL R K L+P I +K+L +I  E+ +R+  R+I PS  W+ +  W S T
Sbjct: 66   TEKDIESINKDFLQRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAWYTNT-WRSLT 124

Query: 111  ITPKFSKY-MLNSTFSFDAWYQKIISNSFNLTFTKHSLELDPLNIGDLILLPDSSN-LLM 168
              PK S + ++NS    D   + +      + F    L  +PLN+GDL+LL    N L M
Sbjct: 125  -KPKISFHKLINSDVQLDTKLKDLDP----MEFQPAQLMENPLNVGDLVLLKVKPNELAM 179

Query: 169  CVDIPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHGNNSIG 228
            CV +P +T DPRYTF + DG + F T++ + LRIP+KLP  +  + L+  E  H +  IG
Sbjct: 180  CVSLPSSTMDPRYTFVAIDGTMCFATKNRVLLRIPHKLP--VGVNSLIQPEGHHKHLPIG 237

Query: 229  TIKNTQNIKILLPIIARQLVVRPILNNLNKSANDXXXXXXXXXXXXHRLIQNGNGPYQIS 288
            T+KN  N   +LPI+ RQL+       ++K A              HR +QN  GP+QI 
Sbjct: 238  TLKNISNQTNILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIP 297

Query: 289  XXXXXXXXXXXXXXXXXXSKKFDINLNFXXXXXXXXXXXXXXXXXXDASTFLATYWAIRL 348
                              +K  D                       ++ TF++TYWAI  
Sbjct: 298  FFTLVGLVQKLDL-----NKALDGKYGIDYLTDLVNNYHTADNVAINSPTFVSTYWAILQ 352

Query: 349  QQQDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDDXX 408
            QQ+  LWG+I +N ALLSPISVT++PL   H YY   +++      N    +++F+    
Sbjct: 353  QQESNLWGEIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLE---ANSYKEVNTFVKLVN 409

Query: 409  XXXXXXXXXXXXXXXXXXXXXXXXXKLDSSKNISQNYPEFINIFQNYCAGNFDDNSKIIA 468
                                          ++IS  YP  I + +++ AGNF +N  I+ 
Sbjct: 410  ERKY--------------------------RDISNLYPSVIQLLKDFAAGNFHNNGIIVT 443

Query: 469  LISKILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGTSK 528
            LISKI R++ ++KD D+T+D C++L++                                +
Sbjct: 444  LISKIFRKIVRYKDYDITRDVCQDLIN--------------------------------E 471

Query: 529  DTPNGINNQDPQFNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLTQFSKF----HHDF 584
              PN ++N       L  N+++ALP+SSKL + Q   Y L     L + +       +DF
Sbjct: 472  IVPNSLSNP------LLLNMDLALPSSSKLMESQQKLYYLTNIEDLQRENSGNDSDRYDF 525

Query: 585  NDLKVYCIDSETAHEIDDGISIEKLN-NNLFTLHIHIADPSSIFLNHEKNSDI---QNLL 640
             DL+V+CIDS+TAHEIDDG+S+E    + ++TLHIHIADP+S+F        +    ++L
Sbjct: 526  GDLRVFCIDSDTAHEIDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDIL 585

Query: 641  NMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEV--DSNNESIKIL 698
            N+A  +SFTTYLPD+V PMLP++ C LSDLG   ++T TISFSV+V+V      +S++I+
Sbjct: 586  NIAFKRSFTTYLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKSLEIM 645

Query: 699  HNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKN 758
            +++F++R G VS FP   TYD+VD+ILS    E      +S ++ DL +LS IS LL++ 
Sbjct: 646  YDSFRIRKGFVSNFP-KATYDDVDKILSAPDNE------SSPVKADLESLSMISKLLREQ 698

Query: 759  RIQNGNAVIFGEGFNKGLVTLSCSKDGGPV-INFKDQNDTKSVTLVTEMMILANSLAARL 817
            RI+  NAVIFGEGFNKG+VTL+ + +G    ++F +Q +T S  LV+EMMILAN+L  R 
Sbjct: 699  RIKKNNAVIFGEGFNKGMVTLNANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRY 758

Query: 818  FKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISKFGSLLNSSFYTDL 877
            F EN I G+FRCY +L L   AQ ++D +    K     P +++I K  SLLNSSFYT  
Sbjct: 759  FAENNIGGVFRCYKQLPLDLIAQQQYDSMITGTK-KGLFPKLRDIVKLSSLLNSSFYTGR 817

Query: 878  PLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDII 937
            P  H+MIGA  YLTVTSPLRRFPDL+NH+QI   ++KKP  ++ T I  ++  IQSR  I
Sbjct: 818  PFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADI 877

Query: 938  IRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLKP 997
            ++  S   + Y+ LNYLK+  K +P +T+DV+ITSV   GF  C+ P+ S + G LKL+P
Sbjct: 878  LKRASRDSSTYWTLNYLKKLAKSDPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQP 937

Query: 998  DLDFTPSIGDVIRNCKIDKIDALDGRLDF 1026
               + P IGD++++CKI KID L+G L+ 
Sbjct: 938  KAKYYPMIGDIVKDCKISKIDCLEGMLEL 966

>ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa] {ON}
            similar to uniprot|P39112 Saccharomyces cerevisiae
            YMR287C MSU1 RNase component of the mitochondrial
            degradosome along with the ATP-dependent RNA helicase
            Suv3p the degradosome associates with the ribosome and
            mediates turnover of aberrant or unprocessed RNAs
          Length = 966

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/1010 (37%), Positives = 548/1010 (54%), Gaps = 106/1010 (10%)

Query: 28   YDYPSRKAYTPPLHNNVTKHNKLSNEDIEKIKQTFLIRIKELDPSITIKELPEITNEYRK 87
            +  P+R    PP          LS EDI++I   FL R K+L+P + +K+L  I  E+  
Sbjct: 54   FSIPNRAMLDPP--------TPLSQEDIDRINYMFLSRTKDLEPGVEVKDLNRIKQEFYS 105

Query: 88   RFLQRFIIPSSKWFNSIEWDSRTITPKFSKYMLNSTFSFDAWYQKIISNSFNLTFTKHSL 147
            R+  R++ P + WF   E +   +   FS+ ++N+    D     I +  F L F    L
Sbjct: 106  RYGARYLNPCNSWFQRSEQN--ILGKSFSRSLINA----DPEALGIKNKRF-LKFDPKEL 158

Query: 148  ELDPLNIGDLILLP-DSSNLLMCVDIPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKL 206
               PL IGDL+LL   S  L MC+D+P +T+DPRYTF + DG + F TR+ + +RIP+ L
Sbjct: 159  MSRPLQIGDLVLLKHQSPQLCMCIDVPSSTRDPRYTFTTVDGTIIFSTRNKVLMRIPHHL 218

Query: 207  PNYLMDSRLLFTEFDHGNNSIGTIKNTQNIKILLPIIARQLVVRPILNNLNKSANDXXXX 266
            PN      LL  E  HG   +G +KNT     +LPI+ RQ +  PI + ++K A +    
Sbjct: 219  PNV----PLLMKEMKHGFEPVGCVKNTTTETFILPIVPRQQITSPISHQISKRAWEEMPF 274

Query: 267  XXXXXXXXHRLIQNGNGPYQISXXXXXXXXXXXXXXXXXXSKKFDINLNFXXXXXXXXXX 326
                    HR +Q+  GP+Q+                   S     N             
Sbjct: 275  TLKKLELLHRHLQDARGPWQVPFMNLVSMVEKLDMQLASAS-----NTGAAYVEDLIRTC 329

Query: 327  XXXXXXXXDASTFLATYWAIRLQQQDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFL 386
                    D++ FL+ Y AI  QQQ  LWG I  ++ALLSP+SVTV+PL   H Y+ + L
Sbjct: 330  TFEPQAKLDSAIFLSVYCAIENQQQSHLWGNIHSSRALLSPVSVTVMPLRSQHLYHRSVL 389

Query: 387  Q----RSNNAIKNGKSLLDSFIDDXXXXXXXXXXXXXXXXXXXXXXXXXXXKLDSSKNIS 442
            Q    R+  A+     L+D+                                        
Sbjct: 390  QNLKVRNYEAVSKFARLVDT---------------------------------GKYNEAI 416

Query: 443  QNYPEFINIFQNYCAGNFDDNSKIIALISKILRRLTKFKDSDLTKDTCKELLDLCTSKGT 502
              YPE + + Q+Y AGNF +++  I+++SKI R++ +F++ D+T+D C +LL        
Sbjct: 417  MEYPEIVKLLQDYAAGNFYNDATAISVVSKIFRKIQRFQEEDITRDICHQLLK------- 469

Query: 503  SKGTSGDASGDASRNTSKDSSQGTSKDTPNGINNQDPQFNLLHNNIEIALPNSSKLTKDQ 562
                              DSSQ T               N LH N+++ LP+SS  +  +
Sbjct: 470  ----------------ELDSSQTTR--------------NPLHYNLDLGLPSSSLRSSSE 499

Query: 563  TLFYNLIEPPKLT-QFSKFHHDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIA 621
               YNL  P     Q     HDF D+KVYCIDSETAHEIDDG+SIE  ++   TLHIHIA
Sbjct: 500  QDIYNLAHPVTFEGQDKNLRHDFGDMKVYCIDSETAHEIDDGVSIESHSDVKRTLHIHIA 559

Query: 622  DPSSIFLN-HEKNSDIQN-LLNMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTAT 679
            DP+S F    E    I++ +L +AL+KSFTTYLPDL+SPMLP S+ K +DLG   QK  T
Sbjct: 560  DPASFFRECQEGTHGIESEILQIALNKSFTTYLPDLMSPMLPGSYSKAADLGKQGQKAKT 619

Query: 680  ISFSVNVEVDSNNESIKILHNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTS 739
            I+FSV+     N +  ++   +F+++LG+VS FP   TY+ VD +L+ ++E    S   +
Sbjct: 620  ITFSVDGSWIKNGQ-FQLQPESFRIKLGLVSNFP-QVTYNTVDSMLAQASEVKNGSANLT 677

Query: 740  DIQNDLRNLSQISNLLKKNRIQNGNAVIFGEGFNKGLVTLSCSKDGG-PVINFKDQNDTK 798
            D Q +L+ L  IS  L+ NRI    AV+FG  FNKG V LS  ++G    ++FKDQ +T 
Sbjct: 678  DDQRNLKELYAISQNLRANRINTQQAVVFGSEFNKGQVALSPDENGVLQKVSFKDQLETP 737

Query: 799  SVTLVTEMMILANSLAARLFKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPN 858
            S  LV+EMMILAN+L+ + FK+N +PG+FRCY  L L  +AQ E+++L+  IK    L  
Sbjct: 738  SSVLVSEMMILANTLSGQFFKDNNLPGVFRCYQPLALGPQAQNEYELLKSKIKEGKSL-T 796

Query: 859  IKEISKFGSLLNSSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFK 918
             K+I    ++LNSSFY+     H+MIGA +YLTVTSPLRRFPD++NH+QI   +K  P  
Sbjct: 797  FKDICMISTILNSSFYSSDGYRHEMIGAPHYLTVTSPLRRFPDMINHLQIHRLLKGLPLC 856

Query: 919  YSTTDIQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGF 978
            ++  D+ + +  IQSRD I+++ S   N Y+ L YLK+ ++ + ++ F V+I SV  +GF
Sbjct: 857  FNKDDVDRFVWHIQSRDSILKDASRCSNTYWTLKYLKQLVENDKNKKFSVMINSVPQVGF 916

Query: 979  IHCILPNFSSSMGILKLKPDLDFTPSIGDVIRNCKIDKIDALDGRLDFSM 1028
            + C+LP++SS+   LKLKP+    P IGD+I NC+I KIDAL+G L+  +
Sbjct: 917  VRCVLPDYSSARATLKLKPNEISHPVIGDIIENCRITKIDALEGLLEMEL 966

>NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853
            YMR287C
          Length = 940

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/996 (38%), Positives = 545/996 (54%), Gaps = 108/996 (10%)

Query: 45   TKHNKLSNEDIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSI 104
            T+  +LS +DI+ I+++FL R   L+P+I +K LP+I  EY KRFL R+I PS  W+ ++
Sbjct: 37   TESKRLSPDDIKFIRESFLKRTNWLEPNIQLKSLPQIYREYEKRFLSRYIRPSKFWYETL 96

Query: 105  EWDSRTITPKFSKYMLNSTFSFDAWYQKIISNSFNLTFTKHSLELDPLNIGDL-ILLPDS 163
             W +    P F+K  LN+    D+  +K +     L F  + L   PL I DL IL    
Sbjct: 97   -WLNNDTKPPFNKLFLNNPLP-DSISKKQL-----LNFDYNDLAKTPLKIRDLAILRATP 149

Query: 164  SNLLMCVDIPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHG 223
            S L MCV +P + +DPRYTFAS  GKL+F  RS I +RIP ++P  +    L+  E  H 
Sbjct: 150  SELSMCVQLPESVEDPRYTFASRSGKLYFVYRSMIKIRIPYQVPKGIQG--LILKELQHE 207

Query: 224  NNSIGTIKNTQNIKILLPIIARQLVVRPILNNLNKSANDXXXXXXXXXXXXHRLIQNGNG 283
             + IGT+K+      +LP +AR L+ R  L+++NK+A+             HR +QN  G
Sbjct: 208  FSPIGTLKSNTKDTFILPYLARNLLSRTGLSDINKAASYQRPIVMKKLELLHRYLQNDKG 267

Query: 284  PYQISXXXX---XXXXXXXXXXXXXXSKKFDINLNFXXXXXXXXXXXXXXXXXXDASTFL 340
            P  I                         + INL                    +AS  +
Sbjct: 268  PTSIPFTHLINLVNKLDLSQALHLQAGNDYIINL---------IKEANDPPSIMNASLTI 318

Query: 341  ATYWAIRLQQQDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLL 400
            A YW++    + FLW  I  N A L P +VTVLPL+ Y  +Y   ++   +  +N    L
Sbjct: 319  AVYWSLVELSETFLWDGINRNSASLFPTTVTVLPLLSYRVHYTELIE---DLERNNYKQL 375

Query: 401  DSF---IDDXXXXXXXXXXXXXXXXXXXXXXXXXXXKLDSSKNISQNYPEFINIFQNYCA 457
            + F   ++D                              + + I Q++ + IN+ Q Y A
Sbjct: 376  NKFSNLVNDK-----------------------------NYQEIEQSFSKIINLLQEYTA 406

Query: 458  GNFDDNSKIIALISKILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRN 517
            GN  +N KI  LISK+ R + +++  D+T+D C ELL    S                  
Sbjct: 407  GNLQNNPKITTLISKLFRGIKEYQRCDITRDLCNELLMKFPS------------------ 448

Query: 518  TSKDSSQGTSKDTPNGINNQDPQFNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKL--T 575
                                 P  N L  N ++A    S+  + Q + Y+ ++P  L   
Sbjct: 449  -------------------IKPNSNPLLKNHDLATRADSQHGQRQQILYDYVKPNDLLIQ 489

Query: 576  QFSKFHHDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIF--LNHEKN 633
            +  +   DF DL+VYCIDSETAHEIDDGISIEK  N  FTLHIHIADP+  F   N+EK 
Sbjct: 490  ESLRDRFDFGDLRVYCIDSETAHEIDDGISIEKKFNGKFTLHIHIADPAIFFPECNNEKG 549

Query: 634  S-DIQN-LLNMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSN 691
               +Q+ +L +A   SFTTYLPD V PMLPKS+CK++DLG + +KT +ISFSV+V ++  
Sbjct: 550  VLGLQDDVLKIAYENSFTTYLPDTVVPMLPKSYCKMADLGINGKKTPSISFSVDVILNKE 609

Query: 692  NESIKILHNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQI 751
              ++KI ++TF++RLG+VS FP   TYDNVD ILS+      K      +Q+DLR LS I
Sbjct: 610  KSNLKICYDTFQIRLGLVSNFPK-ATYDNVDDILSSEVNSEQKL-----LQDDLRQLSMI 663

