Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B029008.850ON52050424270.0
CAGL0I02684g8.850ON49345517700.0
ZYRO0C14872g8.850ON49645917560.0
Suva_13.4758.850ON51546117200.0
NCAS0C003108.850ON55643317070.0
SAKL0D01166g8.850ON50545716950.0
YMR285C (NGL2)8.850ON51546116930.0
Skud_13.4588.850ON51446116840.0
Smik_13.5018.850ON51546116830.0
Kpol_237.18.850ON50345816780.0
TDEL0B001908.850ON49245816760.0
NDAI0K003708.850ON56842616690.0
KAFR0L019608.850ON51146216570.0
TPHA0I003208.850ON52943316410.0
KLTH0C03608g8.850ON49545616230.0
Kwal_27.102048.850ON49445615880.0
KLLA0C06248g8.850ON51646315740.0
KNAG0K006508.850ON48244115020.0
ABL118W8.850ON50442414340.0
Ecym_46198.850ON48742114150.0
NDAI0E002608.850ON49850712211e-163
TBLA0D033008.850ON48044112081e-162
NCAS0B002708.850ON47646611841e-158
Smik_13.168.850ON5024489911e-129
KAFR0A028608.850ON4784339761e-127
Suva_13.258.850ON5024569691e-125
CAGL0B02387g8.850ON4714439621e-125
Skud_13.238.850ON4984729601e-124
YML118W (NGL3)8.850ON5054499561e-123
KNAG0G034708.850ON4664479071e-117
KLLA0F15884g7.78ON7902261813e-13
KNAG0D048407.78ON7792401724e-12
ACR288W7.78ON7362401714e-12
Kwal_26.71127.78ON7422501707e-12
Ecym_73547.78ON7852371707e-12
SAKL0B10032g7.78ON7312401698e-12
KLTH0D02310g7.78ON7392411681e-11
ZYRO0D05302g7.78ON8572391652e-11
Suva_1.457.78ON8312241635e-11
CAGL0H06149g7.78ON8732451626e-11
Skud_1.407.78ON8692241626e-11
Kpol_1040.147.78ON7842341601e-10
KAFR0K006707.78ON7952241572e-10
ACR277C7.90ON3782601524e-10
NDAI0H025207.78ON8982241511e-09
TBLA0E022607.90ON3882631481e-09
YAL021C (CCR4)7.78ON8372241502e-09
Smik_1.457.78ON8392241483e-09
TDEL0H037307.78ON7972311448e-09
TPHA0H026807.78ON8722411441e-08
TBLA0A046607.78ON8962251422e-08
KNAG0L005507.90ON3812401349e-08
SAKL0B09768g7.90ON3682451321e-07
KAFR0D012507.90ON3562471321e-07
Kwal_26.71707.90ON3722431312e-07
KLLA0F07733g7.90ON3712471312e-07
NCAS0F016407.78ON8552361332e-07
CAGL0F01001g7.90ON3592381302e-07
Kpol_1044.67.90ON3722511285e-07
KLTH0D02574g7.90ON3682441276e-07
Ecym_26367.90ON3672371268e-07
ZYRO0D05588g7.90ON3562481259e-07
TDEL0H036007.90ON3662471204e-06
TPHA0L005307.90ON3912411204e-06
Smik_15.1257.90ON3632431171e-05
NCAS0I005007.90ON3892471152e-05
Skud_15.1157.90ON3632531106e-05
NDAI0A085307.90ON3652491107e-05
Suva_15.1277.90ON3632401099e-05
YOL042W (NGL1)7.90ON3632431099e-05
NDAI0K002208.865ON129345699.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B02900
         (520 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   939   0.0  
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   686   0.0  
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   681   0.0  
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   667   0.0  
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      662   0.0  
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   657   0.0  
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   656   0.0  
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   653   0.0  
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   652   0.0  
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   650   0.0  
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   650   0.0  
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   647   0.0  
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   642   0.0  
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   636   0.0  
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   629   0.0  
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   616   0.0  
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   610   0.0  
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   583   0.0  
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   556   0.0  
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   549   0.0  
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   474   e-163
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   469   e-162
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      460   e-158
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   386   e-129
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   380   e-127
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   377   e-125
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   375   e-125
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   374   e-124
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   372   e-123
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   353   e-117
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    74   3e-13
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    71   4e-12
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    70   4e-12
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    70   7e-12
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    70   7e-12
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    70   8e-12
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    69   1e-11
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    68   2e-11
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    67   5e-11
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    67   6e-11
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    67   6e-11
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    66   1e-10
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    65   2e-10
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    63   4e-10
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      63   1e-09
TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {O...    62   1e-09
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    62   2e-09
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    62   3e-09
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    60   8e-09
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    60   1e-08
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    59   2e-08
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    56   9e-08
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    55   1e-07
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    55   1e-07
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    55   2e-07
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    55   2e-07
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      56   2e-07
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    55   2e-07
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    54   5e-07
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    54   6e-07
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    53   8e-07
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    53   9e-07
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    51   4e-06
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    51   4e-06
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    50   1e-05
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    49   2e-05
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    47   6e-05
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    47   7e-05
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    47   9e-05
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    47   9e-05
NDAI0K00220 Chr11 complement(34357..38238) [3882 bp, 1293 aa] {O...    31   9.1  

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  939 bits (2427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/504 (90%), Positives = 456/504 (90%)

Query: 17  NSLSVKDSTLVQSQLNDSSNDLVTXXXXXXXXXXXXXXXXXXXXIDISPEHIAQVXXXXX 76
           NSLSVKDSTLVQSQLNDSSNDLVT                    IDISPEHIAQV     
Sbjct: 17  NSLSVKDSTLVQSQLNDSSNDLVTNTKNNKQNKKSKKKNERQKKIDISPEHIAQVRAKRE 76

Query: 77  XXXXXXXXXXXXQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSLMTYNCLAQALIRRK 136
                       QGIDPDCPKELQFIKRPILQMHENEPVKGFKFSLMTYNCLAQALIRRK
Sbjct: 77  AARKAKRDALLAQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSLMTYNCLAQALIRRK 136

Query: 137 LFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKK 196
           LFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKK
Sbjct: 137 LFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKK 196

Query: 197 PSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFP 256
           PSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFP
Sbjct: 197 PSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFP 256

Query: 257 KNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPF 316
           KNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPF
Sbjct: 257 KNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPF 316

Query: 317 FCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRXXXXXXXXXXXNIEKF 376
           FCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR           NIEKF
Sbjct: 317 FCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRDGEEGDDEEGGNIEKF 376

Query: 377 GKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERN 436
           GKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERN
Sbjct: 377 GKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERN 436

Query: 437 EPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELPS 496
           EPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELPS
Sbjct: 437 EPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELPS 496

Query: 497 HGQPFEGEYPSDHLCMLCEVELCL 520
           HGQPFEGEYPSDHLCMLCEVELCL
Sbjct: 497 HGQPFEGEYPSDHLCMLCEVELCL 520

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/455 (69%), Positives = 371/455 (81%), Gaps = 2/455 (0%)

Query: 66  EHIAQVXXXXXXXXXXXXXXXXXQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSLMTY 125
           E IA++                 +G+DPDCP ELQFI+R +L++HE EPV+G K  +M+Y
Sbjct: 38  EEIARIRAEREAMREAKRQEMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSY 97

Query: 126 NCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFS 185
           NCLAQALIRRKLFP+ G+ALKW+RRS+VLLNEFKHY+PD++CLQEID++QYQSFWKEEF 
Sbjct: 98  NCLAQALIRRKLFPDSGEALKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQ 157

Query: 186 KLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSL 245
           KLGY  QF++KPSKNHGV ++WK E FEM+DRML+D+D E SGDIEPRTTTNN AL+L+L
Sbjct: 158 KLGYSSQFHRKPSKNHGVCIIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILAL 217

Query: 246 KFSKKVTERFPKNI-NKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQN 304
           KF++KV     K + +K+GIL+GTTHLFWHPFGTYERTRQCY++LNKMKEF+ RVN+LQN
Sbjct: 218 KFTQKVKMMGKKLLDDKSGILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQN 277

Query: 305 NGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRXXXX 364
           N D D SHWYPFFCGDFNSQPFDSPYLSMT KPIKY  R+KTVIECSTSFKFSKKR    
Sbjct: 278 NNDGDMSHWYPFFCGDFNSQPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRESGE 337

Query: 365 -XXXXXXXNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSK 423
                   NIEKFGKDQPQ PVP+ + ANDEQ  LV++M+ELHNSLDMRA+SLYS  Y K
Sbjct: 338 DAEDEEGGNIEKFGKDQPQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHK 397

Query: 424 VHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIR 483
           VHPENSG+DNER EPEISNWAH WRGLLDY+F I++W+F    EID+LEDFE  N+IKIR
Sbjct: 398 VHPENSGLDNERGEPEISNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIR 457

Query: 484 GYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVEL 518
           G LRMPP  E+ +HGQP  GEYPSDHLC+L EVEL
Sbjct: 458 GLLRMPPGSEMSTHGQPHVGEYPSDHLCLLSEVEL 492

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  681 bits (1756), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/459 (69%), Positives = 368/459 (80%), Gaps = 4/459 (0%)

Query: 63  ISPEHIAQVXXXXXXXXXXXXXXXXXQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSL 122
           +SPEHIA+V                 QGIDPD P ELQFIKRPIL +H+ E V+GFKF L
Sbjct: 39  VSPEHIAKVRAEREAARAAKKEAMMAQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKL 98

Query: 123 MTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKE 182
           MTYNCLAQALIRRKLFP  GDALKW+RRSKVLLNEFK+YN D+ICLQEID++QYQSFWK+
Sbjct: 99  MTYNCLAQALIRRKLFPTSGDALKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKD 158

Query: 183 EFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALL 242
           E +KLGY+ QF+++ SKNHGV++VWK+E F MTD+ML+D+D+E SGDI PRTTTNN  L+
Sbjct: 159 ELAKLGYDSQFHRQASKNHGVAIVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLI 218

Query: 243 LSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNIL 302
           LSLKFS KV +    N+ KTGI++GTTHLFWHPFGT+ERTRQCY++LNK+KEF  RVN+L
Sbjct: 219 LSLKFSDKVAQE--HNLKKTGIIVGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVL 276

Query: 303 QNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR-- 360
           QN  D D SHWYPFFCGDFNSQPFDSPYLSMT KPI+YS R+KTVIECSTS+ FSK R  
Sbjct: 277 QNGNDGDHSHWYPFFCGDFNSQPFDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRDG 336

Query: 361 XXXXXXXXXXXNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAG 420
                      NIEKFG DQP HPVP  Y+A D ++ LV +MQ LHNSLDMRA+SLYS  
Sbjct: 337 EEDDAEEEEGGNIEKFGTDQPDHPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVA 396

Query: 421 YSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDI 480
           Y KVHPEN+G+DNER EPEISNWAH WRGLLDYLF+I+ WDF+  KEIDSLE FEREN +
Sbjct: 397 YRKVHPENAGLDNERGEPEISNWAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSL 456

Query: 481 KIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVELC 519
           KIRG LR+PP KE+  HGQP  GEYPSDHLCMLCE+EL 
Sbjct: 457 KIRGLLRVPPGKEMTEHGQPHTGEYPSDHLCMLCELELV 495

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/461 (65%), Positives = 368/461 (79%), Gaps = 3/461 (0%)

Query: 63  ISPEHIAQVXXXXXXXXXXXXXXXXXQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSL 122
           ++PEHIA+V                 QGIDPDCP EL FIKRP L +HE EPV GF+F L
Sbjct: 55  VTPEHIAKVRAERDAIRKAKRDSMLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKL 114

Query: 123 MTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKE 182
           MTYNCLAQALIRRKLFP+ GDALKW+RRS+VLLNEF+HYN D+ICLQEIDH+Q+QSFWKE
Sbjct: 115 MTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKE 174

Query: 183 EFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALL 242
           EFSKLGYE Q+++  +KNHGV+++W++++F+  D+ML+D+DKE+SG+I  RTTTNN+ L+
Sbjct: 175 EFSKLGYEGQYHRNSTKNHGVAIIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLV 234

Query: 243 LSLKFSKKVTERFPK-NINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNI 301
           L+LKFS+KV     K +  K+GILIGT+HLFWHPFGTYERTRQCYI+L KM+EF+ RVN+
Sbjct: 235 LALKFSEKVLSNLGKASSKKSGILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNV 294

Query: 302 LQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR- 360
           LQN  D D SHW+PFFCGDFNSQPFD+PYLSMT KP+ Y  R+KTVIECSTSFKFSK R 
Sbjct: 295 LQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRD 354

Query: 361 XXXXXXXXXXXNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAG 420
                      NIEKFGKDQP+ PVP D+ AN+EQ  LV +M +LHNSLDMRA+SLYS  
Sbjct: 355 GEEGADEEEGGNIEKFGKDQPESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVA 414

