Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B029108.851ON85854292e-56
KLLA0C06270g8.851ON84833121e-38
Kpol_237.28.851ON86833078e-38
NDAI0E002508.851ON93822992e-36
SAKL0D01144g8.851ON84832886e-35
Ecym_46248.851ON84832842e-34
Skud_13.4598.851ON83822755e-33
YMR286W (MRPL33)8.851ON86822755e-33
ZYRO0C14894g8.851ON84832747e-33
Suva_13.4768.851ON83822712e-32
TDEL0B002008.851ON86812712e-32
NCAS0B002608.851ON88822713e-32
AFR450C8.851ON84832687e-32
KAFR0A028708.851ON85832601e-30
Smik_13.5028.851ON84812531e-29
Kwal_27.102098.851ON84832513e-29
KNAG0G034808.851ON84802503e-29
CAGL0I02706g8.851ON89812497e-29
TPHA0I003308.851ON88822359e-27
KLTH0C03630g8.851ON84832271e-25
Suva_10.294.14ON314161650.71
ZYRO0F11572g7.343ON73165631.5
TBLA0I015102.541ON109176612.7
KLTH0C11594g6.7ON100645603.3
KLTH0D14938g4.274ON101430586.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B02910
         (85 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B02910 Chr2 (670926..671183) [258 bp, 85 aa] {ON} Anc_8.851...   169   2e-56
KLLA0C06270g Chr3 (554658..554912) [255 bp, 84 aa] {ON} highly s...   124   1e-38
Kpol_237.2 s237 (2310..2570) [261 bp, 86 aa] {ON} (2310..2570) [...   122   8e-38
NDAI0E00250 Chr5 complement(29470..29751) [282 bp, 93 aa] {ON} A...   119   2e-36
SAKL0D01144g Chr4 complement(85723..85977) [255 bp, 84 aa] {ON} ...   115   6e-35
Ecym_4624 Chr4 (1221125..1221379) [255 bp, 84 aa] {ON} similar t...   114   2e-34
Skud_13.459 Chr13 (815502..815750) [249 bp, 83 aa] {ON} YMR286W ...   110   5e-33
YMR286W Chr13 (841942..842202) [261 bp, 86 aa] {ON}  MRPL33Mitoc...   110   5e-33
ZYRO0C14894g Chr3 (1157672..1157926) [255 bp, 84 aa] {ON} highly...   110   7e-33
Suva_13.476 Chr13 (823880..824128) [249 bp, 83 aa] {ON} YMR286W ...   108   2e-32
TDEL0B00200 Chr2 (38779..39039) [261 bp, 86 aa] {ON} Anc_8.851 Y...   108   2e-32
NCAS0B00260 Chr2 complement(27274..27540) [267 bp, 88 aa] {ON} A...   108   3e-32
AFR450C Chr6 complement(1248240..1248494) [255 bp, 84 aa] {ON} S...   107   7e-32
KAFR0A02870 Chr1 (598363..598620) [258 bp, 85 aa] {ON} Anc_8.851...   104   1e-30
Smik_13.502 Chr13 (824481..824732) [252 bp, 84 aa] {ON} YMR286W ...   102   1e-29
Kwal_27.10209 s27 (241628..241882) [255 bp, 84 aa] {ON} YMR286W ...   101   3e-29
KNAG0G03480 Chr7 (745051..745305) [255 bp, 84 aa] {ON} Anc_8.851...   100   3e-29
CAGL0I02706g Chr9 (241613..241882) [270 bp, 89 aa] {ON} highly s...   100   7e-29
TPHA0I00330 Chr9 (63570..63836) [267 bp, 88 aa] {ON} Anc_8.851 Y...    95   9e-27
KLTH0C03630g Chr3 (315520..315774) [255 bp, 84 aa] {ON} similar ...    92   1e-25
Suva_10.29 Chr10 complement(57917..67342) [9426 bp, 3141 aa] {ON...    30   0.71 
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...    29   1.5  
TBLA0I01510 Chr9 (327184..330459) [3276 bp, 1091 aa] {ON} Anc_2....    28   2.7  
KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] ...    28   3.3  
KLTH0D14938g Chr4 (1220665..1223709) [3045 bp, 1014 aa] {ON} sim...    27   6.4  

>TBLA0B02910 Chr2 (670926..671183) [258 bp, 85 aa] {ON} Anc_8.851
          YMR286W
          Length = 85

 Score =  169 bits (429), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 85/85 (100%), Positives = 85/85 (100%)