Query: 752  SNLLKKNRIQNGNAVIFGEGFNKGLVTLSC-SKDGGPVINFKDQNDTKSVTLVTEMMILA 810
            + +L+  R Q   A+ FGEGFN+G    S  S+    VI+F DQ +TKS  LVTE+MILA
Sbjct: 664  AGILRNKRTQENGAITFGEGFNRGTPKYSEDSETESDVISFVDQKNTKSNELVTELMILA 723

Query: 811  NSLAARLFKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISKFGSLLN 870
            N+L  R FKENKI G++RCY++L+L  KA+++++ LRE  K N  LP +++I K  SLLN
Sbjct: 724  NTLCGRYFKENKIFGVYRCYNDLNLEPKAKMQYNKLREECK-NGKLPTLEDIVKVQSLLN 782

Query: 871  SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPI 930
            SS+Y++ P  H MIG+  YLTVTSPLRRF DLV+H+Q+ + +K  P  ++   I+  +P 
Sbjct: 783  SSYYSEHPSRHDMIGSEQYLTVTSPLRRFTDLVSHIQLHNHLKGHPLPFNQKAIRNFVPH 842

Query: 931  IQSRDIIIRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSM 990
            IQSR   +R++S + N    L+YLK  +K  P   FDV ITSV + G   C++P +S + 
Sbjct: 843  IQSRADKLRKISTESNVCMTLSYLKNLLKTKPDTMFDVKITSVPSEGRARCLIPEYSFAR 902

Query: 991  GILKLKPDLDFTPSIGDVIRNCKIDKIDALDGRLDF 1026
            G ++L P L   P +GD + +CK+ KI  +DG L+F
Sbjct: 903  GEIRLSPSLKVYPKVGDTVNSCKVVKISCVDGILEF 938

>KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {ON}
            Anc_8.853 YMR287C
          Length = 929

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/979 (35%), Positives = 537/979 (54%), Gaps = 103/979 (10%)

Query: 54   DIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWDSRTITP 113
            DIE+I + FL R K+L+P + IK+L +I  E+  RF +R+  PS +WF     D+  + P
Sbjct: 51   DIERINEMFLSRTKDLEPGMEIKKLKQIKKEFNTRFAERYFNPSKQWFQ----DNWVVEP 106

Query: 114  KFSKYMLNSTFSFDAWYQKIISNSFNLTFTKHSLELDPLNIGDLILL-PDSSNLLMCVDI 172
                    +T    +    +   + + TF         L +GDL+L  P  + L MCV +
Sbjct: 107  S------TNTAGKSSSQNSMTGKNKHYTFKLSEFISSVLQMGDLVLTTPYPNELAMCVGL 160

Query: 173  PHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHGNNSIGTIKN 232
            P + +DPRYTF +  GK+FF T+S + LRIP +LP  +    L+  E  H    +GTIK 
Sbjct: 161  PESAEDPRYTFVTVSGKMFFGTKSFVHLRIPYRLPEKV--RYLISKEGPHAFEPVGTIKG 218

Query: 233  TQNIKILLPIIARQLVVRPILNNLNKSANDXXXXXXXXXXXXHRLIQNGNGPYQISXXXX 292
            T+++  +LP +ARQLV   + + +NK A               R ++  NG +Q+     
Sbjct: 219  TRDVTYILPYLARQLVTSELPSQINKLAWQKLPSIIKRLELLSRYLRKYNGTWQVPFVQL 278

Query: 293  XXXXXXXXXXXXXXSKKFDINLNFXXXXXXXXXXXXXXXXXXDASTFLATYWAIRLQQQD 352
                                   F                   A+T+LATYWAI+ QQ  
Sbjct: 279  VDAVQRLEEKGGPG--------EFEYIKSLFERPSLGSRRSIHAATYLATYWAIKEQQNF 330

Query: 353  FLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDDXXXXXX 412
             +WGKI VNKA L+PIS +V+P     ++++  +   N+  +   + +   I+       
Sbjct: 331  NIWGKIHVNKAFLAPISTSVVPAASLRSFHDELI---NDPKRKHVNKITDLINTKDYEL- 386

Query: 413  XXXXXXXXXXXXXXXXXXXXXKLDSSKNISQNYPEFINIFQNYCAGNFDDNSKIIALISK 472
                                        + + YPEF+ +  ++ AGNFD+N +++ LIS+
Sbjct: 387  ----------------------------VRERYPEFLQLLSDFTAGNFDNNCEVVTLISQ 418

Query: 473  ILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGTSKDTPN 532
            I R L  +++ ++T+DTC +LL                         K+ S+    + P 
Sbjct: 419  IFRMLDVYRECNVTRDTCFDLL-------------------------KEISEDNFCENP- 452

Query: 533  GINNQDPQFNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLTQFSKFHHDFNDLKVYCI 592
                       + +N ++AL  SS+ +  Q   Y++++P          HDF D+ VYCI
Sbjct: 453  -----------ILSNSDLALAQSSERSALQKCVYSVVQPDIQLDTKTKRHDFLDMPVYCI 501

Query: 593  DSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIF-LNHEKNSDIQNLLNMALSKSFTTY 651
            DSETAHEIDDG+SIEK     +TLH+HIADP+S F  ++ +++ + ++L +A  KSFTTY
Sbjct: 502  DSETAHEIDDGVSIEKNGKGSYTLHVHIADPASFFPESYTESTKLSDVLKIAFDKSFTTY 561

Query: 652  LPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHNTFKVRLGIVSK 711
            LPD+V  MLP+SFC+ +DLG  ++KT TI+FSV V++D +   + I  +TF+ RLG+VS 
Sbjct: 562  LPDVVEAMLPESFCRAADLGKQDKKTRTITFSVRVKMDEHG-GLHIQSDTFRARLGLVSN 620

Query: 712  FPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQNGNAVIFGEG 771
            FP   TY+ VD +L++S+         S ++ DL  L +I++ L+ NR++   AV+FGEG
Sbjct: 621  FP-KVTYNIVDSVLNDSSS-------NSPLRQDLLTLYKIASGLRHNRVKLNGAVVFGEG 672

Query: 772  FNKGLVTL-SCSKDGGPVINFKDQNDTKSVTLVTEMMILANSLAARLFKENKIPGIFRCY 830
            FN G V L   S +    I F++ N+T S  LV+E+MILAN+L+   F+ENKIPGIFRCY
Sbjct: 673  FNNGQVRLIRDSANKVKDITFENNNETPSTVLVSELMILANTLSGNFFRENKIPGIFRCY 732

Query: 831  HELHLAKKAQLEFDILRENIKVNSHLPNIKEISKFGSLLNSSFYTDLPLPHQMIGAANYL 890
            +EL L  KA  ++  +++N++   + P +K+I+K  SL+NSSFY+  P  HQMIGA  YL
Sbjct: 733  NELKLDGKALSDYRSIQDNVQRGKN-PTLKDIAKITSLMNSSFYSGEPRNHQMIGAKQYL 791

Query: 891  TVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYL 950
            TVTSPLRR+PDL+NH+Q+   +  KP  +S   I +M+  +QSR  I++ +S   + Y+ 
Sbjct: 792  TVTSPLRRYPDLINHIQLHKHLANKPLTFSQQAIDQMIWQVQSRADILKSISTTVSAYWT 851

Query: 951  LNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLKPDLDFTPSIGDVIR 1010
            L YLK++I+K+ S  FDV++TS    G ++C+ PN S + G LKLK D    P IGD+++
Sbjct: 852  LTYLKKRIEKDSSARFDVMVTSFPQDGMVNCLFPNHSYARGKLKLKVD-RLPPQIGDIVK 910

Query: 1011 NCKIDKIDALDGRLDFSMV 1029
            +C+I  ID LD  L   MV
Sbjct: 911  DCQITSIDCLDSNLQLVMV 929

>SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar to
            uniprot|P39112 Saccharomyces cerevisiae YMR287C MSU1
            RNase component of the mitochondrial degradosome along
            with the ATP-dependent RNA helicase Suv3p the degradosome
            associates with the ribosome and mediates turnover of
            aberrant or unprocessed RNAs
          Length = 936

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/1019 (36%), Positives = 544/1019 (53%), Gaps = 113/1019 (11%)

Query: 33   RKAYTPPLHNNVTKHNKLSNEDIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQR 92
            R+ +T  L          S +++EKI   F    K+L+P + IK+L ++  +   R+  R
Sbjct: 5    RRIHTTRLLRRKVASGDRSKDNLEKI---FFSHAKDLEPEVEIKQLSQVRQDSDNRYYHR 61

Query: 93   FIIPSSKWFNSIEWDSRT--------ITPKFS--KYMLNSTFSFDAWYQKIISNSFNLTF 142
            +  PS  WF   +  SRT        + P+ S  KY+L +    +  Y K    S     
Sbjct: 62   YFTPSKIWFT--QNVSRTQSFKHFFNLDPQRSSDKYILPTLN--ERLYDK---GSHTFYL 114

Query: 143  TKHSLELDPLNIGDLILL-PDSSNLLMCVDIPHNTKDPRYTFASSDGKLFFKTRSNIPLR 201
            +   L   PL IGDL+LL  + + L MCVD+P +  DPRYTFAS DG L F  R+ I LR
Sbjct: 115  SPSDLMNTPLKIGDLVLLRSNPTQLSMCVDLPTDIMDPRYTFASMDGGLQFAARTMIMLR 174

Query: 202  IPNKLPNYLMDSRLLFTEFDHGNNSIGTIKNTQNIKILLPIIARQLVVRPILNNLNKSAN 261
            IP+     L    L+  E  H    IG +KN+     +LPI+ARQL+   +   + K A 
Sbjct: 175  IPSCHKQEL--DGLVQLERKHSYEPIGVVKNSPTHTYVLPILARQLITSYVPFEITKKAW 232

Query: 262  DXXXXXXXXXXXXHRLIQNGNGPYQISXXX----------XXXXXXXXXXXXXXXSKKFD 311
            +            HR +Q   GP+QIS                            S  F 
Sbjct: 233  NQVPIVSKKLELLHRFLQRSTGPWQISIFTLCELVQNLDLQRALSKQDGSLQDYMSSLFQ 292

Query: 312  -INLNFXXXXXXXXXXXXXXXXXXDASTFLATYWAIRLQQQDFLWGKIQVNKALLSPISV 370
             + L+                   DAS FL+TYW++  QQ+  +WG IQ ++ +L+PISV
Sbjct: 293  KVGLDSNLYCLGEQNLHVNPPNKIDASYFLSTYWSLVKQQELQIWGGIQTHRGILTPISV 352

Query: 371  TVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDDXXXXXXXXXXXXXXXXXXXXXXXX 430
            TVLPL   H YY N +   +   ++   +LD F +                         
Sbjct: 353  TVLPLNSEHLYYENVV---STLKQDNYRMLDEFAE------------------------- 384

Query: 431  XXXKLDSSKNISQNYPEFINIFQNYCAGNFDDNSKIIALISKILRRLTKFKDSDLTKDTC 490
                  + K I   +P+ I I +NY AGNF++N  +I L+SKI R+L  +K+ D T+D C
Sbjct: 385  -LVNKKNYKPIQNRFPQLIQILKNYAAGNFNNNGAMITLVSKIFRKLHTYKERDTTRDMC 443

Query: 491  KELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGTSKDTPNGINNQDPQFNLLHNNIEI 550
             ELL                                ++ +P+ +       N L  N ++
Sbjct: 444  HELL--------------------------------TQISPDKL------INPLLLNKDL 465

Query: 551  ALPNSSKLTKDQTLFYNLIEPPKLTQFSKFHHDFNDLKVYCIDSETAHEIDDGISIEKLN 610
             LP +S+ +  + + Y++ +PP     S   HDF D+ VYCIDSETAHEIDDGISIE L+
Sbjct: 466  GLPMASQRSALEQVVYDISKPPLTEDDSYVRHDFGDMPVYCIDSETAHEIDDGISIETLS 525

Query: 611  NNLFTLHIHIADPSSIFLNHEKNSDIQNLLNMALSKSFTTYLPDLVSPMLPKSFCKLSDL 670
               + LHIHIADP+S F          ++L++A  +SFTTYLPD+V PMLP+S+C+ +DL
Sbjct: 526  EKKYRLHIHIADPASSFAKSTDPEARDDVLDIAFQRSFTTYLPDMVLPMLPESYCRAADL 585

Query: 671  GYDNQKTATISFSVNVEVDSNNESIKILHNTFKVRLGIVSKFPSNTTYDNVDRILSNSTE 730
            G D  KT T+SFS+++    +  ++++L +TFK+RLG+VS+FP   TY+ VD IL    E
Sbjct: 586  GKDGNKTKTLSFSIDIYF--HQGTLRLLDDTFKMRLGLVSRFP-RVTYEKVD-ILLQYPE 641

Query: 731  ENLKSGVTSDIQNDLRNLSQISNLLKKNRIQNGNAVIFGEGFNKGLVTLSCSKDGGPV-I 789
            +  K        +DL+ + +++  L+  R++N +A+IFGEGFNKGLV LS  + G    I
Sbjct: 642  KQPKEA------SDLKLMYEVAKSLRAKRVKNQDAIIFGEGFNKGLVKLSPDETGELTKI 695

Query: 790  NFKDQNDTKSVTLVTEMMILANSLAARLFKENKIPGIFRCYHELHLAKKAQLEFDILREN 849
            +F+DQ ++KS  LV+EMMILAN+L    FK+NKIPG+FRCY+EL L  +A  E+  ++E 
Sbjct: 696  SFEDQVESKSTVLVSEMMILANTLTGGYFKKNKIPGVFRCYNELQLKDRALKEYTKMKEM 755

Query: 850  IKVNSHLPNIKEISKFGSLLNSSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQ 909
             K +   P I++I+   SLLNSSFYT  P  H+MIGA+ YLTVTSPLRRFPD++NH+QI 
Sbjct: 756  TK-SGQFPTIRDINTISSLLNSSFYTGKPKKHEMIGASEYLTVTSPLRRFPDMINHLQIH 814

Query: 910  HFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKKNPSQTFDVL 969
              ++  P  +S  ++  +   IQSRD++++  +     Y+ L +LK +++K     F V+
Sbjct: 815  RHLRGLPLCFSQQEVDGITWHIQSRDVVLKNAARMSATYWTLKFLKNELEKKKDIRFTVM 874

Query: 970  ITSVSNLGFIHCILPNFSSSMGILKLKPDLDFTPSIGDVIRNCKIDKIDALDGRLDFSM 1028
            +TSV ++G + C  PN +++ G L L P     P+IGD+I  CK+ K+D LDG ++  +
Sbjct: 875  VTSVPHMGTVSCAFPNLNAARGTLNLDPKHTPYPAIGDLIHKCKLTKLDCLDGVIELEI 933

>Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {ON}
            YMR287C (MSU1) - component of 3'-5'exonuclease complex
            [contig 39] FULL
          Length = 936

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/985 (35%), Positives = 521/985 (52%), Gaps = 105/985 (10%)

Query: 65   RIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWF--NSIEWDSRT--ITPKFSKYML 120
            R  +L+P + IK+L EI +    R+ ++++IPS +W   N  +W      +         
Sbjct: 37   RAGQLEPGVEIKQLSEIQSGLNDRYYEQYLIPSKEWCRDNGTKWGGMKNYLNMDLMSLSE 96

Query: 121  NSTFSFDAWYQKIISNSFNLTFTKHSLEL--DPLNIGDLILL-PDSSNLLMCVDIPHNTK 177
                  DA  +  + +  + TF     EL   PL IGDL+LL  + + L  CV++P +  
Sbjct: 97   KQQADMDASLEPKVYDKTSETFRLVPKELLKSPLKIGDLVLLRSNPTQLCTCVEVPTDVM 156

Query: 178  DPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHGNNSIGTIKNTQNIK 237
            +P Y FA+ DG++ +  RS I LRIP+   +      L+  E  + +  IGT+K++    
Sbjct: 157  NPSYAFATIDGQIKYAMRSMILLRIPSF--HRRSAHHLIREEKPYLDARIGTVKDSPEKT 214

Query: 238  ILLPIIARQLVVRPILNNLNKSANDXXXXXXXXXXXXHRLIQNGNGPYQISXXXXXXXXX 297
             +LPI+ARQL        + K A              HR +Q  +GP+Q+S         
Sbjct: 215  FILPILARQLYTSYAPFKITKQAWSRMAILTQKLELLHRFLQRSSGPWQVSIFKLCQMAV 274