Query: 421 YSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPN-KEIDSLEDFEREND 479
           Y  VHPEN+G+DN+R EPEISNWA+ WRGLLDYLFYIK WD   N +E+DSL+DFE++N+
Sbjct: 415 YKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNE 474

Query: 480 IKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVELCL 520
           IK RG+LRMPP  E+  HGQP  GEY SDHL M+C++EL L
Sbjct: 475 IKFRGFLRMPPGSEMTKHGQPHVGEYASDHLSMVCDIELQL 515

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/433 (69%), Positives = 356/433 (82%), Gaps = 3/433 (0%)

Query: 89  QGIDPDCPKELQFIKRPILQMHENEPVKGFKFSLMTYNCLAQALIRRKLFPEGGDALKWH 148
           QG+DP+   +LQFI+RPIL +HE EPV GFK S+MTYNCLAQALIRRKLFP+ GDALKW 
Sbjct: 123 QGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGDALKWF 182

Query: 149 RRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVSVVWK 208
           +RSKVL NEFKHYNPD+ICLQEIDH+QYQSFWK EF K+GYE QF++K SKNHGV+++W+
Sbjct: 183 KRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVAIIWR 242

Query: 209 KELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGILIGT 268
           KELF +TD+ML+D+DKE SG+I PRTTTNN  L LSLKF++K   +F    ++ GI++GT
Sbjct: 243 KELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIVGT 302

Query: 269 THLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDS 328
           THLFWHPFGTYERTRQCY++LNKMKEF+ R+N+LQNN D D SHWYPFFCGDFNSQPFD+
Sbjct: 303 THLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPFDT 362

Query: 329 PYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR-XXXXXXXXXXXNIEKFGKDQPQHPVPD 387
           PYLSMTSKPI Y GR+KTVIECSTS+KFSKKR            NIEKFGKDQPQ PVPD
Sbjct: 363 PYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRDGEEDADEEEGGNIEKFGKDQPQTPVPD 422

Query: 388 DYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERNEPEISNWAHIW 447
            + AN+EQK LV  M+ LHNSLDMRAISLY  GY KVHPEN+G+DN+  EPEISNWAH W
Sbjct: 423 HFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWAHTW 482

Query: 448 RGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELP--SHGQPFEGEY 505
            GLLDY+ +IK W F   + +D+LE FE+EN IK+RGYLRMPP+ E+    HGQP  GEY
Sbjct: 483 NGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTGEY 542

Query: 506 PSDHLCMLCEVEL 518
           PSDHL M+CE+EL
Sbjct: 543 PSDHLSMICELEL 555

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/457 (65%), Positives = 357/457 (78%), Gaps = 1/457 (0%)

Query: 62  DISPEHIAQVXXXXXXXXXXXXXXXXXQGIDPDCPKELQFIKRPILQMHENEPVKGFKFS 121
           +ISPEHIA+                   G+DP+ P +LQFIKRP+L +HE EPVKGFKF 
Sbjct: 48  EISPEHIAEKRAQREAARAAKREAMLAHGLDPNVPPDLQFIKRPLLCLHEEEPVKGFKFK 107

Query: 122 LMTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWK 181
           +MTYN LAQALIRRKLFP  G+A+KW +RSKVLLNEFKHY+ D+ CLQEIDH+QYQ+FWK
Sbjct: 108 IMTYNALAQALIRRKLFPSSGNAVKWFKRSKVLLNEFKHYDADVHCLQEIDHIQYQAFWK 167

Query: 182 EEFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIAL 241
           EEF KLGY  QF++  +KNHGV++VW+  LF M D MLVDYDKE SGDI PRTTT N  L
Sbjct: 168 EEFQKLGYASQFHRIGTKNHGVAIVWRCSLFTMVDTMLVDYDKEPSGDIPPRTTTKNAGL 227

Query: 242 LLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNI 301
           +L+LKF+ KV  +FP    K+GILIGTTHLFWHPFGT+ERTRQCY++LNKMKE I RVN+
Sbjct: 228 ILALKFTDKVLNQFP-GTKKSGILIGTTHLFWHPFGTFERTRQCYVVLNKMKELIHRVNV 286

Query: 302 LQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRX 361
           LQNN D+D+SHWYPF CGDFNSQPFD+PYLSMTSKP+ Y GR+KTVIECSTSF FSK R 
Sbjct: 287 LQNNQDRDYSHWYPFICGDFNSQPFDTPYLSMTSKPVTYRGRAKTVIECSTSFTFSKLRD 346

Query: 362 XXXXXXXXXXNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGY 421
                     NIEKFGK QP+HPVP ++ A +EQ  LV +M+ LHNSLDMRAISLY+ GY
Sbjct: 347 GEEGEDEEGGNIEKFGKGQPEHPVPKEFHATEEQTALVKQMESLHNSLDMRAISLYAVGY 406

Query: 422 SKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIK 481
             VHPEN+G+DN+  EPEISNWA  WRGLLDY+F++K+W+ T    +D ++ FEREN IK
Sbjct: 407 KHVHPENAGLDNDSGEPEISNWAETWRGLLDYIFFVKNWNGTDRSSVDKIDVFERENGIK 466

Query: 482 IRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVEL 518
           IRG LRMPP +E+  HGQP EGEYPSDHL M+CE+EL
Sbjct: 467 IRGLLRMPPGEEMTKHGQPHEGEYPSDHLSMMCEIEL 503

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/461 (65%), Positives = 362/461 (78%), Gaps = 3/461 (0%)

Query: 63  ISPEHIAQVXXXXXXXXXXXXXXXXXQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSL 122
           ++PEHIA+V                 QG+DPDCP EL FI+RP L +HE EPV GF+F L
Sbjct: 55  VTPEHIAKVRAEREVMRKAKRDAMLAQGVDPDCPPELHFIRRPFLSLHEAEPVTGFRFKL 114

Query: 123 MTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKE 182
           MTYNCLAQALIRRKLFP+ GDALKW+RRSKVLLNEFK+YN D+ICLQEIDH+Q+QSFWK+
Sbjct: 115 MTYNCLAQALIRRKLFPDSGDALKWYRRSKVLLNEFKYYNSDVICLQEIDHIQFQSFWKD 174

Query: 183 EFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALL 242
           EFSKLGY+ Q+Y+  +KNHGV+++W++ELF   D+ML+DYDKE S  I  RTTTNN+ L+
Sbjct: 175 EFSKLGYDGQYYRNATKNHGVAIMWRRELFHQVDKMLIDYDKESSESISTRTTTNNVGLV 234

Query: 243 LSLKFSKKVTERF-PKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNI 301
           L+LKFS+KV      K+  K GILIGTTHLFWHPFGTYERTRQCYI+L KMKEF+ RVN+
Sbjct: 235 LALKFSEKVLSNLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYIVLKKMKEFMHRVNV 294

Query: 302 LQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR- 360
           LQN  D D SHW+PFFCGDFNSQPFD+PYLSMTSKP+ Y  R+KTVI CSTS+KFSK R 
Sbjct: 295 LQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYRNRAKTVIGCSTSYKFSKVRD 354

Query: 361 XXXXXXXXXXXNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAG 420
                      NIEK+GKDQP+ PVP+ + AN+EQ  LV KM +LHNSLDMRAISLYS G
Sbjct: 355 GEEGADDEEGGNIEKYGKDQPESPVPEKFHANEEQSELVDKMAQLHNSLDMRAISLYSVG 414

Query: 421 YSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPN-KEIDSLEDFEREND 479
           Y  VHPEN+G+DN+R EPEISNWA+ WRGLLDYLFY+K WD   N +E+++L DFE+EN 
Sbjct: 415 YKNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDPQSNCQEVETLGDFEKENK 474

Query: 480 IKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVELCL 520
           +K RG+LRMPP  E+  HGQP  GEY SDHL M+C++EL L
Sbjct: 475 VKCRGFLRMPPGNEMTKHGQPHVGEYASDHLSMVCDLELQL 515

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/461 (64%), Positives = 367/461 (79%), Gaps = 3/461 (0%)

Query: 63  ISPEHIAQVXXXXXXXXXXXXXXXXXQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSL 122
           ++PEHIA+V                  G+DPDCP EL FI+RP+L + E EPV GF+F L
Sbjct: 54  VTPEHIAKVRAEREAMRKAKRDAMLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKL 113

Query: 123 MTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKE 182
           MTYNCLAQALIRRKLFP+ GDALKW RRSKVLLNEFK+YN D+ICLQE+DH+Q+QSFWK 
Sbjct: 114 MTYNCLAQALIRRKLFPDSGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKG 173

Query: 183 EFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALL 242
           +F+K+GY+ Q+++ P+KNHGV+++W++ +F+  D+ML+DYDKE SG I  RTTTNN+ L+
Sbjct: 174 KFNKMGYDGQYHRNPTKNHGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLV 233

Query: 243 LSLKFSKKVTERFPKNINKT-GILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNI 301
           L+LKFSK+V  +  K  +K  GILIGTTHLFWHPFGTYERTRQCY++L KMKEF+ RVN+
Sbjct: 234 LALKFSKEVLSKLGKKSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNV 293

Query: 302 LQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR- 360
           LQN+ D D SHW+PFFCGDFNSQPFD+PYLSMTSKP+ Y  R+KTVIECSTSFKFSK R 
Sbjct: 294 LQNDNDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRD 353

Query: 361 XXXXXXXXXXXNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAG 420
                      NIEKFGKDQP+ PVP+++ ANDEQ  +V  M +LHNSLDMRAISLYS G
Sbjct: 354 GEEGADDEEGGNIEKFGKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVG 413

Query: 421 YSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNK-EIDSLEDFEREND 479
           Y  VHPEN+G+DN+R EPEISNWA+ WRGLLDYLFYIK WD   N+ E+++L DFE++N+
Sbjct: 414 YKSVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNE 473

Query: 480 IKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVELCL 520
           IK RG+LRMPPA E+  HGQP  GEYPSDHL M+C++EL L
Sbjct: 474 IKCRGFLRMPPASEMTKHGQPHVGEYPSDHLSMVCDLELQL 514

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  652 bits (1683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/461 (65%), Positives = 367/461 (79%), Gaps = 3/461 (0%)

Query: 63  ISPEHIAQVXXXXXXXXXXXXXXXXXQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSL 122
           ++PEHIA++                 QG+DPDCP EL FIKRP L +HE EPV GF+F L
Sbjct: 55  VTPEHIAKIRAERDAMRKAKRDAMLAQGVDPDCPPELHFIKRPFLVLHEKEPVTGFRFKL 114

Query: 123 MTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKE 182
           MTYNCLAQALIRRKLFP+ GDALKW+RRS+VLLNEFK+Y  D+ICLQEIDH+Q+QSFWK+
Sbjct: 115 MTYNCLAQALIRRKLFPDSGDALKWYRRSRVLLNEFKYYKADVICLQEIDHIQFQSFWKD 174

Query: 183 EFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALL 242
           EF+KLGY+ Q+Y+  +KNHGV+++W++E+F+  D+ML+DYDKE S +I  RTTTNN+ L+
Sbjct: 175 EFNKLGYDGQYYRNSTKNHGVAIMWRREMFQQVDKMLIDYDKETSENISTRTTTNNVGLV 234

Query: 243 LSLKFSKKVTERFPKNINKT-GILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNI 301
           L+LKFS+KV     K+ +K  GILIGTTHLFWHPFGTYERTRQCY++L KMKEF+ RVN+
Sbjct: 235 LALKFSEKVLSNLSKSSSKKCGILIGTTHLFWHPFGTYERTRQCYVVLKKMKEFMHRVNV 294

Query: 302 LQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR- 360
           LQN  D D SHW+PFFCGDFNSQPFD+PYLSMTSKP+ Y  R+KTVIECSTSFKFSK R 
Sbjct: 295 LQNENDGDLSHWFPFFCGDFNSQPFDTPYLSMTSKPVHYKNRAKTVIECSTSFKFSKARD 354

Query: 361 XXXXXXXXXXXNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAG 420
                      NIEK+GKDQP+ PVP++Y AN+EQ  LV KM +LHNSLDMRAISLYS G
Sbjct: 355 GDESADDEEGGNIEKYGKDQPESPVPENYHANEEQIELVDKMAQLHNSLDMRAISLYSVG 414

Query: 421 YSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPN-KEIDSLEDFEREND 479
           Y  VHPEN+G+DN+R EPEISNWA+ WRGLLDYLFY+K WD   N +E+++L DFE+ N+
Sbjct: 415 YRNVHPENAGLDNDRGEPEISNWANTWRGLLDYLFYVKKWDLRSNCQEVENLGDFEKVNE 474

Query: 480 IKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVELCL 520
           +K RG+LRMPP KE+  HGQP  GEY SDHL M+C++EL L
Sbjct: 475 MKCRGFLRMPPGKEMTKHGQPHVGEYASDHLSMVCDLELEL 515

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/458 (65%), Positives = 354/458 (77%), Gaps = 1/458 (0%)