Query: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60
          MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK
Sbjct: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60

Query: 61 ALTKAEVHDSRRSNPGFIIEKRVST 85
          ALTKAEVHDSRRSNPGFIIEKRVST
Sbjct: 61 ALTKAEVHDSRRSNPGFIIEKRVST 85

>KLLA0C06270g Chr3 (554658..554912) [255 bp, 84 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286W MRPL33 Mitochondrial ribosomal protein of the
          large subunit
          Length = 84

 Score =  124 bits (312), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 57/83 (68%), Positives = 72/83 (86%)

Query: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60
          +FY+ITLQRS+IG PQK+R++VKSLGLGKRGS+AYQ  +PS AGA+ ++KELV VEL DK
Sbjct: 2  VFYRITLQRSVIGTPQKTRAVVKSLGLGKRGSVAYQPATPSIAGAVAQIKELVSVELADK 61

Query: 61 ALTKAEVHDSRRSNPGFIIEKRV 83
          AL+KAE  + R+SNPGF +EKRV
Sbjct: 62 ALSKAEQRELRKSNPGFTVEKRV 84

>Kpol_237.2 s237 (2310..2570) [261 bp, 86 aa] {ON} (2310..2570)
          [261 nt, 87 aa]
          Length = 86

 Score =  122 bits (307), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 73/83 (87%)

Query: 2  FYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDKA 61
          FYKITL RSLIGLPQ +R+IVK++GLGKRGSI Y++++PS AG++ +VKELV VEL+DK 
Sbjct: 3  FYKITLTRSLIGLPQATRNIVKTIGLGKRGSIVYREVTPSIAGSLAKVKELVSVELSDKM 62

Query: 62 LTKAEVHDSRRSNPGFIIEKRVS 84
          LT+ EV+ SR+SNPGF +EKRV+
Sbjct: 63 LTREEVNASRKSNPGFTVEKRVN 85

>NDAI0E00250 Chr5 complement(29470..29751) [282 bp, 93 aa] {ON}
          Anc_8.851 YMR286W
          Length = 93

 Score =  119 bits (299), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 53/82 (64%), Positives = 73/82 (89%)

Query: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60
          +FYKITLQRSLIGLP+++R+IVK++GLGKRGSI Y++++P+ AG++ +VKEL+DVE+T+K
Sbjct: 2  VFYKITLQRSLIGLPKQTRTIVKTIGLGKRGSIVYRRVTPAMAGSLAKVKELIDVEITEK 61

Query: 61 ALTKAEVHDSRRSNPGFIIEKR 82
          AL K E  + R+SNPGF IEKR
Sbjct: 62 ALNKMEQRELRKSNPGFTIEKR 83

>SAKL0D01144g Chr4 complement(85723..85977) [255 bp, 84 aa] {ON}
          highly similar to uniprot|P20084 Saccharomyces
          cerevisiae YMR286W MRPL33 Mitochondrial ribosomal
          protein of the large subunit
          Length = 84

 Score =  115 bits (288), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 52/83 (62%), Positives = 72/83 (86%)

Query: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60
          +FYKITL RS IGLP+ ++SIVKSLGLGKRGS  Y++++PS AG+I ++KELVD+E+T+K
Sbjct: 2  VFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTEK 61

Query: 61 ALTKAEVHDSRRSNPGFIIEKRV 83
          AL+K E  + R+SNPGF++EKR+
Sbjct: 62 ALSKEEQRELRKSNPGFVVEKRL 84

>Ecym_4624 Chr4 (1221125..1221379) [255 bp, 84 aa] {ON} similar to
          Ashbya gossypii AFR450C
          Length = 84

 Score =  114 bits (284), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 52/83 (62%), Positives = 67/83 (80%)

Query: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60
          +FYKI L RS IG+P K+R++VKSLGLGKRGS+ Y  +SP+ AGAI +VKELV+VE+TDK
Sbjct: 2  VFYKIVLSRSTIGMPAKTRAVVKSLGLGKRGSVVYHSVSPTVAGAIAKVKELVNVEVTDK 61

Query: 61 ALTKAEVHDSRRSNPGFIIEKRV 83
          AL+K E    R SNPG+ +EKR+
Sbjct: 62 ALSKEEQRQLRTSNPGYTVEKRL 84

>Skud_13.459 Chr13 (815502..815750) [249 bp, 83 aa] {ON} YMR286W
          (REAL)
          Length = 83