Query: 298  XXXXXXXXXSKKFD--------INLNFXXXXXXXXXXXXXXXXXXDASTFLATYWAIRLQ 349
                     S            + LN                   DA+ +LAT+WA+  Q
Sbjct: 275  MLDLEKFRSSHAESYIKELFQKLGLNGSPNSFQKQSGNLHYIESVDAADYLATFWALEQQ 334

Query: 350  QQDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDDXXX 409
            Q++ LWG+ Q ++A+L+P+SVTVLPL   H YY   L+   +  K+   L+  F      
Sbjct: 335  QENNLWGQFQTHQAMLAPLSVTVLPLASRHLYYETVLK---DLKKDNHRLITKFAG---- 387

Query: 410  XXXXXXXXXXXXXXXXXXXXXXXXKLDSSKNIS---QNYPEFINIFQNYCAGNFDDNSKI 466
                                     L +S N +      P+F  I ++Y AGNF +N  +
Sbjct: 388  -------------------------LVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGAM 422

Query: 467  IALISKILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGT 526
              ++SK+ R +  FK  D+T+D C EL++  + + T                        
Sbjct: 423  ATVVSKLFRSIDVFKGRDITRDLCHELMEKLSHRNT------------------------ 458

Query: 527  SKDTPNGINNQDPQFNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLTQF-SKFHHDFN 585
                           N L  + ++ALP+SS  T  +   Y + +P       ++F  DF+
Sbjct: 459  --------------LNPLLLSDDLALPSSSANTALEEKIYEMAQPSTKEDIPARF--DFS 502

Query: 586  DLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNMALS 645
             + VYCIDSE+AHEIDDGISIE L  N FTLHIHIADP S+F           + N+A  
Sbjct: 503  SMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVSLFTEDGGTKFNDEVWNIAYR 562

Query: 646  KSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHNTFKVR 705
            + FTTYLPDLV PMLP+SFC    LG +N K+ T+SFSVN+++  ++  ++I   +FKVR
Sbjct: 563  RGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVNIKM--HDGGLRIDEESFKVR 620

Query: 706  LGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQNGNA 765
            LG  +KFP   TYD+VDRIL  + ++  ++        +LR L QIS LL+  RI    A
Sbjct: 621  LGYATKFP-KVTYDSVDRILQQNNDKTQEA-------KELRTLYQISLLLQSKRINEQRA 672

Query: 766  VIFGEGFNKGLVTLSCSKDGG-PVINFKDQNDTKSVTLVTEMMILANSLAARLFKENKIP 824
            +IFGEGFN+GLV L+  + G    I F+DQ+ T S  LV+EMMILAN+LA R F+ NKIP
Sbjct: 673  IIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILANTLAGRYFQVNKIP 732

Query: 825  GIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISKFGSLLNSSFYTDLPLPHQMI 884
            G+FRCY EL L   A+  ++ LR   +  S LP +++I+K  SLLNSSFYT  P  H MI
Sbjct: 733  GVFRCYKELLLKSGARESYESLRAMTQSTS-LPAVEDIAKLSSLLNSSFYTGTPDRHSMI 791

Query: 885  GAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGK 944
            GA  YLTVTSPLRRFPDL+NH+QI+  + + P  +S  DI +M+  +QSRD++IR+ +  
Sbjct: 792  GAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQSRDLVIRKAARD 851

Query: 945  CNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLKPDLDFTPS 1004
               ++ L +LK     +P +   V++TS+  +GF+ C+LP+ S++ GILKLKP++    +
Sbjct: 852  SASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGILKLKPEVSADVA 911

Query: 1005 IGDVIRNCKIDKIDALDGRLDFSMV 1029
            IGD++ NC I K+D LD  ++  MV
Sbjct: 912  IGDLMHNCVITKLDCLDAVMELKMV 936

>KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {ON}
            similar to uniprot|P39112 Saccharomyces cerevisiae
            YMR287C MSU1 RNase component of the mitochondrial
            degradosome along with the ATP-dependent RNA helicase
            Suv3p the degradosome associates with the ribosome and
            mediates turnover of aberrant or unprocessed RNAs
          Length = 948

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/981 (36%), Positives = 518/981 (52%), Gaps = 101/981 (10%)

Query: 65   RIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWF--NSIEWDSRTITPKFSKYMLNS 122
            R  +L+P + IK+L  I     +RF  +  +PS  W   N++ W +           L+S
Sbjct: 51   RPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDYLNMDLTSLSS 110

Query: 123  TFSFDA--WYQKIISNSFNLTFTKHSLEL--DPLNIGDLILL-PDSSNLLMCVDIPHNTK 177
                D     +  + +S + TF  H   L    L IGDL+LL  D S L MCV++P    
Sbjct: 111  KQRADMNDSLKPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMCVEVPTEVT 170

Query: 178  DPRYTFASSDGKLFFKTRSNIPLRIPN---KLPNYLMDSRLLFTEFDHGNNSIGTIKNTQ 234
            +P Y FA+ DG + F  R+ I LRIP+       YL+   + F      N  IG +K++ 
Sbjct: 171  NPSYAFATIDGHIRFGERNMILLRIPSFHKAAAKYLIKEEVPFL-----NTRIGAVKDSP 225

Query: 235  NIKILLPIIARQLVVRPILNNLNKSANDXXXXXXXXXXXXHRLIQNGNGPYQISXXXXXX 294
                +L I+ARQL    +   + K+A +            HR +Q   GP+Q+S      
Sbjct: 226  EKTFMLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSIFKLCE 285

Query: 295  XXXXXXXXXXXXSKKFDI------NLNFXXXXXXXXXXXXXXXXXXDASTFLATYWAIRL 348
                        S                                 DAS FLATYW++  
Sbjct: 286  LVALLDIDKCQSSSTGSYIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFLATYWSLVQ 345

Query: 349  QQQDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDDXX 408
            QQ+  LWG+I  ++A+L+PISVTVLPL  +H YY   L+      K+  + L+SF     
Sbjct: 346  QQEHNLWGQIHSHRAMLTPISVTVLPLTSHHLYYKEVLKELK---KDNYAALESF----- 397

Query: 409  XXXXXXXXXXXXXXXXXXXXXXXXXKLDSSKNISQNYPEFINIFQNYCAGNFDDNSKIIA 468
                                     + +S+K     YP+   + ++Y AGNF +N  II 
Sbjct: 398  ------------------AKLINTGERNSAK---LQYPQISRLLRDYAAGNFHNNGPIIT 436

Query: 469  LISKILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGTSK 528
            ++SK+ R+L K++++D+T+D C E L                             + T +
Sbjct: 437  IVSKLFRKLDKYQNNDITRDLCHEFLQ----------------------------ELTCE 468

Query: 529  DTPNGINNQDPQFNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLTQFSKFHHDFNDLK 588
              PN      PQ  LL N  EI  P++S+    +   Y+L  P +    S+  HDF  + 
Sbjct: 469  SIPN------PQ--LLSN--EIRSPSTSERAVLEQKIYDLALPNQNDDISR-RHDFGKMN 517

Query: 589  VYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNMALSKSF 648
            VYCIDSETAHEIDDGISIE    N +TLHIHIADP S+F N ++ S  + + N+AL + F
Sbjct: 518  VYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQEGSFSKEIWNIALQRGF 577

Query: 649  TTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHNTFKVRLGI 708
            T+YLPD V+PMLPKS+ K  DLG D   + T+SFSV++    NN  ++IL  TF V+LG+
Sbjct: 578  TSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKNN--VEILEETFSVKLGL 635

Query: 709  VSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQNGNAVIF 768
            VS+FP   TY  VDRIL       L+   +   Q +LR L +I+ LL+  R++  NA+IF
Sbjct: 636  VSQFP-RVTYKVVDRIL------GLEQDASQQTQ-ELRTLHKIALLLRSKRVKEQNAIIF 687

Query: 769  GEGFNKGLVTLSCSK-DGGPVINFKDQNDTKSVTLVTEMMILANSLAARLFKENKIPGIF 827
            GEGFN+GLV L  ++ +    ++F+DQ +T S  LV+E+MILAN++A + F++  IPG+F
Sbjct: 688  GEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILANTMAGKFFRDRGIPGVF 747

Query: 828  RCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISKFGSLLNSSFYTDLPLPHQMIGAA 887
            RCY  L L   A+  ++ LR+ +  +   P+ K+I+K  SLLNSSFY+     H+MIGA 
Sbjct: 748  RCYKGLQLKDNARQGYNSLRDMMH-SQKFPSAKDIAKLSSLLNSSFYSARAEKHEMIGAP 806

Query: 888  NYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNK 947
             YL VTSPLRRF DLVNH Q+  ++   P K+S   +  +   IQSRD+++R+ +     
Sbjct: 807  AYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVVLRKAARDSAS 866

Query: 948  YYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLKPDLDFTPSIGD 1007
            ++ L +LK Q + NPS+   V++TSV  LG + C+LP  S++ GILKLKP+   T +IGD
Sbjct: 867  FWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKLKPEASSTVAIGD 926

Query: 1008 VIRNCKIDKIDALDGRLDFSM 1028
            V+ NC+I ++D LD  ++  M
Sbjct: 927  VVHNCRITRLDCLDSIMELEM 947

>KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {ON}
            Anc_8.853 YMR287C
          Length = 932

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/995 (36%), Positives = 534/995 (53%), Gaps = 128/995 (12%)

Query: 50   LSNEDIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWDSR 109
            L  E+I+ I + FL R   L+P + IKEL +I  +Y +R+L+R I PS +W+   +W  R
Sbjct: 42   LKKEEIKLINKLFLSRTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEH-DWKDR 100

Query: 110  TI----TPKFSKYMLNSTFSFDAWYQKIISNSFNLTFTKHSLEL--DPLNIGDLILL-PD 162
            +       +FSK ++N          K   N  N   T H+ EL   PL +GD++LL  +
Sbjct: 101  STKILGMERFSKNLINGA--------KPNFNKRNEGITFHTQELLESPLKVGDIVLLKSN 152

Query: 163  SSNLLMCVDIPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDH 222
            ++ L MCV +P +  DPRYTFA+  G L F TRS+I LRIP  +PN +  + L+  E  H
Sbjct: 153  ATELSMCVALPESADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGI--ANLITREIPH 210

Query: 223  GNNSIGTIKNTQNIKILLPIIARQLVVRPILNNLNKSANDXXXXXXXXXXXXHRLIQNGN 282
            G N IG IK++ N   +LP + RQ +       ++  A +            HR +QN  
Sbjct: 211  GFNPIGVIKSSINETFILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPL 270

Query: 283  GPYQISXXXXXXXXXXXXXXXXXXSKKFDINLNFXXXXXXXXXXXXXXXXXXDASTFLAT 342
            G YQI                    K     ++                   DAS  L+T
Sbjct: 271  GWYQIPFFQLVHLVDTIDMSSCNDRKYMKTLID---------NSKNDSYNNLDASRCLST 321

Query: 343  YWAIRLQQQDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDS 402
            YWAI  QQ+  +WG IQ N   +SPISVTV PL  Y  ++N++L          +  LD 
Sbjct: 322  YWAIIEQQETNMWGDIQRNSCSMSPISVTVNPLKAYQ-HFNDYL-----VCGTKQKDLDK 375

Query: 403  FIDDXXXXXXXXXXXXXXXXXXXXXXXXXXXKLDSSKN---ISQNYPEFINIFQNYCAGN 459
                                           +L + KN   I + YPEF+++ ++Y +GN
Sbjct: 376  I--------------------------GQVTRLMNEKNYTIIKEKYPEFMSMLKDYASGN 409

Query: 460  FDDNSKIIALISKILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTS 519
             + NS++  LIS  LR+L  +KD D++K  C +LL                         
Sbjct: 410  LNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLL------------------------- 444

Query: 520  KDSSQGTSKDTPNGINNQDP-QF--NLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLTQ 576
                              DP QF  N+L  N ++ L NSS L +     Y L  P     
Sbjct: 445  ---------------QEIDPTQFFDNILLFNHDLNLSNSSNLGQSNKQLYALCGPQISAD 489

Query: 577  FSKFHHDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDI 636
              +   DF +L+VYCIDSETAHEIDDGISI    N +++L IHIADPS +F      S+I
Sbjct: 490  ADRV--DFGNLRVYCIDSETAHEIDDGISIINKGNGIYSLSIHIADPSILF---SGASEI 544

Query: 637  QNLLN-----MALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSN 691
            Q  LN     +A+ KSFTTYLPD+V P+LP ++ + +DLG + Q T  ++F+VNV+   +
Sbjct: 545  QGPLNDDVFKLAMEKSFTTYLPDIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVKTLPD 604

Query: 692  NESIKILHNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQI 751
             E++ +L++TF ++L  +  FP   TY  V++IL +S   N        ++ DL +L +I
Sbjct: 605  -ETLHVLYDTFDIKLSKIRNFPK-VTYSRVNKILQSSDYSN------PSVKQDLEDLHKI 656

Query: 752  SNLLKKNRIQNGNAVIFGEGFNKGLVTLSCSKDGGPVINFK--DQNDTKSVTLVTEMMIL 809
            +  L+ NR++NG AV+FGEGFNKG++     +    V N K  DQ +T +  LV+E+MIL
Sbjct: 657  ARALRNNRMKNGGAVVFGEGFNKGMIEF-FEEGQAEVKNVKFIDQEETPATLLVSELMIL 715

Query: 810  ANSLAARLFKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISKFGSLL 869
             N+L    FK+N IPGI+R Y++L L  KA +E+  L+ + K     P+IK++++  SL+
Sbjct: 716  TNTLCGWFFKKNNIPGIYRSYNKLLLGSKATMEYMSLQSSTKSGVS-PSIKDMTRVSSLM 774

Query: 870  NSSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLP 929
            NSS YT  P  H+MIGA  YLTVTSPLRRFPDL+NH QI  F+KK PF ++   +Q ++ 
Sbjct: 775  NSSVYTSKPRMHEMIGAQQYLTVTSPLRRFPDLLNHFQIHRFLKKLPFVFNDEKLQNLIW 834

Query: 930  IIQSRDIIIRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSS 989
             IQSR  I++++S   N Y+ L YL++ I +NP++ FDV+ITSV N G ++C+ P+ S +
Sbjct: 835  HIQSRADILKKMSRAINTYWTLEYLQKAIFENPNKRFDVMITSVPNNGVVNCLFPDMSFA 894

Query: 990  MGILKLKPDLDFTPSIGDVIRNCKIDKIDALDGRL 1024
             G LKLK  + + P IGD + NC+I K+++LDG L
Sbjct: 895  RGKLKLKKGMPY-PVIGDTVTNCRIVKLESLDGIL 928

>CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa] {ON}
            similar to uniprot|P39112 Saccharomyces cerevisiae
            YMR287c MSU1
          Length = 923

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/998 (35%), Positives = 530/998 (53%), Gaps = 109/998 (10%)

Query: 49   KLSNEDIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWDS 108
            +L N  +E   + +L R K L+P   I++LP+I + + KR+  R++ PS +WF + +W +
Sbjct: 15   RLDNAPLENSVKNYLARTKGLEPDFEIRQLPQIISGFNKRYRARYLEPSQRWFKA-DWKA 73

Query: 109  ---------RTITPK-FSKYMLNSTFSFD--AWYQKIISNSFNLTFTKHSLELDPLNIGD 156
                     R + P+ F K+++NS F       YQK    +  L+F    L    LN+GD
Sbjct: 74   SDHGEDKATRLLRPEVFDKFIINSDFHRGNMEQYQK----AQKLSFDPAELLRTSLNVGD 129

Query: 157  LILLPD-SSNLLMCVDIPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRL 215
            ++LL   +S L MCV++P +T DPRYTFA  DG L +  ++++ LRIP  LP  +  ++L
Sbjct: 130  IVLLKQCTSELTMCVNLPQSTTDPRYTFAKKDGTLVYAMKNSVILRIPKDLPEEV--NQL 187

Query: 216  LFTEFDHGNNSIGTIKNTQNIKILLPIIARQLVVRPILNNLNKSANDXXXXXXXXXXXXH 275
            L  E +H    IGTIKN+ N   +LP++ RQL+V   L    K A              H
Sbjct: 188  LKRESNHPYQKIGTIKNSSNETEILPVLTRQLIVSFTLATFTKFAWTQLPIVLKKLELIH 247