Query: 64  SPEHIAQVXXXXXXXXXXXXXXXXXQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSLM 123
           SPE I +                  +G+DPD P ELQFIKRP+L +H++EPV GF F+LM
Sbjct: 46  SPEEIERKRAERAAAKEQKRKELLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLM 105

Query: 124 TYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEE 183
           TYNCLAQALIRRKLFP+ G+A+KW RRSKVLL EF+HYN D+ICLQEIDH+QYQ+FWK E
Sbjct: 106 TYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVE 165

Query: 184 FSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLL 243
           F KLGYE QF++  SKNHGV++VWK+E+F+MTDRML+D+DKE S DI PRT TNN  L+L
Sbjct: 166 FEKLGYESQFHRIASKNHGVAIVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLIL 225

Query: 244 SLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQ 303
           SLKFS K+    PKN   TGI+IGTTHLFWHPFGTYERTRQCY++LNKMKEF+ RVN+LQ
Sbjct: 226 SLKFSDKILSTLPKNTKTTGIIIGTTHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQ 285

Query: 304 NNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRXXX 363
           N  D D SHW PFFCGDFNSQPFDSPYLSMTSKPI+Y+ R+KTVI+CSTS+KFSK R   
Sbjct: 286 NGNDGDLSHWVPFFCGDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNGE 345

Query: 364 X-XXXXXXXNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYS 422
                    NIEKFGKDQPQ PVP+ + AN+EQ  LV +M  +HN L MRA SLYS GY 
Sbjct: 346 EDVDDEEGGNIEKFGKDQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYK 405

Query: 423 KVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKI 482
            VH EN+GIDN R EP ISNWA+ WRGLLDY+F++ +WDF   + +DSLE FE EN I++
Sbjct: 406 HVHAENAGIDNTRGEPIISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRL 465

Query: 483 RGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVELCL 520
           RG+LRMP   E+P HGQP EGEY SDHL M+C +EL L
Sbjct: 466 RGFLRMPLDSEMPKHGQPHEGEYASDHLSMICNIELLL 503

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/458 (64%), Positives = 361/458 (78%), Gaps = 2/458 (0%)

Query: 62  DISPEHIAQVXXXXXXXXXXXXXXXXXQGIDPDCPKELQFIKRPILQMHENEPVKGFKFS 121
           ++SPEH+A+V                 +G+DPD P ELQFIKRP+L +HE+EP++G  F 
Sbjct: 34  EMSPEHVAKVRAEREAARKAKREEMLAKGMDPDHPPELQFIKRPLLTLHEDEPIEGLSFK 93

Query: 122 LMTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWK 181
           L+TYNCLAQALIRRKLFP+ GD+LKW RRSKVL  EFKHYN D++CLQEID++QYQ FWK
Sbjct: 94  LLTYNCLAQALIRRKLFPDSGDSLKWFRRSKVLQYEFKHYNADVLCLQEIDYIQYQQFWK 153

Query: 182 EEFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIAL 241
           +E  KLGY+ QFYK+P KNHGVS+ WK+ LF++TDRML+DYDKE SG IE RT T+N  L
Sbjct: 154 DELDKLGYDTQFYKQPCKNHGVSIAWKRHLFQLTDRMLIDYDKESSGKIEKRTLTHNSGL 213

Query: 242 LLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNI 301
           +L+LKF+    +  P +I K+GIL+GT+HLFWHPFGTYERTRQCY++L KMKEF+ RVN+
Sbjct: 214 ILALKFTDAAKQSCP-HIRKSGILVGTSHLFWHPFGTYERTRQCYVVLKKMKEFMKRVNV 272

Query: 302 LQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR- 360
           LQNN D + SHW PFFCGDFNSQPFD+PYLSMTSKP++Y+GR+KTV+ECSTS+ FSK R 
Sbjct: 273 LQNNNDGNLSHWVPFFCGDFNSQPFDTPYLSMTSKPVEYTGRAKTVVECSTSYTFSKLRN 332

Query: 361 XXXXXXXXXXXNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAG 420
                      NIEKFGKDQPQ PVP+ + A  EQ+ LV +MQELHNS+DMRAISLY+ G
Sbjct: 333 GEEDAEDEEGGNIEKFGKDQPQTPVPETFDATPEQQKLVEEMQELHNSIDMRAISLYAVG 392

Query: 421 YSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDI 480
           Y +VHPENSGIDN+R EPE+SNWA+ WRGLLDY+  I  WD +  K++DSLE FE+EN +
Sbjct: 393 YGEVHPENSGIDNDRGEPEMSNWANTWRGLLDYILLITQWDSSDRKKVDSLETFEKENSL 452

Query: 481 KIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVEL 518
           K+RG LRMPPA E+  HGQP EGEY SDHL M+C +EL
Sbjct: 453 KLRGLLRMPPASEMSHHGQPHEGEYASDHLSMMCTIEL 490

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/426 (68%), Positives = 352/426 (82%), Gaps = 4/426 (0%)

Query: 96  PKELQFIKRPILQMHENEPVKGFKFSLMTYNCLAQALIRRKLFPEGGDALKWHRRSKVLL 155
           P ELQFIKRPIL +HE EPV+GFKFS+MTYNCLAQALIRRKLFP+ GDALKW+RRSKVLL
Sbjct: 143 PPELQFIKRPILYLHEEEPVQGFKFSMMTYNCLAQALIRRKLFPDSGDALKWYRRSKVLL 202

Query: 156 NEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVSVVWKKELFEMT 215
           NEF +Y+PDIICLQE+DH+QYQSFWK EF KLGY+ Q+++K  KNHGVS++W++ LF MT
Sbjct: 203 NEFTYYSPDIICLQEVDHIQYQSFWKTEFEKLGYQSQYHRKGVKNHGVSIIWRRSLFTMT 262

Query: 216 DRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPKNI--NKTGILIGTTHLFW 273
           D+ML+++DKE SG++ PRTTTNN+ L+LSLKF+ +   +F KN+   KTGI+IGTTHLFW
Sbjct: 263 DKMLIEFDKESSGNVPPRTTTNNVGLILSLKFTPEAKAQF-KNVETTKTGIIIGTTHLFW 321

Query: 274 HPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSM 333
           HPFGTYERTRQCY++LNKMKEF+ RVN+LQNN D+D SHWYPFFCGDFNSQPFDSPYLSM
Sbjct: 322 HPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDRDLSHWYPFFCGDFNSQPFDSPYLSM 381

Query: 334 TSKPIKYSGRSKTVIECSTSFKFSKKR-XXXXXXXXXXXNIEKFGKDQPQHPVPDDYQAN 392
             KP++YSGR+KTVIECSTS+KFSKKR            NIEKFG DQPQ PVP+++ AN
Sbjct: 382 VRKPVEYSGRAKTVIECSTSYKFSKKRDGEEDVDDEEGGNIEKFGIDQPQTPVPEEFIAN 441

Query: 393 DEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERNEPEISNWAHIWRGLLD 452
            EQ +LV  M++LHNSL+MRAISLY  GY  VHPEN+ IDNE  EPEISNWAH W GLLD
Sbjct: 442 GEQTILVKDMEKLHNSLNMRAISLYGVGYKNVHPENASIDNECGEPEISNWAHTWNGLLD 501

Query: 453 YLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCM 512
           YL ++K W F+   + ++L+ FE  N ++IRG+LRMPPA E+  HGQP  GEYPSDHL M
Sbjct: 502 YLLFVKEWTFSDCTKTETLKQFEESNSMRIRGFLRMPPANEMTKHGQPHVGEYPSDHLSM 561

Query: 513 LCEVEL 518
           LC +EL
Sbjct: 562 LCSIEL 567

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/462 (64%), Positives = 361/462 (78%), Gaps = 4/462 (0%)

Query: 62  DISPEHIAQVXXXXXXXXXXXXXXXXXQGIDPDCPKELQFIKRPILQMHENEPVKGFKFS 121
           ++ PEHIA+V                 QG+DPD P ELQFI+RP+L + + E   GF+F 
Sbjct: 51  NLDPEHIAKVRAEREAMRKSKQEAMLAQGLDPDLPPELQFIRRPLLALSKAESTAGFEFK 110

Query: 122 LMTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWK 181
           +MTYNCLAQALIRRKLFP+ G+A+KW RRSKVLLNEFK+Y+ D+ICLQE+D +Q+Q+FWK
Sbjct: 111 IMTYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLNEFKYYDSDVICLQEVDRIQFQTFWK 170

Query: 182 EEFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIAL 241
           EEF KLGY+ QF+ KPSKNHG+S++WK+ LF MTD+ML+DYDKE+SG+I PRTTTNN+ L
Sbjct: 171 EEFDKLGYDSQFHAKPSKNHGISILWKRSLFTMTDKMLIDYDKEISGNIPPRTTTNNVGL 230

Query: 242 LLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNI 301
           +L+LKFS KV ERFP N  K+GI++GTTHLFWHPFGTYERTRQCYI+LNK KEF+ RVN+
Sbjct: 231 VLALKFSPKVLERFP-NTRKSGIIVGTTHLFWHPFGTYERTRQCYIVLNKTKEFMHRVNV 289

Query: 302 LQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR- 360
           LQNN D+   HWY FF GDFNSQPFD+PYLSMTSKP+KYS R+KTVIECSTS+ FSK R 
Sbjct: 290 LQNNNDEIKDHWYTFFGGDFNSQPFDTPYLSMTSKPVKYSNRAKTVIECSTSYTFSKSRD 349

Query: 361 XXXXXXXXXXXNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAG 420
                      NIEKFGKDQP  PVP  + A+ EQ+ LV  M++LHNSLDMRAISLYS G
Sbjct: 350 GEEDAEDEEGGNIEKFGKDQPATPVPSFFDASSEQQSLVANMEKLHNSLDMRAISLYSVG 409

Query: 421 YSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDI 480
           Y  VH EN+G+DN R EPEISNWAH W GLLDYLF IKSWDF+   ++DSL+ FE EN++
Sbjct: 410 YGTVHIENAGLDNTRGEPEISNWAHAWNGLLDYLFVIKSWDFSDKIQVDSLKKFEDENEL 469

Query: 481 KIRGYLRMPPAKELP--SHGQPFEGEYPSDHLCMLCEVELCL 520
           K++ +L+MP   E+    HGQP  GEYPSDHL M+C++EL L
Sbjct: 470 KVKAFLKMPTKAEMGKFGHGQPHVGEYPSDHLSMICKLELKL 511

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/433 (66%), Positives = 355/433 (81%), Gaps = 4/433 (0%)

Query: 90  GIDPDCPKELQFIKRPILQMHENEPVKGFKFSLMTYNCLAQALIRRKLFPEGGDALKWHR 149
           G+DPDCP ELQFI+RP+L +H++EP K F F+LMTYNCLAQALIRRKLFP+ G+A+KW+R
Sbjct: 95  GLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAVKWYR 154

Query: 150 RSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVSVVWKK 209
           RS+VLLNEFK+YNPD+ICLQEIDH+Q+QSFW+EEF K+GY  QF++  SKNHGV++VWK 
Sbjct: 155 RSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAIVWKN 214

Query: 210 ELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPK--NINKTGILIG 267
            LF +TDRML+D+DKELSGDI PRT TNN  L+LSLK+S  V  ++P+  N NK+GI+IG
Sbjct: 215 NLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSGIIIG 274

Query: 268 TTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFD 327
           TTHLFWHPFGTYERTRQC+++LNK+KEF  RVN+LQNN D +  HW  FFCGDFNSQPFD
Sbjct: 275 TTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNSQPFD 334

Query: 328 SPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRX--XXXXXXXXXXNIEKFGKDQPQHPV 385
           +PYLS+TSKP++Y  R+K VIECSTS+ +SK R             NIEKFGKDQPQ PV
Sbjct: 335 TPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNGDDDEAEDEEGGNIEKFGKDQPQTPV 394

Query: 386 PDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERNEPEISNWAH 445
           PD Y    EQ  LV+KM+ LHNSL+M+A SLY+ GY KVHPENSG+DN++ EPEISNWAH
Sbjct: 395 PDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEISNWAH 454

Query: 446 IWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELPSHGQPFEGEY 505
            WRGLLDY+FY+  WDF+  KE++  E FE++N +K+RGYLRMPPA E+  +GQP +GEY
Sbjct: 455 SWRGLLDYIFYVDHWDFSDCKEVEDFEKFEKKNHMKLRGYLRMPPATEMSKYGQPHQGEY 514

Query: 506 PSDHLCMLCEVEL 518
           PSDHL M+C++EL
Sbjct: 515 PSDHLSMMCKIEL 527

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/456 (62%), Positives = 352/456 (77%), Gaps = 1/456 (0%)

Query: 63  ISPEHIAQVXXXXXXXXXXXXXXXXXQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSL 122
           +SPEHIA+V                 +G+DPD P +LQFI RP+L ++ +E   GF F L
Sbjct: 39  VSPEHIAEVRAQREAAKKKKREDMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKL 98