 Score =  110 bits (275), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 48/82 (58%), Positives = 69/82 (84%)

Query: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60
          +FYKITL RSLIG+P  ++SIVKSLGLGKRGSIAY++++P+ AG++ +VKEL+ +E+T+ 
Sbjct: 2  VFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTEH 61

Query: 61 ALTKAEVHDSRRSNPGFIIEKR 82
           LT  +  + R+SNPGF++EKR
Sbjct: 62 ELTSTQQRELRKSNPGFVVEKR 83

>YMR286W Chr13 (841942..842202) [261 bp, 86 aa] {ON}
          MRPL33Mitochondrial ribosomal protein of the large
          subunit
          Length = 86

 Score =  110 bits (275), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 50/82 (60%), Positives = 69/82 (84%)

Query: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60
          +FYK+TL RSLIG+P  ++SIVKSLGLGKRGSI Y+K++P+ AG++ +VKELV VE+T+ 
Sbjct: 2  VFYKVTLSRSLIGVPHTTKSIVKSLGLGKRGSIVYKKVNPAIAGSLAKVKELVKVEVTEH 61

Query: 61 ALTKAEVHDSRRSNPGFIIEKR 82
           LT ++  + R+SNPGFI+EKR
Sbjct: 62 ELTPSQQRELRKSNPGFIVEKR 83

>ZYRO0C14894g Chr3 (1157672..1157926) [255 bp, 84 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286W
          Length = 84

 Score =  110 bits (274), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 67/83 (80%)

Query: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60
          +FYK+TL RSLIG+P   R++VKSLGLGKRGS  Y++++P  AG++ +VKELV+VE+T  
Sbjct: 2  VFYKVTLSRSLIGVPHTVRNVVKSLGLGKRGSTVYRRVTPQCAGSLAKVKELVNVEVTQH 61

Query: 61 ALTKAEVHDSRRSNPGFIIEKRV 83
          ALTK +  + R+SNPGF +EKRV
Sbjct: 62 ALTKEQQRELRKSNPGFTVEKRV 84

>Suva_13.476 Chr13 (823880..824128) [249 bp, 83 aa] {ON} YMR286W
          (REAL)
          Length = 83

 Score =  108 bits (271), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 48/82 (58%), Positives = 68/82 (82%)

Query: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60
          +FYKITL RSLIG+P  ++S+VKSLGLGKRGSI Y++++P+ AG++ +VKELV VE+T+ 
Sbjct: 2  VFYKITLSRSLIGMPHTTKSVVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVEVTEH 61

Query: 61 ALTKAEVHDSRRSNPGFIIEKR 82
           LT  +  + R+SNPGF++EKR
Sbjct: 62 ELTPYQQRELRKSNPGFVVEKR 83

>TDEL0B00200 Chr2 (38779..39039) [261 bp, 86 aa] {ON} Anc_8.851
          YMR286W
          Length = 86

 Score =  108 bits (271), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 50/81 (61%), Positives = 66/81 (81%)

Query: 2  FYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDKA 61
          FYKITL RS+IG P  ++SIVKSLGLGK GSI Y++++P+ AGA+ +VKELV VE+T+  
Sbjct: 3  FYKITLARSVIGTPHTTKSIVKSLGLGKTGSIVYKQVTPACAGALAKVKELVKVEVTENK 62

Query: 62 LTKAEVHDSRRSNPGFIIEKR 82
          L+K E  + R+SNPGFI+EKR
Sbjct: 63 LSKEEQRELRKSNPGFIVEKR 83

>NCAS0B00260 Chr2 complement(27274..27540) [267 bp, 88 aa] {ON}
          Anc_8.851 YMR286W
          Length = 88

 Score =  108 bits (271), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 69/82 (84%)

Query: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60
          ++YKITL RS+IGLPQ +R IVK+LGLGKRGS+ Y++++P+ AG++++VKE++DVE+T  
Sbjct: 2  VYYKITLARSVIGLPQATRDIVKTLGLGKRGSVIYRQVTPAIAGSMIKVKEIIDVEVTKD 61

Query: 61 ALTKAEVHDSRRSNPGFIIEKR 82
          +L K E    R+SNPGF++EKR
Sbjct: 62 SLNKFEQRQLRKSNPGFVVEKR 83

>AFR450C Chr6 complement(1248240..1248494) [255 bp, 84 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR286W
          (MRPL33)
          Length = 84

 Score =  107 bits (268), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 65/83 (78%)