Query: 276  RLIQNGNGPYQISXXXXXXXXXXXXXXXXXXSKKFDINLNFXXXXXXXXXXXXXXXXXXD 335
            R +Q+  G   ++                  +   D  +                    D
Sbjct: 248  RYLQDSRGSKHVNFMSLVRIIKNLNIKEATDAINGDAYVR-----KVIDESMSVVNKSID 302

Query: 336  ASTFLATYWAIRLQQQDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKN 395
             +T LATYW +R QQQ+ LWG +  N ALLSP +V VLPL   H +Y   + R  +    
Sbjct: 303  PTTLLATYWGVREQQQNNLWGSVYTNTALLSPTTVAVLPLKKAHLFYQEVITRLESNDYQ 362

Query: 396  GKSLLDSFIDDXXXXXXXXXXXXXXXXXXXXXXXXXXXKLDSSKNISQNYPEFINIFQNY 455
                    ++D                                 +I++ Y     +  +Y
Sbjct: 363  EIKAFAKLVNDK-----------------------------DYHSIAKRYDYIRTLLNDY 393

Query: 456  CAGNFDDNSKIIALISKILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDAS 515
             AGN ++N+ +  +ISKI R +  ++D D+T+  C +LL                     
Sbjct: 394  AAGNIEENAVLTTIISKIFRHIDMYRDQDVTRSLCGKLL--------------------- 432

Query: 516  RNTSKDSSQGTSKDTPNGINNQDPQFNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLT 575
                              I+ Q    N +  N ++ +P SS ++  +   Y+   P  ++
Sbjct: 433  ----------------VEISPQSNSSNFILGNWDLNIPKSSGISSVEQKLYDTAMPTIVS 476

Query: 576  QFSKFHHDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIF---LNHEK 632
               ++  DF D+ V+CIDSE AHEIDDGISIE+L+     +HIHIADP+ +F    ++ K
Sbjct: 477  DTDRY--DFGDMPVFCIDSEDAHEIDDGISIEELDGVRSRIHIHIADPAGLFPESFDYTK 534

Query: 633  NSDIQNLLNMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNN 692
            +    ++L ++L ++FTTYLPDLV PMLPKSFC  +DLG  ++KT TISFS  + V+  +
Sbjct: 535  SGISDDVLRVSLKRAFTTYLPDLVVPMLPKSFCNRADLGKHDRKTETISFSFEL-VNKED 593

Query: 693  ESIKILHNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQIS 752
              + + ++TF+VRLGIVS FP   TYD VD IL+        + + S  +  L  L  ++
Sbjct: 594  GGLHVDYDTFQVRLGIVSNFP-KVTYDKVDSILNGD-----DNSLPSKQKKQLELLHTLA 647

Query: 753  NLLKKNRIQNGNAVIFGEGFNKGLVTLSCSKDGGPVI-NFKDQNDTKSVTLVTEMMILAN 811
              L   RI + NAV+FG+GFNKGLV+LS   DG   I  F DQ+ TKS  LV+E MIL N
Sbjct: 648  TKLLHKRIHDDNAVVFGDGFNKGLVSLSPDDDGELCIPTFYDQSQTKSTLLVSEFMILTN 707

Query: 812  SLAARLFKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISKFGSLLNS 871
             L A  F+ENKIPG++RCY+ L+L  +A+ +F++L+ENIK+   LP++K+I+K  S L+S
Sbjct: 708  KLCAAFFQENKIPGVYRCYNGLNLGNQAKAQFELLKENIKLGK-LPSLKDITKISSQLSS 766

Query: 872  SFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPII 931
            SFY+  PLPH+MIG   YLTVTSP+RR PDL+NH+Q+  F+KK P  +    + + +   
Sbjct: 767  SFYSPFPLPHKMIGNTAYLTVTSPMRRGPDLINHLQLHRFLKKLPLCFKQEYLDQYVWSF 826

Query: 932  QSRDIIIRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMG 991
            Q+R  I++      + Y+ L +L++    + ++T DV++TSV   G ++C+ P +S + G
Sbjct: 827  QARADILKIFQRHSSTYWTLKHLEQ----SGTKTHDVIVTSVPQNGTVNCLFPEYSYARG 882

Query: 992  ILKLKPDLDFTPSIGDVIRNCKIDKIDALDGRLDFSMV 1029
             LKL P +   P IGD IR+CK++ I  LDG L  + V
Sbjct: 883  TLKLDPAMKKIPRIGDTIRHCKVESIHPLDGILTLTHV 920

>TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}
            Anc_8.853 YMR287C
          Length = 943

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/987 (37%), Positives = 526/987 (53%), Gaps = 104/987 (10%)

Query: 54   DIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWDSRTITP 113
            ++E +K  FL R K L+    IKE+ EI N+    F   +I+PS  WF+++     T + 
Sbjct: 36   NLELVKSKFLERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDTV-----TSSG 90

Query: 114  KFSKYMLNSTFSFDAWYQ-KIISNSFNLTFTKHSLEL--DPLNIGDLILLPDS-SNLLMC 169
             FS  ++N T     W +   +    N  ++ ++L+L    L+IGDL+LL +S   LLMC
Sbjct: 91   SFSNDLINETLISKKWKKFPDLPIKMNGDYSFNALQLFDRSLDIGDLVLLRNSDKELLMC 150

Query: 170  VDIPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHGNNSIGT 229
            VDIP + +DPR+TFA  DG L F T+ N+ LRI N LP  +++  L+  +++ G   +  
Sbjct: 151  VDIPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNKYEAG---LIN 207

Query: 230  IKNTQNIKI-LLPIIARQLVVRPILNNLNKSANDXXXXXXXXXXXXHRLIQNGNGPYQIS 288
             K    IK+  LP++ARQ+   P+ + +++ A              HR I +G     IS
Sbjct: 208  RKENNAIKLPSLPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSIS 267

Query: 289  XXXXXXXXXXXXXXXXXXSKKFDINLNFXXXXXXXXXXXXXXXXXXDASTFLATYWAIRL 348
                              ++  D + N                   DA T L+TYWA+  
Sbjct: 268  FLKLVHLVQNVDLNKLARNRA-DHDANHISNIIRNTKDDIQYMTKIDAITLLSTYWAVIQ 326

Query: 349  QQQDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLDSFIDDXX 408
            QQQ  LWG IQ++ ALL PISV+VLP               NN I   +++     D+  
Sbjct: 327  QQQSQLWGDIQIHSALLFPISVSVLPF--------------NNVIYLNETIPRVATDENI 372

Query: 409  XXXXXXXXXXXXXXXXXXXXXXXXXKLDSSKNISQNYPEFINIFQNYCAGNFDDNSKIIA 468
                                          + I++ +P+F+N+ + Y  G +  N KI  
Sbjct: 373  NKFTEAINKHNL------------------EKINEKFPDFLNMLKEYGNGCYYGNEKITT 414

Query: 469  LISKILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGTSK 528
            +ISK+ RR+  +K+ +L++D C++L                                   
Sbjct: 415  IISKLFRRIETYKNKELSRDNCQKLY---------------------------------- 440

Query: 529  DTPNGINNQDPQFNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLTQFSKFHHDFNDLK 588
               N +N  +   N L  + ++ LP  S  T+ + L Y+L E        +  HDF DLK
Sbjct: 441  ---NELNPSNKILNSLLLSKDLCLPEISGTTRTEQLIYSLTEVDNHAIIDQRRHDFKDLK 497

Query: 589  VYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNH---EKNSDIQNLLNMALS 645
            V+CID +TAHEIDDG+S+ + + N+  L IHIADP+S+F  H   E NS    +LN+A  
Sbjct: 498  VFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIAFR 557

Query: 646  KSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHNTFKVR 705
            ++FTTYLP+ V PMLPKSFC  SDLG   + T TI+FSV    D +  S  IL +TF+++
Sbjct: 558  RAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSV----DFDKSSCSILEDTFEIQ 613

Query: 706  LGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQNGNA 765
            LG V+ FP NTTY  VD+IL++S +        +DI+ DLR +  I+N L+K RI N  A
Sbjct: 614  LGKVNNFPKNTTYKEVDKILNSSIKRE------NDIERDLREMRFIANHLRKCRIDNS-A 666

Query: 766  VIFGEGFNKGLVTLSCSKDGGPV---INFKDQNDTKSVTLVTEMMILANSLAARLFKENK 822
            VIFGEGFNKG V L   K  G     +NFKD   T S  +V+E MILANSLA + FK +K
Sbjct: 667  VIFGEGFNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHK 726

Query: 823  IPGIFRCYHELHLAKKAQLEFD-ILRENIKVNSHLPNIKEISKFGSLLNSSFYTDLPLPH 881
            IP I++ Y  L++  KA  +F  IL  N K    LP+IKEISK GSLL+SS ++  P  H
Sbjct: 727  IPAIYKTYKGLNMKPKASSQFKKILNVNKK---RLPSIKEISKIGSLLSSSTFSSKPSIH 783

Query: 882  QMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIREL 941
            +MIG   Y TVTSPLRRFPDL+NH Q+  ++  +P  +S   + +M+  +  RD I+R  
Sbjct: 784  EMIGTDQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHY 843

Query: 942  SGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLKPDLDF 1001
            S K NKY+ L YL E+I+ NP   FDV++ SVS  G +HCILP  S + G LKLKP    
Sbjct: 844  SRKFNKYWTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATT 903

Query: 1002 TPSIGDVIRNCKIDKIDALDGRLDFSM 1028
             P+IG++I+NCKI  ID L   L+F++
Sbjct: 904  IPAIGEIIKNCKIANIDCLGNSLEFAI 930

>NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.853
            YMR287C
          Length = 962

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/1004 (37%), Positives = 532/1004 (52%), Gaps = 120/1004 (11%)

Query: 50   LSNEDIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFNSIEWD-- 107
            LS EDI+ I+  FL R  +L+P I +K   +I  E  KRF  R++ PS  W+ S  W+  
Sbjct: 49   LSREDIQLIQANFLKRTNDLEPDIRLKTTAQIHYELDKRFNARYLQPSKSWYES-NWEKL 107

Query: 108  -SRTITPKFSKYMLNSTFSFDAWYQKIISNSFNLTFTKHSLELDPLNIGDLILL-PDSSN 165
              + +T    + +      F   Y K      NL F    +  +PL IGD++LL  ++S 
Sbjct: 108  NEKRLTLSIRELINKDPAEFKFNYYK------NLKFNIEDVT-EPLKIGDIVLLKTNTSE 160

Query: 166  LLMCVDIPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYLMDSRLLFTEFDHGNN 225
              MC+D+P + KDPRYTF SS G L F  RS I L+IP KLP  +   RL+  E  H  N
Sbjct: 161  FSMCIDLPQSLKDPRYTFISSTGDLIFGMRSMILLKIPFKLPGNI--ERLIIKEPAHKYN 218

Query: 226  SIGTIKNTQNIKILLPIIARQLVVRPILNNLNKSANDXXXXXXXXXXXXHRLIQNGNGPY 285
             IGTIK++ +  +L+P+IARQL++  +   ++K A              HR +Q+ +GP 
Sbjct: 219  PIGTIKSSLDETVLVPVIARQLLINFMPAQISKCATKQLPVIIKKLELLHRYLQDFSGPQ 278

Query: 286  QISXXXXXXXXXXXXXXXXXXSKKFDINLNFXXXXXXXXXXXXXXXXXXDASTFLATYWA 345
            QI                    +K +  +N                   DA+  L+TYWA
Sbjct: 279  QIHFHKLINIIEALNLDRATDYEKGNEYVNELLKQKYYNDYTDLSLSSLDATVALSTYWA 338

Query: 346  IRLQQQDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQ--RSNNAIKNGKSLLDSF 403
            I  QQ  FLWG+I+ N + L P +VT+LP   +H YY   ++  R NN  +  +    +F
Sbjct: 339  IIEQQDLFLWGEIKRNSSSLFPTTVTILPFS-HHVYYTKLIKSLRKNNFRRTNE--FSAF 395

Query: 404  IDDXXXXXXXXXXXXXXXXXXXXXXXXXXXKLDSSKNISQNYPEFINIFQNYCAGNFDDN 463
            I++                              SS  I   +PEF+++ + YCAGN  DN
Sbjct: 396  INEHNLNT-------------------------SSPEIQFKFPEFLHLLKEYCAGNLLDN 430

Query: 464  SKIIALISKILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSS 523
             KII ++SKI R L  FK+ D+TKD   ELL                             
Sbjct: 431  PKIITILSKIFRNLNDFKERDITKDLAYELLTKLI------------------------- 465

Query: 524  QGTSKDTPNGINNQDPQFNLLHN----NIEIALPNSSKLTKDQTLFYNLIEPPKLT--QF 577
                           P  NLL N    N +++LP +S   ++Q+  Y L  P K+   + 
Sbjct: 466  ---------------PTSNLLANPLLANHDLSLPTNSGRGENQSKLYELATPTKIESGET 510

Query: 578  SKFHHDFNDLKVYCIDSETAHEIDDGISIEKL-------NNNLFTLH-IHIADPSSIFLN 629
            +   H+FNDL VYCIDSETAHEIDDGISI+K        +  L TL  I + D      N
Sbjct: 511  TTKRHNFNDLNVYCIDSETAHEIDDGISIKKYLKIDLLYSFILLTLQFISMKDS-----N 565

Query: 630  HEKNSDIQN-LLNMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEV 688
             EK + I + +L +A  +SFTTYLPD V PMLP  +C++SDLG  NQ   T++FSV++ +
Sbjct: 566  KEKKTGIDDDILKIAYYRSFTTYLPDNVVPMLPSKYCEMSDLGKSNQNIETLTFSVDITI 625

Query: 689  ---DSNNESIKILHNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDL 745
                +N E++KIL++TFK++ G+VS FP   TYD VD+IL NST    K   TS I  DL
Sbjct: 626  FDGSNNEETLKILYDTFKIQFGLVSNFPK-VTYDTVDKILDNST----KIPDTS-ITEDL 679

Query: 746  RNLSQISNLLKKNRIQNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTE 805
            R LS+I+ LL+K RI   NA++FGEGFN+G+  L  ++D    I F DQ ++ S  LV+E
Sbjct: 680  RQLSRIAKLLRKYRINENNAIVFGEGFNRGIPDLQSTEDE---IIFTDQKNSDSNELVSE 736

Query: 806  MMILANSLAARLFKENKIPGIFRCYHELHLAKKAQLEFDILR-ENIKVNSHLPNIKEISK 864
            MMILAN+L  +  K++KIP I+RCY  L +  +AQ E  ILR +NI     LP+  +++K
Sbjct: 737  MMILANTLTGKYCKDHKIPVIYRCYSPLDIGPEAQQECIILRSKNI---DRLPSNIDMAK 793

Query: 865  FGSLLNSSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDI 924
              S LNSS+Y+  P  H M+G+  Y TVTSPLRRFPDL+NH+Q+ + +K     ++   +
Sbjct: 794  MSSFLNSSYYSGTPSRHSMLGSDEYATVTSPLRRFPDLLNHIQLHNHLKGYQLPFTPNHV 853

Query: 925  QKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILP 984
               L  IQSR   ++ +         LNY+K  I K P++ FDVL+TSV   G   C + 
Sbjct: 854  AHYLTTIQSRSDTLKNIGNAVYTEMTLNYIKLLINKEPTKAFDVLVTSVPIEGSARCAIV 913

Query: 985  NFSSSMGILKLKPDLDFTPSIGDVIRNCKIDKIDALDGRLDFSM 1028
             +  + G +KLK +++  P IGD+I  CK+ KI  ++G L+ SM
Sbjct: 914  GYEYARGTIKLKAEINPVPIIGDIITKCKVTKIFPIEGALELSM 957

>Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON}
            complement(4514..7264) [2751 nt, 917 aa]
          Length = 916

 Score =  541 bits (1395), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 336/884 (38%), Positives = 492/884 (55%), Gaps = 98/884 (11%)