Query: 123 MTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKE 182
           MTYNCLAQALIRRKLFP  G+ALKW +RS+VLLNEF HYN D++CLQE+D++QYQSFWKE
Sbjct: 99  MTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKE 158

Query: 183 EFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALL 242
           EF KLGYE QF++  +KNHG+++VWK+++F M D+ML+DYDKE SG +EPRTTT N+ L 
Sbjct: 159 EFEKLGYESQFHRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLA 218

Query: 243 LSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNIL 302
           ++L F+KKV  ++P + +K GI++GTTHLFWHPFGT+ERTRQCY++LNKMKEF+ R+N+L
Sbjct: 219 IALGFTKKVLAKYPGS-SKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVL 277

Query: 303 QNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRXX 362
           Q+ G    + WYPFFCGDFNSQPFD+PYLS++SKP+ Y GR+KTVIECSTS+ FSK R  
Sbjct: 278 QDKGATQENLWYPFFCGDFNSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARDG 337

Query: 363 XXXXXXXXXNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYS 422
                    NIEKFG  QP+HPVP+ + A +EQK LV  M  LHNSLDMR IS+YS GY 
Sbjct: 338 EECDDEEGGNIEKFGDGQPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYK 397

Query: 423 KVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKI 482
            VH EN+G+DN  NEPEISNWA  WRGLLDY+F+IK WDF+     + LE F+ EN IKI
Sbjct: 398 HVHAENAGLDNNFNEPEISNWAETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKI 457

Query: 483 RGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVEL 518
           RG LRMPPAKE+P+HGQP EGEY SDHL M+CE+EL
Sbjct: 458 RGLLRMPPAKEMPNHGQPHEGEYGSDHLSMMCELEL 493

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/456 (62%), Positives = 350/456 (76%), Gaps = 2/456 (0%)

Query: 65  PEHIAQVXXXXXXXXXXXXXXXXXQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSLMT 124
           PEHIA+V                 +G+DP+ P +LQFI RP+L +  N   +GF F +MT
Sbjct: 41  PEHIAEVRAKREAAKKAKREEMLARGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMT 100

Query: 125 YNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEF 184
           YNCLAQALIRRKLFP  G+ALKW +RS+VLLNEF HY  D+ CLQEID++QYQSFWKEEF
Sbjct: 101 YNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEF 160

Query: 185 SKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLS 244
            KLGY+ QF++  +KNHG+++VWK++LF M D+MLVDYDKE SG ++PRTTT N+ L+L+
Sbjct: 161 GKLGYDSQFHRHGTKNHGIAIVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLA 220

Query: 245 LKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQN 304
           L FSKKV +++P   +K GIL+GTTHLFWHPFGT+ERTRQCY++LNKMK+FI RVN+LQ+
Sbjct: 221 LAFSKKVLDKYP-GTSKRGILVGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQD 279

Query: 305 NGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRXXXX 364
            G      WYPFFCGDFN+QPFD+PYLSM+SKP+ Y  R+KTVIECSTS+ FSK R    
Sbjct: 280 -GSSPEKKWYPFFCGDFNAQPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARDGEE 338

Query: 365 XXXXXXXNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKV 424
                  NIEKFG  QP+HPVPD Y+A  EQK LV  M ELHNSLDMRAIS+YS  Y  V
Sbjct: 339 CDDEEGGNIEKFGDGQPEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHV 398

Query: 425 HPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRG 484
           HPEN+G DN  NEPEISNWA  WRGLLDY+F+IK W+FT NK  + L+ FE+END+KI  
Sbjct: 399 HPENAGRDNTHNEPEISNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILS 458

Query: 485 YLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVELCL 520
            LRMPP++E+P+HGQP EGEY SDHL ++CE+EL L
Sbjct: 459 LLRMPPSEEMPNHGQPHEGEYGSDHLSLMCEIELNL 494

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/463 (60%), Positives = 352/463 (76%), Gaps = 5/463 (1%)

Query: 62  DISPEHIAQVXXXXXXXXXXXXXXXXXQGIDPDCPKELQFIKRPILQMHENEPVKGFK-- 119
           +I+PE+IA++                 QGIDP  P +L+FIKRP+L +  +   +  +  
Sbjct: 55  EITPEYIAEMRAKREAAKIAKKEALIAQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREV 114

Query: 120 --FSLMTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQ 177
              S+MTYNCLAQALIRR LFP  G+A+KW +RS+VLLNEFK+YN D++CLQEID VQY+
Sbjct: 115 CPISIMTYNCLAQALIRRTLFPTSGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYK 174

Query: 178 SFWKEEFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTN 237
           SFWK EF+KLGY CQF+  P+KNHGV + WK++LF+MTD+ML+DYDKE +G IEPRTTT 
Sbjct: 175 SFWKMEFTKLGYMCQFHFNPTKNHGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTK 234

Query: 238 NIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFID 297
           N+ +LLSLKF KKV E++P +   +GI+IGTTHLFWHPFGTYERTRQCYI+L K+KEF +
Sbjct: 235 NVGMLLSLKFKKKVLEKYP-DTKVSGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQN 293

Query: 298 RVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFS 357
           R+N+LQN  D D SHW  FFCGDFNSQPFD+PYLS+TSKP++Y+GR+KTVIECSTSF FS
Sbjct: 294 RINVLQNEKDGDNSHWPAFFCGDFNSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFS 353

Query: 358 KKRXXXXXXXXXXXNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLY 417
           K R           NIEKFGK QP+ PVP+ +  N+EQK L   M+ LHN +DMRAISLY
Sbjct: 354 KLRDGDEGEGEEGGNIEKFGKGQPETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLY 413

Query: 418 SAGYSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERE 477
           S  YSKVHPENSG+DN+RNEPEISNWAH WRGLLDYL+Y+ SWD     +ID L  FE+ 
Sbjct: 414 SIAYSKVHPENSGLDNKRNEPEISNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQN 473

Query: 478 NDIKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVELCL 520
             +++   LR+PPAKE+  HGQP EGEYPSDHLCM+ ++ + +
Sbjct: 474 YGVQVLELLRIPPAKEMTEHGQPHEGEYPSDHLCMIVKLGIIM 516

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/441 (60%), Positives = 337/441 (76%), Gaps = 10/441 (2%)

Query: 89  QGIDPDCPKELQFIKRPILQMHENEPVKG----FKFSLMTYNCLAQALIRRKLFPEGGDA 144
           QG   D P EL+FI+RP+L +H +  +         +LMTYNCLAQALIRRKLFP+ G A
Sbjct: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102

Query: 145 LKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVS 204
           LKW+RRS+VLLN+FKHY PD++CLQE+D VQ+ SFW+ EF KLGY  QF+KK +KNHGV+
Sbjct: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162

Query: 205 VVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGI 264
           VVW+ +LF M D+ML+D+DKE SGD+ PRTTTNN  L+++LKF+++      ++  ++GI
Sbjct: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGH-RDTPRSGI 221

Query: 265 LIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQ 324
           L+GTTHLFWHPFGT+ERTRQCY++LNKMKEF+ RVN+LQN  D +  HW+PFFCGDFNSQ
Sbjct: 222 LVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQ 281

Query: 325 PFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR---XXXXXXXXXXXNIEKFGKDQP 381
           P+D+PYLSMTSKP+ YSGR++TVIECSTS+ FSK+R              NIE FGKDQP
Sbjct: 282 PYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRDGEDAAADEEEEGGNIEIFGKDQP 341

Query: 382 QHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERNEPEIS 441
            HPVP  ++ N EQ  LV +M+ LHNSLDMRA+SLYS GY  VHPEN+G DN R EPEIS
Sbjct: 342 HHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEIS 401

Query: 442 NWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELP--SHGQ 499
           NWAH W GLLDYLFY+  WDF     +D+LE+FE+++ + ++  LRMP  +E+    HGQ
Sbjct: 402 NWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQ 461

Query: 500 PFEGEYPSDHLCMLCEVELCL 520
           P  GEYPSDHL M+C++EL L
Sbjct: 462 PHTGEYPSDHLAMVCDLELAL 482

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/424 (57%), Positives = 320/424 (75%), Gaps = 2/424 (0%)

Query: 97  KELQFIKRPILQMHENEPVKGFKFSLMTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLN 156
           +++ FIKRP+L  + +E  KGF F +MTYNCLAQALIRRKLFP  G+ALKW +RSKVLL+
Sbjct: 83  EDVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLS 141

Query: 157 EFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTD 216
           E ++YNPD+ICLQEIDH QY+SFW +     GY  +F++   KNHG+++VW++ LF   D
Sbjct: 142 ELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVD 201

Query: 217 RMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPF 276
             L+D+D+E SG+IE RTTT N+ L+++L+++ ++  R+P +  ++GI++GT+HLFWHPF
Sbjct: 202 ETLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSA-QSGIVVGTSHLFWHPF 260

Query: 277 GTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSK 336
           GTYER RQCYIIL++MK F+ R+ +L+       S W+PFFCGDFNSQPFD+PYLSM SK
Sbjct: 261 GTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSK 320

Query: 337 PIKYSGRSKTVIECSTSFKFSKKRXXXXXXXXXXXNIEKFGKDQPQHPVPDDYQANDEQK 396
           PI Y GR++TVIECSTS+KFS  R           NIEKFG  QP+ PVPD +    EQ+
Sbjct: 321 PIIYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQR 380

Query: 397 LLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFY 456
            LV  MQ LHN+LDMRAISLYS  Y  VHPEN+GIDN R EPEISNWAH WRGLLDY+ Y
Sbjct: 381 ALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMY 440

Query: 457 IKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEV 516
           +  WDF+ N E+D + +F++   + +R  LR+PPA E+PSHGQP EGEYPSDHL ++CE+
Sbjct: 441 VMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCEL 500

Query: 517 ELCL 520
           EL +
Sbjct: 501 ELLM 504

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/421 (59%), Positives = 318/421 (75%), Gaps = 5/421 (1%)

Query: 99  LQFIKRPILQMHENEPV-KGFKFSLMTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNE 157
           L+FI RP+L +   + V KGF FSLMTYNCLAQ+LIRR LFP  G ALKW +RS VLL E
Sbjct: 69  LEFIARPMLPLKVTQTVHKGFSFSLMTYNCLAQSLIRRSLFPTSGRALKWTKRSMVLLKE 128

Query: 158 FKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDR 217
           FKHYN D++CLQEID+ QY SFW    S LGY  +F++  +K+HGV++ WKK+LF   D+
Sbjct: 129 FKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHRMDNKSHGVAIFWKKDLFIWMDQ 188

Query: 218 MLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFG 277
           ML+++D E SG+IEPR TTNN+ ++L+L FS KV + FP  + K+GI++GT+HLFWHPFG
Sbjct: 189 MLINFDNEDSGEIEPRKTTNNVGMILALGFSDKVKQSFPGTV-KSGIIVGTSHLFWHPFG 247

Query: 278 TYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKP 337
           TYERTRQCY+ILNKMKEFI RV++ QN    D + WYPFFCGDFNSQPFD+PYLS+TSKP
Sbjct: 248 TYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPFFCGDFNSQPFDAPYLSITSKP 307

Query: 338 IKYSGRSKTVIECSTSFKFSKKRXXXXXXXXXXXNIEKFGKDQPQHPVPDDYQANDEQKL 397
           + YSGR+KTVIECS ++KF                +   G+D+P  PVP+ +Q   E   
Sbjct: 308 VLYSGRAKTVIECSAAYKFPDLGAGARGANEDGGTV---GEDRPVDPVPESFQPTAEVSS 364

Query: 398 LVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYI 457
           LV KM++LHNSLDMRAISLY+  Y  VHP+N+G+DNER EPEISNWA+ WRGLLDY+ YI
Sbjct: 365 LVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGLDNERGEPEISNWAYTWRGLLDYIMYI 424

Query: 458 KSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVE 517
             W  + N E+DSLE FE+ + I ++  LRMPPAKE+ SHGQP +GEYPSDHL M+C++E
Sbjct: 425 TPWQASNNVEVDSLESFEKLSHITVQEMLRMPPAKEMSSHGQPHDGEYPSDHLAMMCKLE 484

Query: 518 L 518
           +
Sbjct: 485 V 485

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  474 bits (1221), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 228/507 (44%), Positives = 322/507 (63%), Gaps = 31/507 (6%)

Query: 31  LNDSSNDLVTXXXXXXXXXXXXXXXXXXXXIDISPEHIAQVXXXXXXXXXXXXXXXXXQG 90
           ++DS+ND                       + ++ E+I ++                  G
Sbjct: 2   ISDSANDNAEPHQTQQNNQKKRNQKMNKKRMMLNTEYITKIRAEREKKRELEREYRMKHG 61

Query: 91  IDPDCPKELQFIKRPILQMHENEPVKGFKFSLMTYNCLAQALIRRKLFPEGGDALKWHRR 150
            +PD P ELQFIKRP+L +H+++PVKG    +MTYNCLAQ+LI+R LFP  G ALKW RR
Sbjct: 62  FEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVRR 121