Query: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60
          +FYKITL RS IGLP K + +V SLGLGKRG+  Y+K+SP +AG+I ++KELV VE+T+ 
Sbjct: 2  VFYKITLARSTIGLPDKVKGVVHSLGLGKRGTTVYRKVSPGSAGSIAKIKELVKVEVTEH 61

Query: 61 ALTKAEVHDSRRSNPGFIIEKRV 83
          ALTK E    R+SNPGF +EKRV
Sbjct: 62 ALTKEEQRMLRKSNPGFTVEKRV 84

>KAFR0A02870 Chr1 (598363..598620) [258 bp, 85 aa] {ON} Anc_8.851
          YMR286W
          Length = 85

 Score =  104 bits (260), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 70/83 (84%)

Query: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60
          ++Y+ TL RSLIGLP+ +R+IVK+LG  KRGS  Y+K++P+  G++L+VKEL+ ++LT+K
Sbjct: 2  VYYRATLVRSLIGLPKTTRTIVKTLGFTKRGSTIYRKVTPAITGSLLKVKELISLKLTEK 61

Query: 61 ALTKAEVHDSRRSNPGFIIEKRV 83
          ++TKAE  + R+SNPG+I+EKR+
Sbjct: 62 SVTKAEQREIRKSNPGYIVEKRI 84

>Smik_13.502 Chr13 (824481..824732) [252 bp, 84 aa] {ON} YMR286W
          (REAL)
          Length = 84

 Score =  102 bits (253), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 65/81 (80%)

Query: 2  FYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDKA 61
          FYKI L+RSLIG+P  ++SIVKSLGLGKRGSI Y++++P+ AG++ +VKELV V++T   
Sbjct: 3  FYKIALKRSLIGVPHTTKSIVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVKVTKHE 62

Query: 62 LTKAEVHDSRRSNPGFIIEKR 82
          LT ++    R SNPGF++EKR
Sbjct: 63 LTPSQQRVLRMSNPGFVVEKR 83

>Kwal_27.10209 s27 (241628..241882) [255 bp, 84 aa] {ON} YMR286W
          (MRPL33) - Mitochondrial ribosomal protein MRPL33
          (YmL33) (E. coli L30) [contig 39] FULL
          Length = 84

 Score =  101 bits (251), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 67/83 (80%)

Query: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60
          +FYKITL RS IGLP+  + +V SLGLGK GS+ Y+++SPS AG+I ++KE+V V++ ++
Sbjct: 2  VFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAEQ 61

Query: 61 ALTKAEVHDSRRSNPGFIIEKRV 83
          AL+K +  + R+SNPGFI+EKR+
Sbjct: 62 ALSKEQQRELRKSNPGFIVEKRL 84

>KNAG0G03480 Chr7 (745051..745305) [255 bp, 84 aa] {ON} Anc_8.851
          YMR286W
          Length = 84

 Score =  100 bits (250), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 42/80 (52%), Positives = 67/80 (83%)

Query: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60
          +FYK+TL RSLIG+P+ +R IVK+LGLGKRGS  Y++ +P+ AG++L+VKEL+ VE++ +
Sbjct: 2  VFYKVTLARSLIGMPRATRQIVKTLGLGKRGSTVYKRATPAIAGSLLKVKELITVEVSPQ 61

Query: 61 ALTKAEVHDSRRSNPGFIIE 80
           ++K E+  +R+SNPG+++E
Sbjct: 62 KVSKGEMRLARKSNPGYVVE 81

>CAGL0I02706g Chr9 (241613..241882) [270 bp, 89 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286w MRPL33
          Length = 89

 Score =  100 bits (249), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 66/81 (81%)

Query: 2  FYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDKA 61
          +YK+TL RSLIG P+ +R+IVK++GLGKRGS+ Y+K+SPS AG++ ++KEL+ V++T   
Sbjct: 3  YYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTKSR 62

Query: 62 LTKAEVHDSRRSNPGFIIEKR 82
          LTK +  + R++NPGF +EK+
Sbjct: 63 LTKQQQRELRKTNPGFTVEKQ 83

>TPHA0I00330 Chr9 (63570..63836) [267 bp, 88 aa] {ON} Anc_8.851
          YMR286W
          Length = 88

 Score = 95.1 bits (235), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 63/82 (76%)

Query: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60
          +FYKITL RSLIG P   +++VK++GLGKRGS+ Y++ +P+ AG +  VKE+V VE+T+ 
Sbjct: 2  VFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTEN 61