Query: 152  LNIGDLILLP-DSSNLLMCVDIPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLP-NY 209
             N GD++LL  D SNL MC+++P +T DPRY+FA+S+G + F  RS++ LRIP +LP N 
Sbjct: 121  FNRGDIVLLSQDLSNLYMCIELPQSTADPRYSFANSNGDIIFANRSSVLLRIPLQLPTNL 180

Query: 210  LMDSRLLFTEFDHGNNSIGTIKNTQNIKILLPIIARQLVVRPILNNLNKSANDXXXXXXX 269
            L+    L  E   G   +GT+KN+ +   +LP++ RQLV+ P L+ ++ +AN+       
Sbjct: 181  LLSDDFLQPEPTQG---VGTVKNSIDNPYVLPVLLRQLVISPSLSTISSNANNLLPIVLK 237

Query: 270  XXXXXHRLIQNGNGPYQISXXXXXXXXXXXXXXXXXXSKKFDINL-NFXXXXXXXXXXXX 328
                 HR +Q     ++I                   S   +  + NF            
Sbjct: 238  KLQLLHRNLQ----AFKIIPLVQLSSLVQNLDLTKATSNDGESYISNFIANSNENYSIES 293

Query: 329  XXXXXXDASTFLATYWAIRLQQQDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQR 388
                  ++S  +AT+WAIR QQQD LWG I  +KALL P++V++LPL   + YY   L  
Sbjct: 294  I-----NSSNLIATFWAIRQQQQDHLWGDIHYSKALLFPLAVSILPLQSNYMYYKEILP- 347

Query: 389  SNNAIKNGKSLLDSFIDDXXXXXXXXXXXXXXXXXXXXXXXXXXXKLDSSKNISQNYPEF 448
               AI+     LD  I+                              +   N    +P+ 
Sbjct: 348  ---AIE-----LDHSIERFTK--------------------------NGIPNTPNEFPQL 373

Query: 449  INIFQNYCAGNFDDNSKIIALISKILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSG 508
            +N+ + Y +G    + KI+ +ISKI R L  +K  D+++D C++L +    K        
Sbjct: 374  LNLLKQYASGAVLMDDKIVTMISKIFRNLDDYKKYDVSRDLCQKLYNELVPK-------- 425

Query: 509  DASGDASRNTSKDSSQGTSKDTPNGINNQDPQFNLLHNNIEIALPNSSKLTKDQTLFYNL 568
                                        Q  Q +LL+N  ++ALP +S  T++Q   Y +
Sbjct: 426  ---------------------------EQKIQNSLLYNT-DLALPLASNRTEEQEKVYQM 457

Query: 569  IEPPKLTQFSKFHHDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIF- 627
              P + +  S   HDF DL+V+CID +TAHEIDDG+SIE   NN++TLH+HIADPSS F 
Sbjct: 458  YNPIQTSNNSN-RHDFGDLRVFCIDEKTAHEIDDGVSIEYKQNNVYTLHVHIADPSSYFK 516

Query: 628  LNHEKNSDIQN--LLNMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVN 685
            + ++ N +I+N  +L +AL +SFTTYLPD V PMLPK  C+ +DLG   +KT TI+FSV+
Sbjct: 517  ICNDHNVNIENDEILKIALQRSFTTYLPDQVLPMLPKLLCRAADLGKTGEKTKTITFSVD 576

Query: 686  VEVDSNNESIKILHNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDL 745
            V+++  + ++K+L NTF+VRLG VS F  + TY +VD IL++S E    SG    ++ DL
Sbjct: 577  VKLNKKDMTVKVLDNTFQVRLGYVSNFVKDMTYSDVDSILNDSKE----SGRDKKVEKDL 632

Query: 746  RNLSQISNLLKKNRIQNGNAVIFGEGFNKGLVTLSCSKDGGPV--INFKDQNDTKSVTLV 803
            +++  I+  L  +RI N NAVIF +  N G + L+  +  G V  INFK    T S  LV
Sbjct: 633  KSMFLIAKGLNNSRIMN-NAVIFSDEINNGKIELTKDEITGEVTQINFKGGKFTDSNILV 691

Query: 804  TEMMILANSLAARLFKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEIS 863
            +E+MILANSLA + F EN IP I+R Y +L L K AQ E++ +  N+K+    P +K+I+
Sbjct: 692  SELMILANSLAGKFFAENGIPAIYRSYSDLLLGKDAQSEYNAMLSNLKLGKR-PTLKDIN 750

Query: 864  KFGSLLNSSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTD 923
            K  SL N+S +T  P PH MI    Y TVTSPLRRFPD++NH+QI   + K+P  ++  D
Sbjct: 751  KISSLFNTSKFTTYPSPHSMIATKYYATVTSPLRRFPDMINHLQIHRILSKQPLCFTQRD 810

Query: 924  IQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCIL 983
            ++ M   IQ++D+I+R  S   N Y+ L ++K+Q+ ++P + FDV+ITSV   G  HCIL
Sbjct: 811  LENMNWNIQTKDVILRSSSRMINTYWTLRHIKDQLSEDPDKKFDVMITSVQQNGVAHCIL 870

Query: 984  PNFSSSMGILKLKPDLDFTPSIGDVIRNCKIDKIDALDGRLDFS 1027
              FS + G L   P+ +  P IGD + NCKI KID L   L+FS
Sbjct: 871  AQFSFAKGKLVFDPNDESHPLIGDTVSNCKITKIDCLGNVLEFS 914

>AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YMR287C (MSU1)
          Length = 817

 Score =  427 bits (1097), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 278/894 (31%), Positives = 449/894 (50%), Gaps = 106/894 (11%)

Query: 152  LNIGDLILLPD-SSNLLMCVDIPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPNKLPNYL 210
            L IGDL +L      L++CV+ P +  D RY FA +DG + + T+S++ LR+P      L
Sbjct: 11   LQIGDLCVLSAVPGKLVVCVEQPTDAADARYAFAGADGAVCYATKSDVRLRVPGLHKRPL 70

Query: 211  MDSRLLFTEFDHGNNSIGTIKNTQNIKILLPIIARQLVVRPILNNLNKSANDXXXXXXXX 270
                LL  E DHG   +GT+KN  +   LLP+  R+L     +  +++ A          
Sbjct: 71   --RYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVAQLPEVVAK 128

Query: 271  XXXXHRLIQNGNGPYQISXXXXXXXXXXXX-----XXXXXXSKKFDINLNFXXXXXXXXX 325
                HR +Q+  GP+Q+S                         K    LN          
Sbjct: 129  LELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEKVAKLLAELNIGQGSYCSAA 188

Query: 326  ---XXXXXXXXXDASTFLATYWAIRLQQQDFLWGKIQVNKALLSPISVTVLPL---VLYH 379
                        D + +LATYW +  QQ D +WG I  ++AL SP+SVTVLPL    L++
Sbjct: 189  DINLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTVLPLRDQTLFY 248

Query: 380  NYYNNFLQRSNNAIKNGKSLLDSFIDDXXXXXXXXXXXXXXXXXXXXXXXXXXXKLDSSK 439
            +Y    ++R + A       LD F                                   K
Sbjct: 249  DYLLRDMKRDDYAA------LDEF--------------------------ACLVNQGKYK 276

Query: 440  NISQNYPEFINIFQNYCAGNFDDNSKIIALISKILRRLTKFKDSDLTKDTCKELL-DLCT 498
                NY   + + ++YCAGN + N+ +I L++++ RRL  +K+ ++T+    +LL  LC 
Sbjct: 277  EACSNYKSVLQLLRDYCAGNINSNAALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLC- 335

Query: 499  SKGTSKGTSGDASGDASRNTSKDSSQGTSKDTPNGINNQDPQFNLLHNNIEIALPNSSKL 558
                                          +TP+         N LH N ++ LP S+  
Sbjct: 336  -----------------------------PETPH---------NPLHWNHQLELPLSNPR 357

Query: 559  TKDQTLFYNLIEPPKLTQFSKFHHDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHI 618
            T  +   Y+L  PP   +      +F+ +  YCIDS  AHEIDDG+SIE+L  + + LH+
Sbjct: 358  TALEQKVYDLASPPLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRLHV 416

Query: 619  HIADPSSIFLNHEKNSD--IQNLLNMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQK 676
            HIA P S+F       +  I  ++++A  ++FTTYLPDLV PM+PKS+ + SDLG  ++ 
Sbjct: 417  HIAYPYSLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKP 476

Query: 677  TATISFSVNVEVDSNNESIKIL-HNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKS 735
            T TI+ SV+V++   ++ ++++   T ++ LG  ++     TYD VD +L +  ++   S
Sbjct: 477  TKTITISVDVDL---SKKLRVVDEATLQIALG-TTRTSKRVTYDYVDDLLESKRQDAEAS 532

Query: 736  GVTSDIQNDLRNLSQISNLLKKNRIQNGNAVIFGEGFNKGLVTLSCSKDGGPV-INFKDQ 794
                    DLR L +++  L++ R    +A++FG+  N GL++L+ ++DG  + +   D 
Sbjct: 533  --------DLRLLYKVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDS 583

Query: 795  NDTKSVTLVTEMMILANSLAARLFKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNS 854
              TKS TLV+E+MI+ANSLA R F EN IPG++R   EL L  +A  ++  L+  ++   
Sbjct: 584  KSTKSNTLVSELMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKG 643

Query: 855  HLPNIKEISKFGSLLNSSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKK 914
             + +  ++ K  + L +S Y+  P  H M+G   YLT+TSPLRR PD++NHMQ+   ++ 
Sbjct: 644  SVSS-SDLVKVAAFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRS 702

Query: 915  KPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVS 974
             P  +S   I  +   I +RD+ +++ S + + ++ L YLK+Q+   P + +D+++TS+ 
Sbjct: 703  LPPCFSQEQIDALNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLP 762

Query: 975  NLGFIHCILPNFSSSMGILKLKPDLDFTPSIGDVIRNCKIDKIDALDGRLDFSM 1028
              GF+HC +P    S G LK+ P     P++G  + NC I ++D+LDG L F M
Sbjct: 763  LNGFVHCKIPGIFYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFEM 815

>KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {ON}
            similar to uniprot|P39112 Saccharomyces cerevisiae
            YMR287C MSU1 RNase component of the mitochondrial
            degradosome along with the ATP-dependent RNA helicase
            Suv3p the degradosome associates with the ribosome and
            mediates turnover of aberrant or unprocessed RNAs
          Length = 983

 Score =  428 bits (1100), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 296/1021 (28%), Positives = 513/1021 (50%), Gaps = 127/1021 (12%)

Query: 43   NVTKHNKLSNEDIEKIKQTFLIRIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWFN 102
            NVT  +   +E++      F  + K++ P + IK       E   RF  RF+ PS  W+ 
Sbjct: 41   NVTTESLQEDEEV-----IFFSQDKDILPEVEIKPFRRTKAETLMRFNDRFVQPSIDWYR 95

Query: 103  SIEWDSRTITPKFSKYM------LNSTFSFDA---WYQK----IISNSFNLTFTKH-SLE 148
             +       T K  ++M      ++S+  F+    W  K    + +N++N   T+     
Sbjct: 96   KVGKSHGENTDK-DEFMHLLRNDISSSTLFEETLKWLSKDNYKLRNNTYNGYDTQEIEFY 154

Query: 149  LDPLNI-------GDLILLPDSS-NLLMCVDIPHNTKDPRYTFASSDGKLFFKTRSNIPL 200
             DP  I       GD+ +L +S   LL+CV  P    D R+TFA++DG + +  ++++ L
Sbjct: 155  FDPSAIVSSTLMPGDICVLKNSPFELLVCVKTPSEAMDARFTFANTDGNVVYAWKTSVHL 214

Query: 201  RIPNKLPNYLMDSRLLFTEFDHGNNSIGTIKNTQNIKILLPIIARQLVVRPILNNLNKSA 260
            R P       ++  +L  E  HG + +G++KN +++  ++P + R++++  +   +  +A
Sbjct: 215  RFPTIFNTTELE--ILQREKLHGYSPVGSVKNDKDVTFVIPTLPRRMLISNVTFRIADAA 272

Query: 261  NDXXXXXXXXXXXXHRLIQNGNGPYQISXXXXXXXXXXXXXXXXXXSKKFDINLNFXXXX 320
                          HR +Q+G+ P+QI                        I   F    
Sbjct: 273  VQQLPIIKKKLELIHRYLQSGSSPWQIPILKLVEICSNLELSNNIEK---SIATAFMKSG 329

Query: 321  XXXXXXXXXXXXXXDAST----------FLATYWAIRLQQQDFLWGKIQVNKALLSPISV 370
                          + S+           LA YWA+  QQ   +WG++ V++ +  P +V
Sbjct: 330  LSSDALYSLANSHFELSSKVPNKVECSRLLAVYWALLHQQGTQMWGEMTVHRGIFFPSAV 389

Query: 371  TVLPLVLYHNYYNNFLQ--RSNNAIKNGKSLLDSFIDDXXXXXXXXXXXXXXXXXXXXXX 428
            TVLPL   H +Y+N +   R +  ++  +  + + I++                      
Sbjct: 390  TVLPLTKQHLHYHNIIHKLRQHGGVRINR--IAALINE---------------------- 425

Query: 429  XXXXXKLDSSKNISQNYPEFINIFQNYCAGNFDDNSKIIALISKILRRLTKFKDSDLTKD 488
                   +   ++++++P  + + ++Y AGN + N  I +LIS + R+L ++K+ ++++D
Sbjct: 426  -------NDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLFRKLDEYKELNISRD 478

Query: 489  TCKELLDLCTSKGTSKGTSGDASGDASRNTSKDSSQGTSKDTPNGINNQDPQFNLLHNNI 548
             C +LL                                       IN  +P   LL N+ 
Sbjct: 479  VCFDLL-------------------------------------KRINPSEPPNPLLINH- 500

Query: 549  EIALPNSSKLTKDQTLFYNLIEPPKLTQFSKFHHDFNDLKVYCIDSETAHEIDDGISIEK 608
            E+ LP +++  K +   Y+L  PPK+   ++   ++ DL  YCIDS  AHEIDD +SI+ 
Sbjct: 501  ELQLPVNNERVKLEQKIYDLAVPPKIEHSAEIRTEYKDLICYCIDSPDAHEIDDAVSIKS 560

Query: 609  LNNNLFTLHIHIADPSSIFLNHEKNSDIQN--LLNMALSKSFTTYLPDLVSPMLPKSFCK 666
            L    + ++IH+ADP+S+F    ++    N  +L++A  ++FTTYLPD V PMLP ++ +
Sbjct: 561  LGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAFTTYLPDKVFPMLPTTYAR 620

Query: 667  LSDLGYDNQKTATISFSVNVEVDSNNESIKILHNTFKVRLGIVSKFPSNTTYDNVDRILS 726
             SDLG   + T  ++FSV+    S ++ + +L ++ KV L ++ K  +  TY+ VD +L 
Sbjct: 621  SSDLGQFGKPTKAVTFSVDCTF-SKSKGLCLLKDSLKVELSVLHK-STRITYEAVDELLD 678

Query: 727  NSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQNGNAVIFGEGFNKGLVTLSCSKDGG 786
              T +  KSG       DL+ L  I+  L++ RI +G AV+F E  + G+V+LS   +  
Sbjct: 679  EPTTKP-KSGK----HEDLKTLFYIAKALRRQRIVDGGAVVF-ENSSTGIVSLSPDDNSE 732

Query: 787  PV-INFKDQNDTKSVTLVTEMMILANSLAARLFKENKIPGIFRCYHELHLAKKAQLEFDI 845
             V ++FKDQ +TKS  LV+E+MILANSL A  F+EN+IPGI+R Y  L++ + A    + 
Sbjct: 733  LVEVSFKDQIETKSTILVSELMILANSLTASYFEENQIPGIYRGYRPLNVVEDATSVPEW 792

Query: 846  LRENIKVNSHLPNIKEISKFGSLLNSSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNH 905
            ++   + N  +    +I+K  S L SSFY+ LP PH M+G ++YLT+TSPLRRFPDLVNH
Sbjct: 793  VKAKTQENKIISK-ADIAKMKSFLTSSFYSSLPTPHDMLGTSHYLTITSPLRRFPDLVNH 851

Query: 906  MQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKKNPSQT 965
            +Q+   +K  P  Y  + +  M+  I +RD+ ++  S    +Y+ L +LK++I+      
Sbjct: 852  LQLHRTLKGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFLKKEIEDPTKNN 911

Query: 966  FDVLITSVSNLGFIHCILPNFSSSMGILKLKPDLDFTPSIGDVIRNCKIDKIDALDGRLD 1025
            + + ITS+++ G+ HC++ + + ++G LK+  + +  P +GD I +C+I  I  LDG L 
Sbjct: 912  WKLQITSLTDNGYAHCVILDKAFAVGQLKINLNKN-PPLVGDQISDCEISNIQCLDGILQ 970

Query: 1026 F 1026
            F
Sbjct: 971  F 971

>NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1.367
           YOL021C
          Length = 1012

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 106/452 (23%), Positives = 173/452 (38%), Gaps = 80/452 (17%)

Query: 583 DFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNM 642
           D  D  +  ID     +IDD +  +KL N  + + +HIAD +  F+      D +     
Sbjct: 544 DLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTH-FVKQGTALDAE----- 597

Query: 643 ALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKI--LHN 700
             S+  + YL D    MLP      +DL          +FSV  E+DSN + +K+    +
Sbjct: 598 GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDSNADIVKVDFTKS 655

Query: 701 TFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRI 760
             K R           +Y+     + +  +       T D+   +R L Q+S  LK+ R+
Sbjct: 656 VIKSREAF--------SYEQAQLRIDDPNQ-------TDDLTQGMRALLQLSIKLKQKRL 700

Query: 761 QNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTEMMILAN-SLAARLFK 819
            NG A+       K  +    S  G   +  K    T S  LV E M+LAN S+A +++ 
Sbjct: 701 DNG-ALNLASPEVKVHMDSETSDPGE--VEIKKLLATNS--LVEEFMLLANISVARKIYD 755

Query: 820 ENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK--------------- 864
                 + R +     A      F++L E +    ++    E SK               
Sbjct: 756 AFPQTAMLRRH-----AAPPSTNFELLNEMLHRRKNMSISLESSKALADSLDRCEDPKDP 810

Query: 865 -FGSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQ 909
            F +L+               S  Y+     H  +    Y   TSP+RR+ D+V H Q+ 
Sbjct: 811 YFNTLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRYCDVVAHRQLA 870

Query: 910 HFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYL-----LNYLKEQIKKNPSQ 964
             I  +P   S  D  KM       D+I R ++ K           + Y   Q+ +N   
Sbjct: 871 GAIGYEPLSLSHRDKNKM-------DMICRNINKKHRNAQFAGRASIEYYVGQVMRNNET 923

Query: 965 TFDVLITSVSNLGFIHCILPNFSSSMGILKLK 996
                +  V N G +  ++P F    G+++L+
Sbjct: 924 VETGYVIKVFNNGIV-VLVPKFGVE-GLIRLE 953

>KLLA0A10835g Chr1 (938712..941738) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 1008

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 102/449 (22%), Positives = 172/449 (38%), Gaps = 74/449 (16%)

Query: 583 DFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNM 642
           DF D  +  ID     +IDD +  ++L N  + + +HIAD +  F+      D +     
Sbjct: 541 DFRDKLICSIDPPGCVDIDDALHAKQLPNGNWEVGVHIADVTH-FVKPGTALDAE----- 594

Query: 643 ALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEV--DSNNESIKILHN 700
             S+  + YL D    MLP      +DL          +FSV  E+  D+N   +    +
Sbjct: 595 GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVVWELDNDANIVGVDFTKS 652

Query: 701 TFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRI 760
             + R     +   N       RI   + ++ L  G        +R L Q+S  LK+ R+
Sbjct: 653 VIRSREAFSYEKAQN-------RIDDETAKDELTLG--------MRALLQLSKKLKQKRL 697

Query: 761 QNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTEMMILAN-SLAARLFK 819
             G   +         V +         +  K   DT S  LV E M+LAN S+A ++++
Sbjct: 698 DAGALNLASPEVK---VHMDSETSDPNEVEIKKLLDTNS--LVEEFMLLANISVARKIYE 752

Query: 820 ENKIPGIFRCYHELHLAKKAQLEFDILRENIKV-------------------------NS 854
                 + R +     A      F++L E ++V                         +S
Sbjct: 753 AFPQTAMLRRH-----AAPPSTNFELLNEMLQVRKGMSISLESSKALADSLDRCEDPNDS 807

Query: 855 HLPNIKEISKFGSLLNSSF-------YTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQ 907
           +L  +  I     ++ + +       Y D    H  +    Y   TSP+RR+ D+V H Q
Sbjct: 808 YLNTLIRIMSTRCMMAAQYFHAGAFSYAD--FRHYGLAVDIYTHFTSPIRRYCDVVAHRQ 865

Query: 908 IQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKKNPSQTFD 967
           +   I  +    S  D QKM  I   R+I  +  + +      + Y   Q+ +N   T  
Sbjct: 866 LAGAIGYEALDLSHRDKQKMEMI--CRNINKKHRNAQFAGRASIEYYVGQVMRNNESTET 923

Query: 968 VLITSVSNLGFIHCILPNFSSSMGILKLK 996
             +  V N G I  ++P F    G+++L+
Sbjct: 924 GYVIKVFNNG-IAVLVPKFGVE-GLIRLE 950

>NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON}
           Anc_1.367
          Length = 998

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 104/452 (23%), Positives = 173/452 (38%), Gaps = 80/452 (17%)

Query: 583 DFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNM 642
           D  D  +  ID     +IDD +  ++L N  + + +HIAD +  F+      D +     
Sbjct: 530 DLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTH-FVKPGTALDAE----- 583

Query: 643 ALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKI--LHN 700
             S+  + YL D    MLP      +DL          +FSV  E+D N + + +    +
Sbjct: 584 GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDENADIVNVDFTKS 641

Query: 701 TFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRI 760
             K R           +Y+     + ++++       T D+   +R L Q+S  LK+ R+
Sbjct: 642 VIKSREAF--------SYEQAQLRIDDASQ-------TDDLTQGMRALLQLSIKLKQKRL 686

Query: 761 QNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTEMMILAN-SLAARLFK 819
             G   +        +   S + D G V   K    T S  LV E M+LAN S+A +++ 
Sbjct: 687 DAGALNLASPEVKVHMD--SETSDPGEV-EIKKLLATNS--LVEEFMLLANISVARKIYD 741

Query: 820 ENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK--------------- 864
                 + R +     A      F++L E +    ++    E SK               
Sbjct: 742 AFPQTAMLRRH-----AAPPSTNFELLNEMLHQRKNMSISLESSKALADSLDRCEDPKDP 796

Query: 865 -FGSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQ 909
            F +L+               S  Y+     H  +    Y   TSP+RRF D+V H Q+ 
Sbjct: 797 YFNTLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRFCDVVAHRQLA 856

Query: 910 HFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYL-----LNYLKEQIKKNPSQ 964
             I  +P   S  D  KM       D+I R ++ K           + Y   Q+ +N   
Sbjct: 857 GAIGYEPLDLSHRDKNKM-------DMICRNINRKHRNAQFAGRASIEYYVGQVMRNNES 909

Query: 965 TFDVLITSVSNLGFIHCILPNFSSSMGILKLK 996
           T    +  V N G +  ++P F    G+++L+
Sbjct: 910 TETGYVIKVFNNGIV-VLVPKFGVE-GLIRLE 939

>Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON}
           (83527..86493) [2967 nt, 989 aa]
          Length = 988

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 104/445 (23%), Positives = 170/445 (38%), Gaps = 66/445 (14%)

Query: 583 DFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNM 642
           D  D  +  ID     +IDD +  +KL N  F + +HIAD +  F+      D +     
Sbjct: 520 DLRDKLICSIDPPGCVDIDDALHAKKLPNGHFEVGVHIADVTH-FVKAGTPLDAE----- 573

Query: 643 ALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHNTF 702
             S+  + YL D    MLP      +DL          +FSV  E+D N + +K+  +  
Sbjct: 574 GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDENADIVKVDFSKS 631

Query: 703 KVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQN 762
            +R           +Y+     + +  +       T ++   +R L  +S  LK+ R+  
Sbjct: 632 VIR------SREAFSYEQAQLRIDDKNQ-------TDELTLGMRALLDLSIKLKQKRLDA 678

Query: 763 GNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTEMMILAN-SLAARLFKEN 821
           G   +        +   S + D G V   K    T S  LV E M+LAN S+A +++   
Sbjct: 679 GALNLASPEVKVHMD--SETSDPGEV-EIKKLLATNS--LVEEFMLLANISVARKIYDSF 733

Query: 822 KIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK----------------F 865
               + R +     A      F+IL E ++    L    E SK                F
Sbjct: 734 PQTAMLRRH-----AAPPSTNFEILNEMLQKRKGLSISLESSKALADSLDRCVDKKDPYF 788

Query: 866 GSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHF 911
            +L+               S  Y+     H  +    Y   TSP+RR+ D+V H Q+   
Sbjct: 789 NTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGA 848

Query: 912 IKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLIT 971
           I  +P   S  D  KM  I   ++I  R  + +      + Y   Q+ +N        + 
Sbjct: 849 IGYEPLDLSHRDKNKMEMI--CKNINRRHRNAQFAGRASIEYYVGQVMRNNESVETGYVI 906

Query: 972 SVSNLGFIHCILPNFSSSMGILKLK 996
            V N G +  I+P F    G+++L+
Sbjct: 907 KVLNNGIV-VIVPKFGVE-GLIRLE 929

>KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.367
           YOL021C
          Length = 996

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 107/452 (23%), Positives = 171/452 (37%), Gaps = 80/452 (17%)

Query: 583 DFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNM 642
           D  D  +  ID     +IDD +  +KL N  + + +HIAD +  F+      D +     
Sbjct: 528 DLRDKLICSIDPPGCVDIDDALHAKKLPNGHWEVGVHIADVTH-FVKPGTALDAE----- 581

Query: 643 ALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKI-LHNT 701
             S+  + YL D    MLP      +DL          +FSV  E+D N + I +  H +
Sbjct: 582 GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDENADIINVEFHKS 639

Query: 702 FKVRLGIVSKFPSNTTYDNVD-RILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRI 760
                  V +      Y+    RI     ++ L  G        +R L Q+S  LK+ R+
Sbjct: 640 -------VIRSREAFAYEQAQLRIDDPKQQDELTLG--------MRALLQLSIKLKQKRL 684

Query: 761 QNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTEMMILAN-SLAARLFK 819
           + G   +        +   S + D G V   K    T S  LV E M+LAN S+A +++ 
Sbjct: 685 EAGALNLASPEVKVHMD--SETSDPGEV-EIKKLLATNS--LVEEFMLLANISVARKIYD 739

Query: 820 ENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK--------------- 864
                 + R +     A      F+IL E ++   ++    E SK               
Sbjct: 740 SFPQTAMLRRH-----APPPATNFEILNEMLQRRKNMSISVESSKALADSLDRCEDPKDP 794

Query: 865 -FGSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQ 909
            F +L+               S  Y+     H  +    Y   TSP+RR+ D+V H Q+ 
Sbjct: 795 YFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDIVAHRQLA 854

Query: 910 HFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYL-----LNYLKEQIKKNPSQ 964
             I  +P      D  KM       D+I R ++ K           + Y   Q+ KN   
Sbjct: 855 GAIDYEPLSLDHRDKHKM-------DMICRNINRKHRNAQFAGRASIEYYVGQVMKNNES 907

Query: 965 TFDVLITSVSNLGFIHCILPNFSSSMGILKLK 996
                +  V N G +  ++P F    G+++L+
Sbjct: 908 LESGYVIKVFNNGIV-VLVPKFGVE-GLIRLE 937

>TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 102/461 (22%), Positives = 169/461 (36%), Gaps = 94/461 (20%)

Query: 581 HHDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLL 640
             D  D  +  ID     +IDD +  ++L+N  + + +HIAD +  F+      D +   
Sbjct: 527 RRDLRDKLICSIDPPGCVDIDDALHAKRLSNGNWEVGVHIADVTH-FVKPNTALDAE--- 582

Query: 641 NMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKI--L 698
               S+  + YL D    MLP      +DL          +FSV  E+D N   + +  +
Sbjct: 583 --GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVERFAFSVIWELDDNANIVNVDFM 638

Query: 699 HNTFKVRLGIVSKFPSNTTYDNVD-RILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKK 757
            +  K R           +Y+    RI   + ++ L  G        +R L Q+S  LK+
Sbjct: 639 KSVIKSREAF--------SYEQAQLRIDDPNQKDELTEG--------MRALLQLSIKLKQ 682

Query: 758 NRIQNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTK------SVTLVTEMMILAN 811
            R+  G         N     +    D        D N+ +      + +LV E M+LAN
Sbjct: 683 KRLDAG-------ALNLASPEVKVHMDS----ETSDPNEVEIKKLLATNSLVEEFMLLAN 731

Query: 812 -SLAARLFKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK------ 864
            S+A ++F       + R +     A      F+ L E ++    L    E SK      
Sbjct: 732 ISVARKIFDAFPQTAMLRRH-----AAPPSTNFETLNEMLQTRKGLSISIESSKALADSL 786

Query: 865 ----------FGSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFP 900
                     F +L+               S  Y+     H  +    Y   TSP+RR+ 
Sbjct: 787 DRCIDPQDPYFNTLVRIMSTRCMMAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRYC 846

Query: 901 DLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYL-----LNYLK 955
           D+V H Q+   I  +P      D  KM       D+I R ++ K           + Y  
Sbjct: 847 DVVAHRQLAGAIGYEPLDLMHRDKNKM-------DMICRNINKKHRNAQFAGRASIEYYV 899

Query: 956 EQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLK 996
            Q+ +N        +  V N G +  ++P F    G+++L+
Sbjct: 900 GQVMRNNETVEAGYVIKVLNNGIV-VLVPRFGVE-GLIRLE 938

>TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {ON}
           Anc_1.367 YOL021C
          Length = 1015

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 100/453 (22%), Positives = 170/453 (37%), Gaps = 74/453 (16%)

Query: 579 KFHHDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQN 638
           K   D  D  +  ID     +IDD +  ++L N  + + +HIAD +  F+      D + 
Sbjct: 543 KNRQDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTH-FVKPGTALDAE- 600

Query: 639 LLNMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNE--SIK 696
                 S+  + YL D    MLP      +DL          +FSV  E+D N E   +K
Sbjct: 601 ----GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDDNAEIIDVK 654

Query: 697 ILHNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLK 756
              +  + R           +Y+     + +  +       T ++   +R L ++S  LK
Sbjct: 655 FTKSVIRSREAF--------SYEQAQLRIDDKNQ-------TDELTKGMRALLELSVKLK 699

Query: 757 KNRIQNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTEMMILAN-SLAA 815
           + R+  G   +         V +         +  K    T S  LV E M+LAN S+A 
Sbjct: 700 QKRLDAGALNLASPEVK---VHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVAR 754

Query: 816 RLFKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK----------- 864
           ++F       + R +     A      F IL E ++   +L    E SK           
Sbjct: 755 KIFDAFPQTAMLRRH-----ASPPSTNFAILNEMLQKRKNLSISLESSKALADSLDRCID 809

Query: 865 -----FGSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNH 905
                F +L+               S  Y      H  +    Y   TSP+RRF D++ H
Sbjct: 810 PKDPYFNTLIRIMSTRCMMAAQYFYSGAYQYSDFRHYGLAVDIYTHFTSPIRRFCDVIAH 869

Query: 906 MQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIR--ELSGKCNKYYLLNYLKEQIKKNPS 963
            Q+   I  +P      D  KM  I ++ +   R  + +G+ +    + Y   Q+ +N  
Sbjct: 870 RQLAGAIGYEPLALMHRDKNKMEMICKNINKKHRNAQFAGRAS----IEYYVGQVMRNNE 925

Query: 964 QTFDVLITSVSNLGFIHCILPNFSSSMGILKLK 996
            T    +  V N G +  ++P F    G+++++
Sbjct: 926 CTETGYVIKVLNNGIV-VLVPKFGVE-GLIRIE 956

>Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {ON}
            similar to Ashbya gossypii AEL031C
          Length = 988

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 105/455 (23%), Positives = 168/455 (36%), Gaps = 71/455 (15%)