Query: 151 SKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVSVVWKKE 210
           SKVLLNE K+Y+ D++ LQEID VQ++ +WK   +KLGY+C+FYKK  K HGV + WK+ 
Sbjct: 122 SKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKRN 181

Query: 211 LFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGILIGTTH 270
           LF     + +D+D+ LSG I+PRT T N+ L+++L+F  K        I K G++IGTTH
Sbjct: 182 LFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKS----AIKKKGVIIGTTH 237

Query: 271 LFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPY 330
           LFWH FGT+ERTRQCY+++++M +F+ ++  ++         WYPFF GDFNSQP D+PY
Sbjct: 238 LFWHLFGTFERTRQCYVMMDQMDKFMKKLGGIEK--------WYPFFTGDFNSQPKDAPY 289

Query: 331 LSMTSKPIKYSGRSKTVIECSTSFKFSKKR------------------XXXXXXXXXXXN 372
           +S+TSKP+ +   +K VIECS ++K+SKKR                              
Sbjct: 290 VSITSKPVSFQNETKIVIECSAAYKYSKKRNGEEEEKNEGKEKQHEIDSSDSSDAETDEE 349

Query: 373 IEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGID 432
            E+   +QP +  P  +    EQ  LV+++  LHNSL++RAISLYS GY KV PEN+ I+
Sbjct: 350 KEEIIPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYIN 409

Query: 433 NERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKE-IDSLEDFERENDIKIRGYLRMPPA 491
           N+R EPE+S WA +W GLLDY+F+++ WD   N E +DSL+ FEREN++K+RG L+MP +
Sbjct: 410 NDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQS 469

Query: 492 KELPSHGQPFEGEYPSDHLCMLCEVEL 518
           KE+  H  P++GEYPSDHLCM+ ++EL
Sbjct: 470 KEMCEHAIPYKGEYPSDHLCMMIQLEL 496

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  469 bits (1208), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 236/441 (53%), Positives = 306/441 (69%), Gaps = 17/441 (3%)

Query: 89  QGIDPDCPKELQFIKRPILQM--HENEPVKGFKFSLMTYNCLAQALIRRKLFPEGGDALK 146
           QG DPD P EL FIKRPIL +  H +   KGFKFSLMTYNCLAQA+IRR++F + G ALK
Sbjct: 40  QGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPALK 99

Query: 147 WHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEF-SKLGYECQFYKKPSKNHGVSV 205
           W RRSKVL+NE  +YNPDI+CLQEID  QY++FWK++  S L     +YK+  K+HGV +
Sbjct: 100 WFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGVLI 159

Query: 206 VWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKK-VTERFPKNI----- 259
            WKK +F+  D M+VD+D   + +I  RT T NIA+ ++LKF+ + +T+ FP  +     
Sbjct: 160 AWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSFDQ 219

Query: 260 NKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCG 319
           N  G +I TTHLFWHPFGT+ERTRQCYI+L KMK+FID +N+     D   +HWYPF CG
Sbjct: 220 NDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV----KDHLKTHWYPFICG 275

Query: 320 DFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRXXXXXXXXXXXNIEKFGKD 379
           DFNS P D+PYLSMTSKPI+Y+GR K VIECST++KFSK+R             EK   +
Sbjct: 276 DFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEEE--EKKLIN 333

Query: 380 QPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERNEPE 439
           QP+  VPD +    EQ  LV ++Q LHN L +RA SLY   Y  V P N  I+N+R EPE
Sbjct: 334 QPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVNINNDRGEPE 393

Query: 440 ISNWAHIWRGLLDYLFYIKSWDFT-PNKEI-DSLEDFERENDIKIRGYLRMPPAKELPSH 497
            ++WA  W G+LDY+ Y+ +WD   P  EI +SLE+FE+ N + I+G L+MP  K++P H
Sbjct: 394 FTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKMPLNKDMPFH 453

Query: 498 GQPFEGEYPSDHLCMLCEVEL 518
            QPFE EYPSDH+ +LCE+E+
Sbjct: 454 TQPFEREYPSDHISILCEMEI 474

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  460 bits (1184), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 230/466 (49%), Positives = 312/466 (66%), Gaps = 15/466 (3%)

Query: 62  DISPEHIAQVXXXXXXXXXXXXXXXXXQGIDPDCPKELQFIKRPILQMHENEPVKG---F 118
           D SPE+I+++                 QG+DPD P ELQF +RP L +H+NEP  G    
Sbjct: 17  DNSPEYISEIRKQRANKWQRIRESRMQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKH 76

Query: 119 KFSLMTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQS 178
           +FS++TYNCLAQ LI R +FPE G+ALKW RRSK ++NE K+YNPDI+CLQEID    + 
Sbjct: 77  EFSILTYNCLAQGLIMRDMFPESGNALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKE 136

Query: 179 FWKEEFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNN 238
           FW  +F  LGY  +F+KK  K HGV + W+  +F+  D+  VD+D+ L+GDI PRT T N
Sbjct: 137 FWSVQFKSLGYSFKFFKKEKKIHGVVIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRN 196

Query: 239 IALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDR 298
           I L+++L+F         +  +  GI++ TTHLFWHPFGT+ERTRQCY++L++M +F+  
Sbjct: 197 IGLIVALQFLDNNNNNPSRESH--GIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSF 254

Query: 299 VNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSK 358
           +N  +++G    ++WYPF  GDFNSQP D+PY+SMT+KPI+Y    +TVIECSTS+ +SK
Sbjct: 255 LN--EHSG---ITNWYPFLTGDFNSQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSK 309

Query: 359 KRX----XXXXXXXXXXNIEKFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAI 414
           KR                 E+F K QP  P P  +Q   EQ  LV  +Q+LHNSL  RAI
Sbjct: 310 KRNGDMDVNEKEQSDSEEDEEFIKKQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAI 369

Query: 415 SLYSAGYSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFT-PNKEIDSLED 473
           SLYS GY  VHPENS I+N R EPE S+W   W GLLDY+FYIK+W+    N ++++LE 
Sbjct: 370 SLYSVGYRNVHPENSFINNTRGEPEFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLET 429

Query: 474 FERENDIKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVELC 519
           FE+ N +KI G+L++P  KE+  H QP+EGEYPSDHL ++C+++L 
Sbjct: 430 FEKTNTLKILGFLKLPLRKEMAHHSQPYEGEYPSDHLALMCKLQLT 475

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  386 bits (991), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 194/448 (43%), Positives = 278/448 (62%), Gaps = 36/448 (8%)

Query: 89  QGIDPDCPK-ELQFIKRPILQMHENEPVKGFKFS------------LMTYNCLAQALIRR 135
           QG DPD P  +LQFI+RP+L +   +    FK S            +MTYN LAQ LIRR
Sbjct: 66  QGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRR 125

Query: 136 KLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYK 195
             FP+ G ALKWH+RSKVL++E K Y PDI+ LQE+D+ + + FW+E F KLG++  F +
Sbjct: 126 DFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLSFRR 184

Query: 196 KPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGD-IEPRTTTNNIALLLSLKFSKKVTER 254
              K HG+ V W  E F++ +  ++DYD+ L+G+ I  RT T NIAL++SL+F       
Sbjct: 185 NGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT---- 240

Query: 255 FPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWY 314
             +N +  GI++  THLFWHPFG +ER RQ Y++L K++E  D            +  W+
Sbjct: 241 --RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEIKDF---------PKYHGWH 289

Query: 315 PFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRXXXXXXXXXXXNIE 374
               GDFN++P + PYL++TSKP+  +G ++ ++ECS ++++SKKR             E
Sbjct: 290 SLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQDDEDYDE 349

Query: 375 ----KFGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSG 430
               +   +QP++P P  + A  E+K LV ++  LHNSL ++ ISLY  GY KVHPEN+ 
Sbjct: 350 NSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPENA- 408

Query: 431 IDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPP 490
            +    EPE+SNWA+ W GLLDY+FYI+S D    ++  SL  FE  N + + GYLRMP 
Sbjct: 409 -NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRMPC 467

Query: 491 AKELPSHGQPFEGEYPSDHLCMLCEVEL 518
            +E+P H QPFEGEY SDH+ ++C++ L
Sbjct: 468 KQEMPKHSQPFEGEYASDHISLMCQIRL 495

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  380 bits (976), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 192/433 (44%), Positives = 284/433 (65%), Gaps = 24/433 (5%)

Query: 101 FIKRPILQMHENEPV-KGFKFSLMTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFK 159
           FIKR ILQ+   E +       +MTYN L+Q+LIRR+++P+  DA+KWH RSKV+LNE K
Sbjct: 53  FIKRAILQLPNVEELDNSVDLKIMTYNTLSQSLIRREIYPDAHDAIKWHVRSKVILNEIK 112

Query: 160 HYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYK--KPSKNHGVSVVWKKELFEMTDR 217
           +YN DI+C QE+D +Q+  FW  E SKLGYE +FYK  +  K HGV++ W+  LFE  D 
Sbjct: 113 YYNCDIMCFQEVDVIQWDKFWLPELSKLGYEGEFYKDFRGPKVHGVAIFWRSNLFEQFDV 172

Query: 218 MLVDYDKELSGDIEPRTT-TNNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPF 276
           + +++D  ++G+   +TT T N+ L+++LKF K    +F     ++GI+IGTTHLFWHPF
Sbjct: 173 IKINFDDIVAGNAISKTTRTWNVGLIVALKF-KSSNAKF-----RSGIVIGTTHLFWHPF 226

Query: 277 GTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSK 336
           GT+ERTRQ  I+L K ++ ID +N    + ++  + W P   GDFNSQP D PYLS+TSK
Sbjct: 227 GTFERTRQLAILLKKFRKLIDNLNTECGHINEMSNRWLPILTGDFNSQPCDMPYLSITSK 286

Query: 337 PIKYSGRSKTVIECSTSFKFSKKRXXXXXXXXXXXNIEK-----------FGKDQPQHPV 385
           P+  SG +KTVIECST++KFS++R           + E+             +  P  P 
Sbjct: 287 PVSASGEAKTVIECSTAYKFSRRRSGSINSSEEVDHNEETQSEKEVEEEEDEESNPIDPR 346

Query: 386 PDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERNEPEISNWAH 445
           P  ++A  EQK L+ K++++HNS++++A SL+   Y KVH  + G+ N +NEPE+S+ + 
Sbjct: 347 PSHFEATSEQKDLIAKLEKVHNSINLKATSLFGIAYKKVH--SIGL-NCKNEPELSHTSI 403

Query: 446 IWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELPSHGQPFEGEY 505
            W GLLDY+F ++ W+     +  SLEDFE+   ++++G L+MP  KELP + QP +G+Y
Sbjct: 404 FWTGLLDYIFILEPWNEVEKTDWGSLEDFEKRMSLRVKGLLKMPEMKELPKNVQPHQGQY 463

Query: 506 PSDHLCMLCEVEL 518
           PSDHL M+C++ +
Sbjct: 464 PSDHLSMICDLNV 476

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  377 bits (969), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 195/456 (42%), Positives = 278/456 (60%), Gaps = 61/456 (13%)

Query: 89  QGIDPDCPK-ELQFIKRPILQMHENEPVKG--------FKFSLMTYNCLAQALIRRKLFP 139
           QG DPD P  +LQFIKRP L +H +E  +G            +MTYN LAQ LIRR  FP
Sbjct: 68  QGKDPDFPTPDLQFIKRPFLHLH-HEIAQGSTESTPNSLDVKIMTYNTLAQTLIRRNFFP 126

Query: 140 EGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSK 199
           + G ALKWH+RSKVL++E K Y PDI+ LQE+D+ + + FW+E F KLG++  F +   K
Sbjct: 127 QSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNELK-FWQENFRKLGFDLTFKRHDGK 185

Query: 200 NHGVSVVWKKELFEMTDRMLVDYDKELSGDIEP-RTTTNNIALLLSLKFSKKVTERFPKN 258
            HG+ + W    F++ +  ++DYD  L+G+  P RT T NIAL+ SL+          KN
Sbjct: 186 THGLLIAWNSGKFQLENEWMLDYDNILAGNAIPARTRTKNIALIASLRL---------KN 236

Query: 259 IN---KTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYP 315
           I+     G+++  THLFWHPFG +ER RQ Y++L K++E               ++ W+ 
Sbjct: 237 ISDPSTDGVIVANTHLFWHPFGVFERLRQSYLVLAKIQEI---------KACPKYNGWHS 287

Query: 316 FFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRXXXXXXXXXXXNIEK 375
              GDFN++P + PYL++T KP+  +G ++ + ECS ++++SKKR           N E+
Sbjct: 288 VLMGDFNTEPEEPPYLAITRKPVALTGSARVMAECSLAYRYSKKR-----------NGEE 336

Query: 376 FGKD---------------QPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAG 420
            G+D               QPQ+P P  + A  EQK LV ++  LHNSL +R +SLY  G
Sbjct: 337 GGQDDEECDEQSRGEGRFNQPQNPKPKSFTATSEQKALVDQLVALHNSLHVRGVSLYGLG 396