Query: 61 ALTKAEVHDSRRSNPGFIIEKR 82
           L+K +  + R+SNPGF ++KR
Sbjct: 62 QLSKEQQRELRKSNPGFTVQKR 83

>KLTH0C03630g Chr3 (315520..315774) [255 bp, 84 aa] {ON} similar
          to uniprot|P20084 Saccharomyces cerevisiae YMR286W
          MRPL33 Mitochondrial ribosomal protein of the large
          subunit
          Length = 84

 Score = 92.0 bits (227), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 68/83 (81%)

Query: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60
          +FYKITL RS IGLP+ ++S+V SLGLGK GS+ Y++++PS AG+I +VKE+V VE+T+ 
Sbjct: 2  VFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAKVKEVVRVEVTEH 61

Query: 61 ALTKAEVHDSRRSNPGFIIEKRV 83
          ALTK +  + R+SNPGF +EKRV
Sbjct: 62 ALTKEQQRELRKSNPGFTVEKRV 84

>Suva_10.29 Chr10 complement(57917..67342) [9426 bp, 3141 aa] {ON}
            YLL040C (REAL)
          Length = 3141

 Score = 29.6 bits (65), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 18   SRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDKALTKAEVHDSRRSNPGF 77
            S ++   + + + GSI  Q+I P+    + R++ +VD +L  K L      DS  S P F
Sbjct: 2322 SNTLSIPIEICETGSIDIQQIEPNVTKPLYRMRNIVDKQLVVKFLGG----DSDWSQPFF 2377

Query: 78   I 78
            I
Sbjct: 2378 I 2378

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score = 28.9 bits (63), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 39/65 (60%), Gaps = 2/65 (3%)

Query: 17  KSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDKALTKAE--VHDSRRSN 74
           +++ +++SL    R  +A + +  S + A+LR ++ +DVE +D+A+ KAE  + D+    
Sbjct: 280 EAKFLIRSLESKLRIGLAEKTVLISLSNALLRHEQGLDVEPSDEAVDKAEQSIRDAFCQV 339

Query: 75  PGFII 79
           P + I
Sbjct: 340 PNYEI 344

>TBLA0I01510 Chr9 (327184..330459) [3276 bp, 1091 aa] {ON} Anc_2.541
           YKL033W
          Length = 1091

 Score = 28.1 bits (61), Expect = 2.7,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 34/76 (44%), Gaps = 5/76 (6%)

Query: 1   MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISP-----STAGAILRVKELVDV 55
           +F  IT +     LP+ +  I  + G+   GS   Q I        T  ++  + E+ D 
Sbjct: 766 LFEIITFKMKDQFLPKFNNEISITSGINSFGSWGLQNIDQVINNLDTEASVDPISEMSDS 825

Query: 56  ELTDKALTKAEVHDSR 71
           ELT+KA    E  DS+
Sbjct: 826 ELTNKAKNFQEYFDSK 841

>KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa]
           {ON} similar to uniprot|P39985 Saccharomyces cerevisiae
           YEL055C
          Length = 1006

 Score = 27.7 bits (60), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 15  PQKSRSIVKSLGLGKRGSIAYQKISPS-TAGAILRVKELVDVELT 58
           P+K+    ++L L + GSI++ +++ S T   +L  K L D +LT
Sbjct: 399 PEKTAPSFETLALKEHGSISFDQLTKSKTLNLLLSGKSLTDQQLT 443

>KLTH0D14938g Chr4 (1220665..1223709) [3045 bp, 1014 aa] {ON}
           similar to uniprot|Q07468 Saccharomyces cerevisiae
           YDL077C VAM6 Protein involved in vacuolar morphogenesis
          Length = 1014

 Score = 26.9 bits (58), Expect = 6.4,   Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 15/30 (50%)

Query: 35  YQKISPSTAGAILRVKELVDVELTDKALTK 64
           Y K +PS  G   RVK   D E  +K L K
Sbjct: 591 YLKFNPSMVGPFTRVKNSCDFETVEKQLLK 620

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,357,371
Number of extensions: 223459
Number of successful extensions: 581
Number of sequences better than 10.0: 25
Number of HSP's gapped: 581
Number of HSP's successfully gapped: 25
Length of query: 85
Length of database: 53,481,399
Length adjustment: 57
Effective length of query: 28
Effective length of database: 46,945,437
Effective search space: 1314472236
Effective search space used: 1314472236
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)