Query: 581  HHDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLL 640
              D  D  +  ID     +IDD +  +KL N  + + +HIAD +  F+      D +   
Sbjct: 519  RRDMRDKLICSIDPPGCVDIDDALHAKKLINGNWEVGVHIADVTH-FVKPNTALDAE--- 574

Query: 641  NMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEV--DSNNESIKIL 698
                S++ + YL D    MLP      +DL          +FSV  E+  D+N  S++  
Sbjct: 575  --GASRATSVYLVDKRIDMLPMLLG--TDLCSLKASVDRFAFSVIWELDNDANIVSVEFT 630

Query: 699  HNTFKVRLGIVSKFPSNTTYDNVD-RILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKK 757
             +  + R           +Y+    RI   +  + L  G        +R L Q+S  LK+
Sbjct: 631  KSVIRSREAF--------SYEQAQLRIDDPNQNDELTLG--------MRALLQLSKKLKQ 674

Query: 758  NRIQNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTEMMILAN-SLAAR 816
             R+  G   +         V +         +  K    T S  LV E M+LAN S+A +
Sbjct: 675  KRLDAGALNLASPEVK---VHMDSETSDPSEVEIKKLLSTNS--LVEEFMLLANISVARK 729

Query: 817  LFKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK------------ 864
            ++       + R +     A      F+ L E ++V  ++    E SK            
Sbjct: 730  IYDSFPQTAMLRRH-----AAPPSTNFESLNEMLQVRKNMSISLESSKALADSLDRCVDS 784

Query: 865  ----FGSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHM 906
                F +L+               S  Y+     H  +    Y   TSP+RR+ D++ H 
Sbjct: 785  DDVYFNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDIIAHR 844

Query: 907  QIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKKNPSQTF 966
            Q+   I  +    S  D QKM  I   R+I  R  + +      + Y   Q+ +N     
Sbjct: 845  QLAAAIGYESLDLSHRDKQKMEII--CRNINKRHRNAQFAGRASIEYHVGQVMRNNESIE 902

Query: 967  DVLITSVSNLGFIHCILPNFSSSMGILKLKPDLDF 1001
               +  V N G I  ++P F     IL      DF
Sbjct: 903  TGYVIKVFNNG-IAVLVPKFGVEGLILAENLTTDF 936

>KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} highly
            similar to uniprot|Q08162 Saccharomyces cerevisiae
            YOL021C DIS3 Nucleolar exosome component involved in rRNA
            processing and RNA degradation binds Gsp1p/Ran and
            enhances the GEF activity of Srm1p implicated in mitotic
            control homologous to the E. coli RNase R of the RNase II
            family
          Length = 986

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 107/462 (23%), Positives = 174/462 (37%), Gaps = 80/462 (17%)

Query: 581  HHDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLL 640
              D  D  +  ID     +IDD +  +KL N  + + +HIAD +  F+      D +   
Sbjct: 516  RRDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTH-FVKANTPLDAE--- 571

Query: 641  NMALSKSFTTYLPDLVSPMLP----KSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIK 696
                S+  + YL D    MLP     + C L             +FSV  E+D N   + 
Sbjct: 572  --GASRGTSVYLVDKRIDMLPMLLGTNLCSLKPY------VDRFAFSVLWELDENANIVN 623

Query: 697  I--LHNTFKVRLGIVSKFPSNTTYDNVD-RILSNSTEENLKSGVTSDIQNDLRNLSQISN 753
            +    +  K R           +Y+    RI   S ++ L  G        +R L Q+S 
Sbjct: 624  VDFTKSVIKSREAF--------SYEQAQLRIDDESQKDELTQG--------MRALLQLSI 667

Query: 754  LLKKNRIQNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTEMMILAN-S 812
             LK+ R+  G   +        +   S + D G V   K    T S  LV E M+LAN S
Sbjct: 668  KLKQKRLDAGALNLASPEVKVHMD--SETSDPGEV-EIKKLLATNS--LVEEFMLLANIS 722

Query: 813  LAARLFKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK-------- 864
            +A R+++      + R     H A  A   F+ L E +++   +    E SK        
Sbjct: 723  VARRIYEAFPQTAMLR----RHAAPPAT-NFETLNEMLQLRKGMSISLESSKALANSLDR 777

Query: 865  --------FGSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDL 902
                    F +L+               +  Y+     H  +    Y   TSP+RR+ D+
Sbjct: 778  CVDLEDPYFNTLVRIMSTRCMMAAQYFYAGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDV 837

Query: 903  VNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKKNP 962
            V H Q+   I  +P   +  D  KM      R+I  +  + +      + Y   Q+ +N 
Sbjct: 838  VAHRQLAAAIGYEPLDLNHRDKNKM--DFMCRNINKKHRNAQFAGRASIEYYVGQVMRNN 895

Query: 963  SQTFDVLITSVSNLGFIHCILPNFSSSMGILKLKPDLDFTPS 1004
                   +  V + G +  ++P F    G+++L+   D  PS
Sbjct: 896  ESVETGYVIRVFHNGIV-VLVPKFGVE-GLIRLENLTDDEPS 935

>Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 97/452 (21%), Positives = 171/452 (37%), Gaps = 82/452 (18%)

Query: 583 DFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNM 642
           D  D  +  ID     +IDD +  ++L N  + + +HIAD +  F+      D +     
Sbjct: 533 DLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTH-FVKPNTALDAE----- 586

Query: 643 ALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVD--SNNESIKILHN 700
             ++  + YL D    MLP      +DL          +FSV  E+D  +N  ++  + +
Sbjct: 587 GAARGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDDDANIVNVDFMKS 644

Query: 701 TFKVRLGIVSKFPSNTTYDNVD-RILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNR 759
             K R           +Y+    RI   +  + L SG        +R L ++S  LK+ R
Sbjct: 645 VIKSREAF--------SYEQAQFRIDDKNQNDELTSG--------MRALLELSIKLKQKR 688

Query: 760 IQNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTEMMILAN-SLAARLF 818
           ++ G   +        + + +   +   +      N     +LV E M+LAN S+A +++
Sbjct: 689 LEAGALNLASPEVKVHMDSETSDPNEVEIKKLLATN-----SLVEEFMLLANISVARKIY 743

Query: 819 KENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK-------------- 864
                  + R +     A      F+I+ E +    ++    E SK              
Sbjct: 744 DAFPQTAMLRRH-----AAPPSTNFEIMNEMLNTRKNMSISLESSKALADSLDRCVDPED 798

Query: 865 --FGSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQI 908
             F +L+               S  Y+     H  +    Y   TSP+RR+ D+V H Q+
Sbjct: 799 PYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 858

Query: 909 QHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYL-----LNYLKEQIKKNPS 963
              I  +P   +  D  KM       D+I R ++ K           + Y   Q+ +N  
Sbjct: 859 AGAIGYEPLSLTHRDKNKM-------DMICRNINRKHRNAQFAGRASIEYYVGQVMRNNE 911

Query: 964 QTFDVLITSVSNLGFIHCILPNFSSSMGILKL 995
            T    +  V N G +  ++P F    G+++L
Sbjct: 912 STETGYVIKVFNNGIV-VLVPKFGVE-GLIRL 941

>Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa]
           {ON} YOL021C (REAL)
          Length = 1030

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 100/458 (21%), Positives = 171/458 (37%), Gaps = 94/458 (20%)

Query: 583 DFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNM 642
           D  D  +  ID     +IDD +   KL N  + + +HIAD +  F+      D +     
Sbjct: 562 DLRDKVICSIDPPGCVDIDDALHARKLPNGNWEVGVHIADVTH-FVKPSTALDAE----- 615

Query: 643 ALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNE--SIKILHN 700
             ++  + YL D    MLP      +DL          +FSV  E+D N +  +++ + +
Sbjct: 616 GAARGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVMWELDDNADIVNVEFMKS 673

Query: 701 TFKVRLGIVSKFPSNTTYDNVD-RILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNR 759
             K R           +Y+    RI   + ++ L  G        +R L ++S  LK+ R
Sbjct: 674 VIKSREAF--------SYEQAQLRIDDKNQDDELTLG--------MRALLKLSIKLKQKR 717

Query: 760 IQNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTK------SVTLVTEMMILAN-S 812
           ++ G         N     +    D        D N+ +      + +LV E M+LAN S
Sbjct: 718 LEAG-------ALNLASPEVKVHMDS----ETSDPNEVEIKKLLATNSLVEEFMLLANIS 766

Query: 813 LAARLFKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK-------- 864
           +A +++       + R +     A      F+ L E +    ++    E SK        
Sbjct: 767 VARKIYDAFPQTAMLRRH-----AAPPSTNFETLNEMLNTRKNMSISLESSKALADSLDR 821

Query: 865 --------FGSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDL 902
                   F +L+               S  Y+     H  +    Y   TSP+RR+ D+
Sbjct: 822 CVDSEDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDV 881

Query: 903 VNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYL-----LNYLKEQ 957
           V H Q+   I  +P   +  D  KM       D+I R ++ K           + Y   Q
Sbjct: 882 VAHRQLAGAIGYEPLSLAHRDKNKM-------DMICRNINRKHRNAQFAGRASIEYYVGQ 934

Query: 958 IKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKL 995
           + ++   T    I  V N G +  ++P F    G+++L
Sbjct: 935 VMRSNESTETGYIIKVFNNGIV-VLVPKFGVE-GLIRL 970

>YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}
           DIS3Exosome core complex catalytic subunit; possesses
           both endonuclease and 3'-5' exonuclease activity;
           involved in 3'-5' RNA processing and degradation in both
           the nucleus and the cytoplasm; has similarity to E. coli
           RNase R and to human DIS3
          Length = 1001

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 102/450 (22%), Positives = 170/450 (37%), Gaps = 78/450 (17%)

Query: 583 DFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNM 642
           D  D  +  ID     +IDD +  +KL N  + + +HIAD +  F+      D +     
Sbjct: 533 DLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTH-FVKPGTALDAE----- 586

Query: 643 ALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHNTF 702
             ++  + YL D    MLP      +DL          +FSV  E+D   +S  I++  F
Sbjct: 587 GAARGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELD---DSANIVNVNF 641

Query: 703 KVRLGIVSKFPSNTTYDNVD-RILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQ 761
              +  V +     +Y+    RI   +  + L  G        +R L ++S  LK+ R++
Sbjct: 642 ---MKSVIRSREAFSYEQAQLRIDDKTQNDELTMG--------MRALLKLSVKLKQKRLE 690

Query: 762 NGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTEMMILAN-SLAARLFKE 820
            G   +         V +         +  K    T S  LV E M+LAN S+A +++  
Sbjct: 691 AGALNLASPEVK---VHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKIYDA 745

Query: 821 NKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK---------------- 864
                + R +     A      F+IL E +    ++    E SK                
Sbjct: 746 FPQTAMLRRH-----AAPPSTNFEILNEMLNTRKNMSISLESSKALADSLDRCVDPEDPY 800

Query: 865 FGSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQH 910
           F +L+               S  Y+     H  +    Y   TSP+RR+ D+V H Q+  
Sbjct: 801 FNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAG 860

Query: 911 FIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYL-----LNYLKEQIKKNPSQT 965
            I  +P   +  D  KM       D+I R ++ K           + Y   Q+ +N   T
Sbjct: 861 AIGYEPLSLTHRDKNKM-------DMICRNINRKHRNAQFAGRASIEYYVGQVMRNNEST 913

Query: 966 FDVLITSVSNLGFIHCILPNFSSSMGILKL 995
               +  V N G +  ++P F    G+++L
Sbjct: 914 ETGYVIKVFNNGIV-VLVPKFGVE-GLIRL 941

>TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 110/504 (21%), Positives = 192/504 (38%), Gaps = 67/504 (13%)

Query: 524 QGTSKDTPNGINNQDPQFNLLHNNIEIALPNSS---KLTKDQTLFYNLIEPPKLTQFSKF 580
           +    +T + +   D ++      +   LP+     K+  D T    L + P+L +    
Sbjct: 471 ESVQAETESLLLEHDVEYRPFSKKVLDCLPSEGHEWKVPSDLTSSDALAKDPQLAR---- 526

Query: 581 HHDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLL 640
             D  D  +  ID     +IDD +  +KL N  + + +HIAD +  F+      D +   
Sbjct: 527 RKDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTH-FVKPNTPLDAE--- 582

Query: 641 NMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHN 700
               S+  + YL D    MLP      +DL          +FSV  E+D N   + +  N
Sbjct: 583 --GASRGTSVYLVDKRIDMLP--LLLGTDLCSLKPYVDRYAFSVLWELDDNANIVDV--N 636

Query: 701 TFKVRLGIVSKFPSNTTYDNVD-RILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNR 759
             K  +     F    +Y+    RI   S  + L  G        +R L ++S  LK+ R
Sbjct: 637 FTKSVIRSREAF----SYEQAQIRIDDKSQTDELTQG--------MRALLKLSIKLKQKR 684

Query: 760 IQNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTEMMILAN-SLAARLF 818
           +  G   +         V +         +  K    T S  LV E M+LAN S+A ++F
Sbjct: 685 LDAGALNLASPEVK---VHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKIF 739

Query: 819 KENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK------------FG 866
           +      + R  H +  +   +   ++L +  ++   L + K ++             F 
Sbjct: 740 ESFPQTAMLR-RHGVPPSTNFETLNEMLHQRKQMTISLESSKALADSLDRCVDPKDPYFN 798

Query: 867 SLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFI 912
           +L+               S  Y+     H  +    Y   TSP+RR+ D+V H Q+   I
Sbjct: 799 TLIRIMSTRCMMAAQYFYSGAYSYSEFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAI 858

Query: 913 KKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITS 972
             +P   S  D  KM  I   R+I  R  + +      + Y   Q+ +N        +  
Sbjct: 859 GYEPLDLSHRDKNKMDMI--CRNINKRHRNAQFAGRASIEYYVGQVMRNNESVETGYVIK 916

Query: 973 VSNLGFIHCILPNFSSSMGILKLK 996
           V N G +  ++P F    G+++++
Sbjct: 917 VLNNGIV-VLVPRFGVE-GLIRIE 938

>Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 100/451 (22%), Positives = 166/451 (36%), Gaps = 80/451 (17%)

Query: 583 DFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNM 642
           D  D  +  ID     +IDD +  ++L N  + + +HIAD +  F+      D +     
Sbjct: 533 DLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTH-FVKPGTALDAE----- 586

Query: 643 ALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKI--LHN 700
             ++  + YL D    MLP      +DL          +FSV  E+D N   + +  + +
Sbjct: 587 GAARGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWELDENANIVNVDFMKS 644

Query: 701 TFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRI 760
             + R      F        +D I  N   + L  G        +R L Q+S  LK+ R+
Sbjct: 645 VIRSR----EAFSYEQAQLRIDDINQN---DELTLG--------MRALLQLSVKLKQKRL 689

Query: 761 QNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTEMMILAN-SLAARLFK 819
           + G   +         V +         +  K    T S  LV E M+LAN S+A +++ 
Sbjct: 690 EAGALNLASPEVK---VHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKIYD 744

Query: 820 ENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK--------------- 864
                 + R +     A      F+ L E +    ++    E SK               
Sbjct: 745 AFPQTAMLRRH-----AAPPSTNFETLNEMLNTRKNMSISLESSKALADSLDRCVDPEDP 799

Query: 865 -FGSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQ 909
            F +L+               S  Y+     H  +    Y   TSP+RR+ D+V H Q+ 
Sbjct: 800 YFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLA 859

Query: 910 HFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYL-----LNYLKEQIKKNPSQ 964
             I  +P   +  D  KM       D+I R ++ K           + Y   Q+ +N   
Sbjct: 860 GAIGYEPLSLTHRDKNKM-------DMICRNINRKHRNAQFAGRASIEYYVGQVMRNNES 912

Query: 965 TFDVLITSVSNLGFIHCILPNFSSSMGILKL 995
           T    +  V N G +  ++P F    G+++L
Sbjct: 913 TETGYVIKVFNNGIV-VLVPKFGVE-GLIRL 941

>CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa]
           {ON} highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021c DIS3
          Length = 1007

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 99/449 (22%), Positives = 166/449 (36%), Gaps = 70/449 (15%)