Query: 421 YSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDI 480
           Y KV PENS   N   EPE+SNWA+ W GLLDY+FYI+  D     + + ++DFE +N++
Sbjct: 397 YGKVQPENSHESN--GEPELSNWANSWCGLLDYIFYIEHSDEHSAHDQNPVDDFENKNNL 454

Query: 481 KIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEV 516
           ++ GYL+MP AKE+P H QPFEGEY SDH+ ++C++
Sbjct: 455 RVMGYLKMPRAKEMPKHSQPFEGEYASDHVSLMCQL 490

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  375 bits (962), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 194/443 (43%), Positives = 270/443 (60%), Gaps = 33/443 (7%)

Query: 89  QGIDPDCPKELQFIKRPILQM-HENEPVKGFKFSLMTYNCLAQALIRRKLFPEGGDALKW 147
           +G+DPD P E QFI+RPIL + H +   +G   S+MTYNCLAQ LIRR++FPE G ALKW
Sbjct: 48  RGLDPDFPAECQFIERPILLVPHGDNYERGLPLSIMTYNCLAQTLIRREMFPESGPALKW 107

Query: 148 HRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVSVVW 207
             RSKVLL+E KHYN DI CLQEID VQY  FW EE  K GY+  ++ + SK+HGV + W
Sbjct: 108 FVRSKVLLHEIKHYNADICCLQEIDDVQYDLFWSEELPKFGYKTIYFHQDSKSHGVMIAW 167

Query: 208 KKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPK-NINKTGILI 266
           K+ELF++   M +++DKE    I+PRT TNN+ LL++L F+     R  +   +++G++I
Sbjct: 168 KEELFQLESHMNIEFDKEAPAGIQPRTRTNNVGLLVALAFTDAFRARNNRIRTSRSGVII 227

Query: 267 GTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPF 326
           GT HLFWHPFGTY+RTRQC +I  K+ EF   V      GD     +   F GDFNSQP 
Sbjct: 228 GTFHLFWHPFGTYDRTRQCLVIKKKILEFAGTV-----KGD-----YCKMFTGDFNSQPN 277

Query: 327 DSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRXXXXXXXXXXXNIEKF---------- 376
             PYL +T    + + + +T IE ST++++S++R             E+           
Sbjct: 278 SVPYLVLTQPRAQLNTQQRTSIEASTAYRYSERRNLGKEYSMEEEEEEEEEEEKREYEYD 337

Query: 377 -GKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNER 435
            G D    P PD++ + +EQ+ LV  + +  N + + A SLYS GY  V P +     + 
Sbjct: 338 QGTDPWNTPRPDEFDSTEEQRQLVNNLIDRCNDVPLCATSLYSIGYHTVDPTHIA---DH 394

Query: 436 NEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELP 495
           +EPE+S+W+  W GLLDY+FY+     TP         FE  N+I I GYL+MP   ++ 
Sbjct: 395 HEPELSSWSTKWAGLLDYIFYVNQRPSTP-------ATFETANNIAIAGYLQMPTHAQMH 447

Query: 496 SHGQPFEGEYPSDHLCMLCEVEL 518
           +H QP+ GEYPSDH+ M+C +E+
Sbjct: 448 NHSQPYTGEYPSDHISMMCALEI 470

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  374 bits (960), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 191/472 (40%), Positives = 280/472 (59%), Gaps = 34/472 (7%)

Query: 63  ISPEHIAQVXXXXXXXXXXXXXXXXXQGIDPDCPK-ELQFIKRPILQMHE---------- 111
           ++ +HI ++                 QG DPD P  +LQFI+RP L ++           
Sbjct: 42  LADDHIKKIREERAQRRQSRRNSLISQGKDPDFPTPDLQFIERPFLHVYREVSQDSKTSG 101

Query: 112 -NEPVKGFKFSLMTYNCLAQALIRRKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQE 170
              P       +MTYN LAQ LIRR  FP+ G ALKWH+RSKVL++E K Y PDI+ LQE
Sbjct: 102 MQVPPSSLDVQIMTYNTLAQTLIRRDFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQE 161

Query: 171 IDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGD- 229
           +D+ +   FW E F KLG+   F +   K HG+ V W  E F+  +  ++DYD  L+G+ 
Sbjct: 162 VDYNEL-GFWHENFHKLGFGSTFRRHEGKTHGLMVAWNNEKFQQDNEWMLDYDTILAGNA 220

Query: 230 IEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIIL 289
           I  RT T NIAL++SL   K +T     N++ +G+++  THLFWHPFG +ER RQ +++L
Sbjct: 221 ISARTRTKNIALIVSLSV-KNMT-----NLSTSGVIVANTHLFWHPFGVFERLRQSFLVL 274

Query: 290 NKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIE 349
            K++E               +  W+    GDFN++P + PY+++T +P+  +G ++ + E
Sbjct: 275 KKIEEI---------KTCPKYYGWHSLLMGDFNTEPEEPPYMAITRRPLTLTGSARAMTE 325

Query: 350 CSTSFKFSKKRXXXXXXXXXXXNIEKFGK---DQPQHPVPDDYQANDEQKLLVTKMQELH 406
           CS ++++SK R           + E  G+   DQPQ+P P  + A  EQK LV ++  LH
Sbjct: 326 CSLAYRYSKMRNGEESDQDEECDEESTGEGQHDQPQNPKPKYFVATKEQKNLVNQLVALH 385

Query: 407 NSLDMRAISLYSAGYSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNK 466
           NSL ++ ISLY   Y KVHP+NS       EPE+SNWA+ W GLLDY+FYI+  D   + 
Sbjct: 386 NSLHVKGISLYGLSYGKVHPDNS--KENHGEPELSNWANTWCGLLDYIFYIERNDNVSSS 443

Query: 467 EIDSLEDFERENDIKIRGYLRMPPAKELPSHGQPFEGEYPSDHLCMLCEVEL 518
           + + +++FE +N++KI GYLRMP A+E+P H QPFEGEY SDH+ ++C++ L
Sbjct: 444 KDEPVKNFEDQNNVKIIGYLRMPRAEEMPKHSQPFEGEYASDHISLMCQLRL 495

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  372 bits (956), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 193/449 (42%), Positives = 276/449 (61%), Gaps = 39/449 (8%)

Query: 89  QGIDPDCPK-ELQFIKRPILQM-HENEPVKGFK------------FSLMTYNCLAQALIR 134
           QG DPD P  +LQFI+RP L + H+N   KG                +MTYN LAQ LIR
Sbjct: 66  QGKDPDFPTPDLQFIERPFLPINHDNS--KGLTPATIQVTQDSLDVKIMTYNTLAQTLIR 123

Query: 135 RKLFPEGGDALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFY 194
           R  FPE G ALKWH+RSKVL++E K Y PD++ LQE+D+ +  +FW+E F KLG++  F 
Sbjct: 124 RDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIFK 182

Query: 195 KKPSKNHGVSVVWKKELFEMTDRMLVDYDKELSGD-IEPRTTTNNIALLLSLKFSKKVTE 253
           +   K HG+ V W  + F++ +  ++DYD  L+G+ I  RT T NIAL++SL F K +T+
Sbjct: 183 RHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYF-KGITD 241

Query: 254 RFPKNINKTGILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHW 313
                 +  GI++  THLFWHPFG +ER RQ Y++L K++E               ++ W
Sbjct: 242 S-----SSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEI---------KACSKYNGW 287

Query: 314 YPFFCGDFNSQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRXXXXXXXXXXXNI 373
           +    GDFN++P + PYL++T +P+   G  + ++ECS ++++SKKR             
Sbjct: 288 HSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGEESDQDDEECD 347

Query: 374 EK----FGKDQPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENS 429
           EK       DQPQ+P P+ + A  E+K LV ++  LHNSL ++ +SLY  GY KVHPEN+
Sbjct: 348 EKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPENA 407

Query: 430 GIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMP 489
             +    EP +SNWA+ W GLLDY+FYI+       ++ + L  FE  N++KI GYLRMP
Sbjct: 408 --NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMP 465

Query: 490 PAKELPSHGQPFEGEYPSDHLCMLCEVEL 518
            A+E+P H QPFEGEY SDH+ ++C++ L
Sbjct: 466 CAQEMPKHSQPFEGEYASDHISLMCQIRL 494

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  353 bits (907), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 191/447 (42%), Positives = 266/447 (59%), Gaps = 37/447 (8%)

Query: 94  DCPKELQFIKRPILQMHENEPVKG--------FKFSLMTYNCLAQALIRRKLFPEGGDAL 145
           D  +E+ FIKRP+L++    P  G         +  +MTYN LAQ LIRR  FP+  DA+
Sbjct: 37  DVAREI-FIKRPLLEV----PYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAI 91

Query: 146 KWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVSV 205
           KWHRRS+VL+ E ++Y+ D++CLQE D +Q+  FW EEF +LGY+  F+  P K HGV++
Sbjct: 92  KWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAI 151

Query: 206 VWKKELFEMT--DRMLVDYDKELSG-DIEPRTTTNNIALLLSLKFSKKVTERFPKNINKT 262
           VWK  +FE T  D++ +  D  ++G DI   T T  +AL ++L+     T R        
Sbjct: 152 VWKTSMFEDTPLDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHHKTSR-------- 203

Query: 263 GILIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFN 322
            I+  TTHLFWH FGT+ERTRQ ++IL+++ +FI +V        +     Y FF GDFN
Sbjct: 204 PIIFSTTHLFWHLFGTFERTRQLFVILSELNKFIKKVTDAHCPRGQ---RCYTFFTGDFN 260

Query: 323 SQPFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRXXXXXXXXXXXNIEKFGKD--- 379
           SQP D+PYLS+T KP++  GR+K++IECS S+++SK+R             E   ++   
Sbjct: 261 SQPCDAPYLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVE 320

Query: 380 ----QPQHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSG--IDN 433
               +PQ P P  Y A  EQ   V  +Q LHN + ++ +SLY  GY  VHPENS     +
Sbjct: 321 DETNRPQDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTS 380

Query: 434 ERNEPEISNWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKE 493
              EP++S+ A  W GLLDY+F I  W     K I  L+  ER+  IKI GYLRMP  +E
Sbjct: 381 VNQEPQLSHRALHWSGLLDYIFLITEWSENATK-ISDLQALERQTGIKINGYLRMPLKEE 439

Query: 494 LPSHGQPFEGEYPSDHLCMLCEVELCL 520
           +  H +P E EYPSDHL M+C++ L L
Sbjct: 440 MCDHTEPHENEYPSDHLAMMCDISLPL 466

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 100/226 (44%), Gaps = 14/226 (6%)

Query: 110 HENEPVKGFKFSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICL 168
           H N  +    F+L++YN L       K++      AL W  R + L  +   ++ D+ICL
Sbjct: 444 HMNNTLLKNSFTLLSYNTLCHHYATPKMYRFTPSWALSWDYRREKLKEQLLDFDTDVICL 503

Query: 169 QEIDHVQYQSFWKEEFSKLGYECQFYKK----------PSKNHGVSVVWKKELFEMTDRM 218
           QE++ + Y+ +W     K  Y C F+ K            K  G ++ +KK+ F++  + 
Sbjct: 504 QEVETLTYEEYWVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQD 563

Query: 219 LVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGT 278
            +D+        +   T + +   ++      + E    N N+  + + TTHL W P   
Sbjct: 564 SIDFSSAWRSHKKFHRTEDYLNRAMNKDNVALIAELKHLNTNE-NVWVVTTHLHWDPQFN 622

Query: 279 YERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQ 324
             +T Q  ++L+ ++  I + + + NN   D        CGDFNSQ
Sbjct: 623 DVKTFQVGVMLDYLETLIKQHHHVNNN--NDIKKIPMVICGDFNSQ 666

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 100/240 (41%), Gaps = 35/240 (14%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQS 178
           F++++YN L Q     K++      AL W  R   L ++   Y+ DI+CLQE++   ++ 
Sbjct: 435 FTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRAKLRDQILSYSCDIMCLQEVEARTFED 494

Query: 179 FWKEEFSKLGYECQFYKK----------PSKNHGVSVVWKKELFEMTDRMLVDYDK---- 224
           FW     K GY   F+ K            K  G  V +K+  F +  +  VD+      
Sbjct: 495 FWLPLLEKHGYSGSFHAKTRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEVDFSSTWMK 554

Query: 225 ----ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTY 279
               + + D   R    +NIAL   L+             +   I + TTHL W P    
Sbjct: 555 HEKFQRTEDFLNRAMNKDNIALYFKLQHIA----------SGEHIWVATTHLHWDPKFND 604

Query: 280 ERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIK 339
            +T Q  ++L+ ++  I      Q+N  +D        CGDFNS    + Y  ++S  +K
Sbjct: 605 VKTFQVGVLLDHLQTLIR-----QDNPRQDVKKAPVIICGDFNSYIDSAVYELLSSGSVK 659

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 103/240 (42%), Gaps = 42/240 (17%)