Query: 581 HHDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLL 640
             D  D  +  ID     +IDD +  + L N  + + +HIAD +  F+      D +   
Sbjct: 537 RRDLRDKLICSIDPPNCVDIDDALHAKMLENGNWEVGVHIADVTH-FVKPGTALDAE--- 592

Query: 641 NMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHN 700
               S+  + YL D    MLP      +DL          +FSV  E+D +   + +   
Sbjct: 593 --GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDQDANIVNVDFT 648

Query: 701 TFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRI 760
              +R      F        +D    N T+E         +   +R L Q+S  LK+ R+
Sbjct: 649 KSVIRSR--EAFSYEQAQIRIDD--PNQTDE---------LTQGMRALLQLSKKLKQKRL 695

Query: 761 QNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTEMMILAN-SLAARLFK 819
             G   +         V +         +  K    T S  LV E M+LAN S+A +++ 
Sbjct: 696 DAGALNLASPEVK---VHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKIYD 750

Query: 820 ENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK--------------- 864
                 + R +     A      F+IL E ++    L    E SK               
Sbjct: 751 SFPQTAMLRRH-----AAPPSTNFEILNEMLQTKKGLTISLESSKALADSLDRCVDKNDP 805

Query: 865 -FGSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQ 909
            F +L+               S  Y+     H  +    Y   TSP+RR+ D+V H Q+ 
Sbjct: 806 YFNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLA 865

Query: 910 HFIKKKPFKYSTTDIQKMLPIIQSRDIIIR--ELSGKCNKYYLLNYLKEQIKKNPSQTFD 967
             I  +P   +  D  KM  I ++ +   R  + +G+ +    + Y   Q+ +N      
Sbjct: 866 AAIGYEPLSLTHRDKTKMDMICKNINRKHRNAQFAGRAS----IEYYVGQVMRNNESVET 921

Query: 968 VLITSVSNLGFIHCILPNFSSSMGILKLK 996
             +  V N G +  ++P F    G+++L+
Sbjct: 922 GYVIKVFNNGIV-VLVPKFGVE-GLIRLE 948

>SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 988

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 106/479 (22%), Positives = 180/479 (37%), Gaps = 82/479 (17%)

Query: 550 IALPNSSKLTKDQTLFYNLIEPPKLTQFSKFHHDFNDLKVYCIDSETAHEIDDGISIEKL 609
           ++L +S  ++KD  L       PK         D  D  +  ID     +IDD +  ++L
Sbjct: 501 VSLDDSDAISKDPLL-------PK-------RRDLRDKLICSIDPPGCVDIDDALHAKQL 546

Query: 610 NNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNMALSKSFTTYLPDLVSPMLPKSFCKLSD 669
            N  + + +HIAD +  F+      D +       S+  + YL D    MLP      +D
Sbjct: 547 PNGNWEVGVHIADVTH-FVKAGTPLDAE-----GASRGTSVYLVDKRIDMLPMLLG--TD 598

Query: 670 LGYDNQKTATISFSVNVEVDSNNESIKILHNTFKVRLGIVSKFPSNTTYDNVD-RILSNS 728
           L          +FSV  E+D     + +      +R           +Y+    RI   +
Sbjct: 599 LCSLKPYVDRFAFSVIWELDQKASIVNVDFTKSVIR------SREAFSYEQAQLRIDDPN 652

Query: 729 TEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQNGNAVIFGEGFNKGLVTLSCSKDGGPV 788
            ++ L  G        +R L  +S  LK+ R+  G A+       K  +    S  G   
Sbjct: 653 QKDELTQG--------MRALLNLSVKLKQKRLDAG-ALNLASPEVKVHMDSETSDPGD-- 701

Query: 789 INFKDQNDTKSVTLVTEMMILAN-SLAARLFKENKIPGIFRCYHELHLAKKAQLEFDILR 847
           +  K    T S  LV E M+LAN S+A ++++      + R +     A      F+ L 
Sbjct: 702 VEIKKLLATNS--LVEEFMLLANISVAKKIYEAFPQTAMLRRH-----AAPPSTNFETLN 754

Query: 848 ENIKVNSHLPNIKEISK----------------FGSLLN--------------SSFYTDL 877
           E +++   +    E SK                F +L+               S  Y+  
Sbjct: 755 EMLQLRKSMSISLESSKALADSLDRCIDPQDPYFNTLVRIMSTRCMMAAQYFYSGAYSYA 814

Query: 878 PLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDII 937
              H  +    Y   TSP+RR+ D+V H Q+   I  +P   +  D  KM  I   ++I 
Sbjct: 815 DFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAIGYEPLDLTHRDKNKMEMI--CKNIN 872

Query: 938 IRELSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLK 996
            R  + +      + Y   Q+ +N        +  V N G +  ++P F    G+++L+
Sbjct: 873 KRHRNAQFAGRASIEYYVGQVMRNNESVETGYVIRVFNNGIV-VLVPKFGVE-GLIRLE 929

>ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON}
           highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021C DIS3 Nucleolar exosome component
           involved in rRNA processing and RNA degradation binds
           Gsp1p/Ran and enhances the GEF activity of Srm1p
           implicated in mitotic control homologous to the E. coli
           RNase R of the RNase II family
          Length = 993

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 104/450 (23%), Positives = 174/450 (38%), Gaps = 72/450 (16%)

Query: 581 HHDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLL 640
             D  D  +  ID     +IDD +  +KL N  + + +HIAD +  F+      D +   
Sbjct: 523 RRDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTH-FVKPNTALDGE--- 578

Query: 641 NMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHN 700
               S+  + YL D    MLP      +DL          +FSV  E+   NE+  I++ 
Sbjct: 579 --GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWEL---NENADIVNV 631

Query: 701 TFKVRLGIVSKFPSNTTYDNVD-RILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNR 759
            F      V K     +Y+    RI   + ++ L  G        +R L ++S  LK+ R
Sbjct: 632 DFA---KSVIKSREAFSYEQAQLRIDDPNQQDELTHG--------MRALLKLSIKLKEKR 680

Query: 760 IQNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTEMMILAN-SLAARLF 818
           I N  A+       K  V +         +  K    T S  LV E M+LAN S+A +++
Sbjct: 681 I-NAGALNLASPEVK--VHMDSETSDPNEVEIKKLLATNS--LVEEFMLLANISVARKIY 735

Query: 819 KENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK-------------- 864
                  + R +     A      F++L E ++    +    E SK              
Sbjct: 736 DSFPQTAMLRRH-----ASPPSTNFELLNEMLQTRKGMSISLESSKALADSLDRCIDPKD 790

Query: 865 --FGSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQI 908
             F +L+               S  Y+     H  +    Y   TSP+RR+ D+V H Q+
Sbjct: 791 PYFNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQL 850

Query: 909 QHFIKKKPFKYSTTDIQKMLPIIQSRDIIIR--ELSGKCNKYYLLNYLKEQIKKNPSQTF 966
              I  +P   S  D  +M  I ++ +   R  + +G+ +    + Y   Q+ +N     
Sbjct: 851 AGAIGYEPLDLSHRDKNRMDMICKNINKKHRNAQFAGRAS----IEYYVGQVMRNNESVE 906

Query: 967 DVLITSVSNLGFIHCILPNFSSSMGILKLK 996
              +  V N G +  ++P F    G+++L+
Sbjct: 907 TGYVIKVLNNGIV-VLVPKFGVE-GLIRLE 934

>KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1.367
           YOL021C
          Length = 1000

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 102/451 (22%), Positives = 170/451 (37%), Gaps = 78/451 (17%)

Query: 583 DFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLNM 642
           D  D  +  ID     +IDD +  ++L N  + + +HIAD +  F+      D +     
Sbjct: 532 DLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTH-FVKPGTALDAE----- 585

Query: 643 ALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHNTF 702
             S+  + YL D    MLP      +DL          +FSV  E+   NE   I++  F
Sbjct: 586 GASRGTSVYLVDKRIDMLPMLLG--TDLCSLKPYVDRFAFSVIWEL---NEDADIVNVDF 640

Query: 703 KVRLGIVSKFPSNTTYDNVD-RILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQ 761
                 V +     +Y+    RI  ++ ++ L  G        +R L  +S  LK+ R+ 
Sbjct: 641 TKS---VIRSREAFSYEQAQVRIDDSNQKDELTLG--------MRALLHLSKKLKQKRLD 689

Query: 762 NGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTEMMILAN-SLAARLFKE 820
            G   +        +   S + D G V   K    T S  LV E M+LAN S+A +++  
Sbjct: 690 AGALNLASPEVKVHMD--SETSDPGEV-EIKKLLATNS--LVEEFMLLANISVARKIYDA 744

Query: 821 NKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK---------------- 864
                + R +     A      F++L E +    ++    E SK                
Sbjct: 745 FPQTAMLRRH-----AAPPSTNFELLNEMLHQRKNMTISLESSKALADSLDRCIDPQDAY 799

Query: 865 FGSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLVNHMQIQH 910
           F +L+               S  Y+     H  +    Y   TSP+RR+ D+V H Q+  
Sbjct: 800 FNTLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRYCDVVAHRQLAA 859

Query: 911 FIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYL-----LNYLKEQIKKNPSQT 965
            I  +P      D  KM       D++ R ++ K           + Y   Q+ +N    
Sbjct: 860 AIDYEPLSLMHRDKNKM-------DMVCRNINKKHRNAQFAGRASIEYYVGQVMRNNESV 912

Query: 966 FDVLITSVSNLGFIHCILPNFSSSMGILKLK 996
               +  V N G +  ++P F    G+++L+
Sbjct: 913 ETGYVIKVFNNGIV-VLVPKFGVE-GLIRLE 941

>AEL031C Chr5 complement(574534..577527) [2994 bp, 997 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL021C
           (DIS3)
          Length = 997

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 98/450 (21%), Positives = 162/450 (36%), Gaps = 77/450 (17%)

Query: 581 HHDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLL 640
             D  D  +  ID     +IDD +  ++L N  + + +HIAD +  F+      D +   
Sbjct: 528 RRDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIADVTH-FVKPGTALDTE--- 583

Query: 641 NMALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHN 700
               S++ + YL +    MLP      +DL          +FSV  E+D++   + +   
Sbjct: 584 --GASRATSVYLVNKRIDMLPMLLG--TDLCSLKPYVDRFAFSVLWELDADANIVNVDFT 639

Query: 701 TFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRI 760
              +R      F        +D +  N            ++ N +R L ++S  LK+ R+
Sbjct: 640 KSVIRSR--EAFSYEAAQLRIDDVNQN-----------DELTNGMRALLELSKKLKQKRL 686

Query: 761 QNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTK------SVTLVTEMMILANSLA 814
             G         N     +    D        D N+ +      + +LV E M+LAN   
Sbjct: 687 DAG-------ALNLASPEVKVHMDN----ETSDPNEVEIKKLLATNSLVEEFMLLANISV 735

Query: 815 ARLFKENKIPGIFRCYHELHL-AKKAQLEFDILRENIKVNSHLPNIKEISK--------- 864
           AR     KI   F     L   A      F+ L E ++V   +    E SK         
Sbjct: 736 AR-----KINDAFPQTAMLRRHAAPPSTNFEALNEMLQVRKKMAISLESSKALADSLDRC 790

Query: 865 -------FGSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLV 903
                  F +L+               S  ++     H  +    Y   TSP+RR+ D+V
Sbjct: 791 IDPEDPYFNTLVRIMSTRCMMAAQYFYSGAFSYSDFHHYGLAVDIYTHFTSPIRRYCDVV 850

Query: 904 NHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRELSGKCNKYYLLNYLKEQIKKNPS 963
            H Q+   I  +P   +  D QKM  I   ++I  R  + +      + Y   Q+ +N  
Sbjct: 851 VHRQLAGAIGYEPLDLTHRDKQKMEMI--CKNINRRHRNAQFAGRASIEYYVGQVMRNNH 908

Query: 964 QTFDVLITSVSNLGFIHCILPNFSSSMGIL 993
                 +  V N G +  ++P F     IL
Sbjct: 909 SVETGYVIKVFNNG-VAVLVPKFGVEGMIL 937

>Kwal_34.16245 s34 complement(260089..263049) [2961 bp, 986 aa] {ON}
           YOL021C (DIS3) - 3'-5' exoribonuclease complex subunit
           [contig 265] FULL
          Length = 986

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 101/455 (22%), Positives = 178/455 (39%), Gaps = 82/455 (18%)

Query: 581 HHDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLL 640
             D  D  +  ID     +IDD +  ++L N  + + +HIAD +  F+      D +   
Sbjct: 516 RRDLRDKLICSIDPPGCVDIDDALHAKQLPNGNWEVGVHIADVTH-FVKPNTPLDAE--- 571

Query: 641 NMALSKSFTTYLPDLVSPMLP----KSFCKLSDLGYDNQKTATISFSVNVEV--DSNNES 694
               S+  + YL D    MLP     + C L             +FSV  E+  D+N  +
Sbjct: 572 --GASRGTSVYLVDKRIDMLPMLLGTNLCSLKPY------VDRFAFSVLWELDQDANIVN 623

Query: 695 IKILHNTFKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNL 754
           +    +  K R           +Y+     + +ST+       T ++   +R L  +S  
Sbjct: 624 VDFTKSVIKSREAF--------SYEQAQLRIDDSTQ-------TDELTQGMRALLSLSIK 668

Query: 755 LKKNRIQNGNAVIFGEGFNKGLVTLSCSKDGGPVINFKDQNDTKSVTLVTEMMILAN-SL 813
           LK+ R+ N  A+       K  +    S  G   +  K    T S  LV E M+LAN S+
Sbjct: 669 LKEKRL-NAGALNLASPEVKVHMDSETSDPGE--VEIKKLLATNS--LVEEFMLLANISV 723

Query: 814 AARLFKENKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISK--------- 864
           A ++++      + R     H A  A   F+ L E +++   +    E SK         
Sbjct: 724 ARKIYEAFPQTAMLR----RHAAPPAT-NFEALNEMLQLRKGMSISLESSKALADSLDRC 778

Query: 865 -------FGSLLN--------------SSFYTDLPLPHQMIGAANYLTVTSPLRRFPDLV 903
                  F +L+               S  Y+     H  +    Y   TSP+RR+ D+V
Sbjct: 779 VDPKDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVV 838

Query: 904 NHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIR--ELSGKCNKYYLLNYLKEQIKKN 961
            H Q+   I  +    +  D  KM  + ++ +   R  + +G+ +  Y   Y+ + ++ N
Sbjct: 839 AHRQLAAAIGYEALDLNHRDKNKMEFMCRNINKKHRNAQFAGRASIEY---YVGQVMRNN 895

Query: 962 PSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLK 996
            S+    +I    N G +  ++P F    G+++L+
Sbjct: 896 ESEETGYVIRVFHN-GIV-VLVPKFGVE-GLIRLE 927

>Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C
           (UBP3) - Ubiquitin-specific protease [contig 231]
           PARTIAL
          Length = 444

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 461 DDNSKIIALISKILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDA 514
           D++SK++      +R LTK+KD+   KD C +L +L    G +   + D +G+ 
Sbjct: 156 DEDSKMV-----FVRNLTKYKDAKFLKDPCNDLRELLEKYGANAEDTEDEAGNG 204

>ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} highly
           similar to uniprot|P15442 Saccharomyces cerevisiae
           YDR283C GCN2 Protein kinase phosphorylates the
           alpha-subunit of translation initiation factor eIF2
           (Sui2p) in response to starvation activated by uncharged
           tRNAs and the Gcn1p-Gcn20p complex
          Length = 1657

 Score = 32.3 bits (72), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 5/57 (8%)

Query: 16  LLKNYPNSQNTKYDYPSRKAYTPP--LHNNVTKHNKLSNEDIEKIKQTFLIRIKELD 70
           +L  +PN Q ++ ++PS  A+TPP  L NN TK ++L+  DI ++   F+  I  +D
Sbjct: 425 MLSRHPNKQGSRLEFPS-CAWTPPELLDNNNTKPHRLT--DIWEVGVLFIQVINGVD 478

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 112,453,669
Number of extensions: 5352706
Number of successful extensions: 22430
Number of sequences better than 10.0: 149
Number of HSP's gapped: 23113
Number of HSP's successfully gapped: 222
Length of query: 1029
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 909
Effective length of database: 39,721,479
Effective search space: 36106824411
Effective search space used: 36106824411
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)