Query: 110 HENEPVKGFKFSLMTYNCLAQALIRRKLF---PEGGDALKWHRRSKVLLNEFKHYNPDII 166
           H NE +    F+L++YN L Q     K++   P    AL W  R + L +E   Y  DII
Sbjct: 388 HLNEELLKKSFTLLSYNTLCQHYATPKMYRFVPSW--ALSWDYRREKLKDEVLAYQTDII 445

Query: 167 CLQEIDHVQYQSFWKEEFSKLGYECQFYKK----------PSKNHGVSVVWKKELFEMTD 216
           CLQE++   Y+ FW     K GY   F+ K            K  G  + +K   F    
Sbjct: 446 CLQEVESKTYEEFWLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVF 505

Query: 217 RMLVDYDK--------ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTG--IL 265
           +  +D+          + + D   R    +N+AL++ L+              +TG  + 
Sbjct: 506 KDAIDFSSVWMKHKKFQRTEDYLNRAMNKDNVALIIKLRHE------------RTGEHVW 553

Query: 266 IGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPF-FCGDFNSQ 324
           + TTHL W P     +T Q  ++L+ +++ + +   + +  DK      P   CGDFNSQ
Sbjct: 554 VVTTHLHWDPHFNDVKTFQVAVMLDYIEKLLKQHGGVGSPQDKK---KIPLVICGDFNSQ 610

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 62/250 (24%), Positives = 106/250 (42%), Gaps = 32/250 (12%)

Query: 110 HENEPVKGFKFSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICL 168
           H N       F+L++YN L Q     K++      AL W  R + L  +  +Y+ DIICL
Sbjct: 400 HLNRETAKKSFTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICL 459

Query: 169 QEIDHVQYQSFWKEEFSKLGYECQFYKK----------PSKNHGVSVVWKKELFEMTDRM 218
           QE++   Y+ FW     + GY   F+ K            K  G  + ++   F++  + 
Sbjct: 460 QEVECKTYEDFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKD 519

Query: 219 LVDYDK--------ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGILIGTT 269
            VD+          + + D   R    +N+ALL+ L+  K              +   TT
Sbjct: 520 TVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALLVKLQHLKSGEH----------VWAATT 569

Query: 270 HLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSP 329
           HL W P     +T Q  ++L+ M++ I   +   N+  ++        CGDFNSQ   + 
Sbjct: 570 HLHWDPQFNDVKTFQVGVLLDHMEKVIKEHSGYNNS--QELKKVPVIICGDFNSQVDSAV 627

Query: 330 YLSMTSKPIK 339
           Y  +++  ++
Sbjct: 628 YELLSTGSVR 637

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 100/237 (42%), Gaps = 36/237 (15%)

Query: 110 HENEPVKGFKFSLMTYNCLAQALIRRKLF---PEGGDALKWHRRSKVLLNEFKHYNPDII 166
           H N+      F+L++YN L Q     K++   P    AL W  R + L  E   Y  D+I
Sbjct: 435 HVNQDTLKRSFTLLSYNTLCQHYATPKMYRFVPSW--ALSWDYRREKLKEEVLSYQTDVI 492

Query: 167 CLQEIDHVQYQSFWKEEFSKLGYECQFYKK----------PSKNHGVSVVWKKELFEMTD 216
           CLQE++   Y+ FW     K GY   F+ K            K  G  + +K   F    
Sbjct: 493 CLQEVESKTYEEFWLPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIF 552

Query: 217 RMLVDYDK--------ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGILIG 267
           +  +D+          + + D   R    +NIAL++ LK            ++   + + 
Sbjct: 553 KDAIDFSSVWMKHKKFQRTEDYLNRAMNKDNIALIVKLK----------HELSGEHVWVV 602

Query: 268 TTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQ 324
           TTHL W P     +T Q  ++L+ +++ + + + + N  +K         CGDFNSQ
Sbjct: 603 TTHLHWDPHFNDVKTFQVGVLLDYIEKLLKQQSNIGNPQEKKKVPL--IICGDFNSQ 657

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 102/240 (42%), Gaps = 32/240 (13%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQS 178
           F+L++YN L Q     K++      AL W  R   L  +   +  D++CLQE++   ++ 
Sbjct: 399 FTLLSYNTLCQHYATPKMYRYTPSWALSWDYRRDKLKEQIISFQADVVCLQEVECKTFED 458

Query: 179 FWKEEFSKLGYECQFYKK----------PSKNHGVSVVWKKELFEMTDRMLVDYDK---- 224
           FW     K GY   F+ K            K  G  V +K   F++  +  VD+      
Sbjct: 459 FWAPFLQKHGYTGVFHAKTRARTMQSKDSKKVDGCCVFYKNSEFKLVFKDAVDFSSVWMK 518

Query: 225 ----ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTY 279
               + + D   R    +N+AL + L+  K   +          I + TTHL W P    
Sbjct: 519 HKKFQRTEDYLNRAMNKDNVALFVKLQHLKTNEQ----------IWVTTTHLHWDPQFND 568

Query: 280 ERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPIK 339
            +T Q  ++L+ M++ +   N + NN  ++        CGDFNSQ   + Y   +S  ++
Sbjct: 569 VKTFQVGVLLDYMEKLLRDQNGVGNN--QEMKKVPLVICGDFNSQLDSAVYELFSSGTVR 626

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 99/241 (41%), Gaps = 32/241 (13%)

Query: 110 HENEPVKGFKFSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICL 168
           H++       F++++YN L Q     K++      AL W  R + L  +   YN DI+CL
Sbjct: 398 HQSRETLKKSFTILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCL 457

Query: 169 QEIDHVQYQSFWKEEFSKLGYECQFYKK----------PSKNHGVSVVWKKELFEMTDRM 218
           QE++   Y+ FW     + GY   F+ K            K  G    +K   F++  + 
Sbjct: 458 QEVECKTYEDFWAPLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKE 517

Query: 219 LVDYDK--------ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGILIGTT 269
            VD+          + + D   R    +N+AL++ L+  K              +   TT
Sbjct: 518 AVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALVVKLQHIKSGEH----------VWAATT 567

Query: 270 HLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSP 329
           HL W P     +T Q  ++L+ M++ I   N    N  ++        CGDFNSQ   + 
Sbjct: 568 HLHWDPQFNDVKTFQVGVLLDYMEKVIKEQN--NCNNTQELKKVPVVICGDFNSQTNSAV 625

Query: 330 Y 330
           Y
Sbjct: 626 Y 626

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 97/239 (40%), Gaps = 32/239 (13%)

Query: 112 NEPVKGFKFSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICLQE 170
           N+ V    F++M+YN L Q     K++      AL W  R + L  E   Y  DI+CLQE
Sbjct: 516 NKEVAKRSFTIMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQE 575

Query: 171 IDHVQYQSFWKEEFSKLGYECQFYKK----------PSKNHGVSVVWKKELFEMTDRMLV 220
           ++   Y+  W     K GY   F+ K            K  G  V +K+  F++  +  V
Sbjct: 576 VEAKTYEEHWAPLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEV 635

Query: 221 DYDK--------ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGILIGTTHL 271
           D+          + + D   R    +N+ + + L   K          +   + I TTHL
Sbjct: 636 DFSSTWMKHKKFQRTEDYLNRAMNKDNVVIYIKLNHLK----------SGESVWIATTHL 685

Query: 272 FWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPY 330
            W P     +T Q  I+++ ++E I       +  D   S      CGDFNSQ   + Y
Sbjct: 686 HWDPQFNDVKTFQVGILMDHLEELIKEHGSPSSRQDPKKSPV--IICGDFNSQKDSAVY 742

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 95/224 (42%), Gaps = 32/224 (14%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQS 178
           F++++YN L Q     K++      AL W  R   L  +   Y+ D++CLQE++   ++ 
Sbjct: 499 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYSSDVLCLQEVESKTFED 558

Query: 179 FWKEEFSKLGYECQFYKKP----------SKNHGVSVVWKKELFEMTDRMLVDYDK---- 224
           +W     K GY   F+ K            K  G  + +K++ F+M +R  +D+      
Sbjct: 559 YWVPLLEKHGYTGVFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKMVNRDSMDFSGAWMK 618

Query: 225 ----ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTY 279
               + + D   R    +N+AL L L+             +   I + TTHL W P    
Sbjct: 619 HKKFQRTEDYLNRAMNKDNVALFLKLQHVS----------SGDTIWVVTTHLHWDPKFND 668

Query: 280 ERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNS 323
            +T Q  ++L+ ++  +       +N  +D        CGDFNS
Sbjct: 669 VKTFQVGVLLDHLETLLKEDTT--HNSRQDIKKSPVLICGDFNS 710

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 105/245 (42%), Gaps = 43/245 (17%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQS 178
           F++++YN L Q     K++      AL W  R + L  +  ++N DIICLQE++   ++ 
Sbjct: 538 FTMLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKTFED 597

Query: 179 FWKEEFSKLGYECQFYKK----------PSKNHGVSVVWKKELFEMTDRMLVDYDK---- 224
           FW+    K GY   F+ K            K  G    +K   F+M  +  VD+      
Sbjct: 598 FWQPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDFSGLWMK 657

Query: 225 ----ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGIL-IGTTHLFWHPFGT 278
               + + D   R    +N+A+++ L           ++I    I+ + TTHL W P   
Sbjct: 658 HKKFQRTEDYLNRAMNKDNVAIVMKL-----------QHIQSGEIMWLVTTHLHWDPKFN 706

Query: 279 YERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPI 338
             +T Q  ++L+ M+  +      + N  +D   +    CGD NS      YLS +   +
Sbjct: 707 DVKTFQVGVLLDHMETLLK-----EQNPKQDVKKYPLVICGDLNS------YLSSSVYEL 755

Query: 339 KYSGR 343
             +GR
Sbjct: 756 FSTGR 760

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 94/224 (41%), Gaps = 32/224 (14%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQS 178
           FS+++YN L Q     K++      AL W  R   L  +   Y+ D++CLQE++   ++ 
Sbjct: 537 FSVLSYNTLCQHYATPKMYRYTPSWALTWDYRRSKLKEQILSYDSDVLCLQEVESKTFED 596

Query: 179 FWKEEFSKLGYECQFYKKP----------SKNHGVSVVWKKELFEMTDRMLVDYDK---- 224
           +W     K GY   FY K            K  G  + +K++ F++  +  +D+      
Sbjct: 597 YWVPLLDKHGYTGIFYAKARAKTMHSKDSKKVDGCCIFFKRDQFKLVTKDAMDFSGAWMK 656

Query: 225 ----ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTY 279
               + + D   R    +N+AL L L+             +   I + TTHL W P    
Sbjct: 657 HKKFQRTEDYLNRAMNKDNVALFLKLQHVS----------SGDTIWVVTTHLHWDPKFND 706

Query: 280 ERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNS 323
            +T Q  ++L+ ++  +       +N  +D        CGDFNS
Sbjct: 707 VKTFQVGVLLDHLESLLKEDTT--HNSRQDIKKSPVLICGDFNS 748

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 98/234 (41%), Gaps = 32/234 (13%)

Query: 110 HENEPVKGFKFSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICL 168
           H N  ++   F++++YN L Q     K++      AL W  R + L ++   +  D+ICL
Sbjct: 442 HLNPELQKKSFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVICL 501

Query: 169 QEIDHVQYQSFWKEEFSKLGYECQFYKK----------PSKNHGVSVVWKKELFEMTDRM 218
           QE++   Y+ FW     K GY   FY K            K  G  + +K+  F +  + 
Sbjct: 502 QEVESKSYEEFWLPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYKD 561

Query: 219 LVDYDK--------ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGILIGTT 269
            VD+          + + D   R    +N+AL + L+  K          +   + + TT
Sbjct: 562 SVDFSGVWMKHKKFQRTEDYLNRAMNKDNVALYMKLEHIK----------SGESVWVVTT 611

Query: 270 HLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNS 323
           HL W P     +T Q  I+L+ ++E +   N    +  ++        CGD NS
Sbjct: 612 HLHWDPQFNDVKTFQVGILLDHLEELLKDNN--NASSKQEIRKCPVIICGDLNS 663

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/224 (25%), Positives = 95/224 (42%), Gaps = 35/224 (15%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQS 178
           F++++YN L Q     K++      AL+W  R + L  +   Y  DI+CLQE++   Y+ 
Sbjct: 466 FTILSYNTLCQHYATPKMYRYTPSWALRWDYRREKLKEQILSYGCDILCLQEVESKTYED 525

Query: 179 FWKEEFSKLGYECQFY----------KKPSKNHGVSVVWKKELFEMTDRMLVDYDK---- 224
           FW     K GY   F+          K   K  G  V +KK  F++  +  +D+      
Sbjct: 526 FWAPLLEKNGYTGYFHCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDFSGAWQK 585

Query: 225 ----ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTY 279
               + + D   R    +N+A+ + L+  +          +   + + TTHL W P    
Sbjct: 586 HKRFQRTEDYLNRAMNKDNVAIYMKLQHVQ----------SGEYLWVVTTHLHWDPKFND 635

Query: 280 ERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNS 323
            +T Q  ++L+ M+  I      + N  +D   +     GDFNS
Sbjct: 636 VKTFQVGVLLDHMESIIK-----EENPKQDVKKFPIIITGDFNS 674

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 115/260 (44%), Gaps = 43/260 (16%)

Query: 100 QFIKRPILQMHENEPVKGFK----FSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVL 154
           + I R +L ++      G +    F+L+TYN L+   +  +++    +  K W  R K+L
Sbjct: 18  RMINRQLLPVYSGSASAGCRSERRFNLLTYNMLSPYYMWPQVYTYVPEPFKKWEYRHKLL 77

Query: 155 LNEFKH-YNPDIICLQEIDHVQYQSFWKEEFS-KLGYECQFYKKPSKNH---------GV 203
             E  H Y+ DI+CLQE+    Y+ FW+++   ++ +E Q+ +KP   +         GV
Sbjct: 78  EYELFHKYHADILCLQELTGKDYEKFWRKQMKRRMNFESQYAQKPPPAYWKRSQEEMDGV 137

Query: 204 SVVWKKELFE--------MTDRM--LVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTE 253
              +  + FE        ++D +  L   +KE     +   T     ++        +T+
Sbjct: 138 GTFYNADKFEHVATDLEYLSDTLGVLTPTEKEWMAQTQVEVTDATGHVVEKQSLKTVLTQ 197

Query: 254 R-----FPKNINK-TGIL--IGTTHLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQ 303
           R     F   ++K TG L  +  T L+W     Y+  +  QC+II+ ++K  + R   L 
Sbjct: 198 RNQVCLFVTLLHKPTGSLFVVVNTQLYWK----YDEVKLAQCFIIMRRLKAIVKR---LL 250

Query: 304 NNGDKDFSHWYPFFCGDFNS 323
              D  +S+      GD NS
Sbjct: 251 TRKDTSYSNIKVLLSGDLNS 270

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 94/224 (41%), Gaps = 35/224 (15%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQS 178
           F++++YN L Q     K++      AL W  R + L  +   Y  DI+CLQE++   ++ 
Sbjct: 569 FTILSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILSYQSDILCLQEVESKTFEE 628

Query: 179 FWKEEFSKLGYECQFY----------KKPSKNHGVSVVWKKELFEMTDRMLVDYDK---- 224
           FW     K  Y+  F+          K+  K  G  + +KK  F++  +  +D+      
Sbjct: 629 FWGPLLEKYDYQGVFHIKTRAKTMQTKESKKVDGCCIFFKKSKFKLLAKEAMDFSGTWMK 688

Query: 225 ----ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTY 279
               + + D   R    +N+AL + L   + +T           + + TTHL W P    
Sbjct: 689 HKKFQRTEDYLNRAMNKDNVALYMKL---QSITS-------GETVWVVTTHLHWDPKFND 738

Query: 280 ERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNS 323
            +T Q  I+L+ M+  +      + N  +D        CGD NS
Sbjct: 739 VKTFQVGILLDHMETLLK-----EENPKQDVKKANVVICGDLNS 777

>TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {ON}
           Anc_7.90 YOL042W
          Length = 388

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 112/263 (42%), Gaps = 50/263 (19%)

Query: 105 PILQMHENEPV-KGFKFSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVLLNE-FKHY 161
           PI Q H+  P  K   F+ ++YN L+   +  +++       K W  R  +L  E    Y
Sbjct: 28  PIQQPHQTLPAAKNPTFTFLSYNMLSPHYMWPQVYTYVPQEYKDWKYRHNLLEKEILDKY 87

Query: 162 NPDIICLQEIDHVQYQSFWKEEFSK-LGYECQFYKKPSKNH---------GVSVVWKKEL 211
             DI+C+QE+  + Y SFW++   K   Y  +F  K   N+         GV + +  ++
Sbjct: 88  RSDIMCVQELTTIDYYSFWRDSLRKGFNYGSRFIAKNPPNYWTKSLVEMDGVGIFYNLDM 147

Query: 212 FEMT--------------DRMLVDY--DKELS-----GDIEPRTTTNNIALLLSLKFSKK 250
           F+                DR  +DY   KE++     GD+  + +   +AL      SK 
Sbjct: 148 FDYIGSRSINLNDLASTFDRKELDYMAAKEITILNGNGDVTGKESLYELAL------SKN 201

Query: 251 VTERF---PKNINKTGILIGTTHLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNN 305
               F      I+K   +I  THL+W     YE  +  QC II+ K+ + ++ +     +
Sbjct: 202 QVCLFVMVEHKISKDVFVIINTHLYW----KYEEVKLTQCMIIMRKLAKIVNELLFNAES 257

Query: 306 GDKDFSHWYPFFCGDFNSQPFDS 328
            D +++     F GD N   FDS
Sbjct: 258 RDMNYNKVKILFSGDLNDG-FDS 279

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 94/224 (41%), Gaps = 32/224 (14%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQS 178
           F++++YN L Q     K++      AL W  R   L  +   Y+ D++CLQE++   ++ 
Sbjct: 505 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEE 564

Query: 179 FWKEEFSKLGYECQFYKKP----------SKNHGVSVVWKKELFEMTDRMLVDYDK---- 224
           +W     K GY   F+ K            K  G  + +K++ F++  +  +D+      
Sbjct: 565 YWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWMK 624

Query: 225 ----ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTY 279
               + + D   R    +N+AL L L       +  P       I   TTHL W P    
Sbjct: 625 HKKFQRTEDYLNRAMNKDNVALFLKL-------QHIPSG---DTIWAVTTHLHWDPKFND 674

Query: 280 ERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNS 323
            +T Q  ++L+ ++  +       +N  +D   +    CGDFNS
Sbjct: 675 VKTFQVGVLLDHLETLLKEET--SHNFRQDIKKFPVLICGDFNS 716

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 93/224 (41%), Gaps = 32/224 (14%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQS 178
           F++++YN L Q     K++      AL W  R   L  +   Y+ D++CLQE++   ++ 
Sbjct: 507 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFED 566

Query: 179 FWKEEFSKLGYECQFYKKP----------SKNHGVSVVWKKELFEMTDRMLVDYDK---- 224
           +W     K GY   F+ K            K  G  + +KK+ F++  +  +D+      
Sbjct: 567 YWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKKDQFKLITKDAMDFSGAWMK 626

Query: 225 ----ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTY 279
               + + D   R    +N+AL L L       +  P       I   TTHL W P    
Sbjct: 627 HKKFQRTEDYLNRAMNKDNVALFLKL-------QHIPSG---DTIWAVTTHLHWDPKFND 676

Query: 280 ERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNS 323
            +T Q  ++L+ ++  +       +N  +D        CGDFNS
Sbjct: 677 VKTFQVGVLLDHLETLLREETT--HNFRQDIKKSPVLICGDFNS 718

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 97/231 (41%), Gaps = 32/231 (13%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQS 178
           F++++YN L Q     K++      AL W  R + L  +   Y  D+ICLQE++   ++ 
Sbjct: 464 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQILSYMTDVICLQEVEAKTFEE 523

Query: 179 FWKEEFSKLGYECQFYKK----------PSKNHGVSVVWKKELFEMTDRMLVDYDK---- 224
           +W     K GY   F+ K            K  G  V +++  F++  +  VD+      
Sbjct: 524 YWAPLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAYKDAVDFSGVWQK 583

Query: 225 ----ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTY 279
               + + D   R    +N+A+ L L+  K          +   + I TTHL W P    
Sbjct: 584 HKKFQRTEDYLNRAMNKDNVAIYLKLQHIK----------SGESVWIVTTHLHWDPQFND 633

Query: 280 ERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPY 330
            +T Q  ++++ ++  +   +  Q+   ++        CGD NS+   + Y
Sbjct: 634 VKTFQVGVLMDHIENLLKEQSNAQSK--QEAKKCPVILCGDLNSEIHSAVY 682

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 100/241 (41%), Gaps = 34/241 (14%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQS 178
           F++++YN L Q     K++       L W  R + L N+      D+ICLQE++   Y+ 
Sbjct: 540 FTVLSYNTLCQHYATPKMYRYTPSWVLSWDTRREQLKNQILGIQSDVICLQEVEAQTYED 599

Query: 179 FWKEEFSKLGYECQFYKK----------PSKNHGVSVVWKKELFEMTDRMLVDYDK---- 224
           FW     K GY   F+ K            K  G  + +K+  F++  +  VD+      
Sbjct: 600 FWLPLLQKRGYLGIFHAKTRAKTMQSKDSKKVDGCCIFYKESEFKLQHQESVDFSGVWMK 659

Query: 225 ----ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKT-GILIGTTHLFWHPFGT 278
               + + D   R    +N+AL + L           ++IN    + + TTHL W P   
Sbjct: 660 HKKFQRTEDYLNRAMNKDNVALFVKL-----------EHINSGESVWVVTTHLHWDPQFN 708

Query: 279 YERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTSKPI 338
             +T Q  ++L+ ++  +   N    +  ++        CGD NS    + Y  +++  +
Sbjct: 709 DVKTFQVGVLLDHLESLLKDYN--NASSKQEIRKCPVIICGDLNSHLQSAVYELLSTGHV 766

Query: 339 K 339
           K
Sbjct: 767 K 767

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 95/225 (42%), Gaps = 34/225 (15%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQS 178
           F++++YN L Q     K++      AL W  R   L ++   +  DI+CLQE++   Y  
Sbjct: 564 FTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRDKLKDQILSFKSDILCLQEVESRTYDD 623

Query: 179 FWKEEFSKLGYECQFYKK----------PSKNHGVSVVWKKELFEMTDRMLVDYDK---- 224
           FW+    K GY+  F+ K            K  G  + +K+  F++  +  VD+      
Sbjct: 624 FWEPLLQKHGYKGIFHAKTRAKTMQTKDSKKVDGCCIFYKESEFKVLFKEAVDFSGIWMK 683

Query: 225 ----ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTY 279
               + + D   R    +N+A+ + L+  K     +          I TTHL W P    
Sbjct: 684 HKNFQRTEDYLNRAMNKDNVAIYMKLQHIKSGEVTW----------IVTTHLHWDPQFND 733

Query: 280 ERTRQCYIILNKMKEFI-DRVNILQNNGDKDFSHWYPFFCGDFNS 323
            +T Q  ++L+ ++  + +  NI   +  +D        CGD NS
Sbjct: 734 VKTFQVGVLLDHLESLLKEHSNI---HSKQDVKKCPIIICGDLNS 775

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 105/240 (43%), Gaps = 44/240 (18%)

Query: 119 KFSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVLLNEF-KHYNPDIICLQEIDHVQY 176
           +F+L+TYN L+ A +  +++    +  K W  R  +L  E    Y  DI+C+QE+    Y
Sbjct: 38  RFTLLTYNILSPAYMWPQVYTYVPEQCKQWEFRHDLLEQELLGKYKADIMCIQEMTKRDY 97

Query: 177 QSFWK----------EEFSKLGYECQFYKKPSKNHGVSVVWKKELFEMT-------DRML 219
           Q FW            EF        + ++P +  GV++ + +++F+         ++ML
Sbjct: 98  QQFWSPIASGKCDMGSEFISKTAPKYWKREPDELDGVAIFYNRKMFDFVSSKGIYLNQML 157

Query: 220 VDY-DKEL-----------SGDIEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGI--L 265
             + D EL            G   P   TN   LL  LK   +V+         TG+  +
Sbjct: 158 DAFNDHELEYLGQKKLGLTDGAGNPTGETN---LLNFLKLKNQVSLFVSLQHKSTGMYFV 214

Query: 266 IGTTHLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNS 323
           +  THL+W     Y+  +  QC +I+ ++ + ID  ++L++  D         F GD NS
Sbjct: 215 VINTHLYWK----YDEVKLTQCMVIMRELSQIID--DLLKDVPDVTKEKVKIIFTGDLNS 268

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 109/245 (44%), Gaps = 40/245 (16%)

Query: 112 NEPVKGFKFSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVLLNE-FKHYNPDIICLQ 169
           N+P    KF+L+TYN L+   +  +++    +  K W  R ++L +E FK Y  DI+CLQ
Sbjct: 22  NKPFFNNKFTLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQ 81

Query: 170 EIDHVQYQSFWKEEFSK-LGYECQF--------YKKPS-KNHGVSVVWKKELFE------ 213
           E+    Y +FW ++  + L Y   F        +K+P+ +  GV + +  + FE      
Sbjct: 82  ELTTKDYHNFWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFEYISSSS 141

Query: 214 --MTDRMLVDYDKELSGDIEPRTTTNNIA--------LLLSLKFSKKV---TERFPKNIN 260
             + D + +   +EL    E   T  N A        L+  L+   +V        K+ N
Sbjct: 142 IYLNDVLGIFNVRELKYMKETMITLTNGAGEAIGKDNLMNILQGRNQVCLFVSLRHKDTN 201

Query: 261 KTGILIGTTHLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFC 318
              ++I  THL+W     Y+  +  QC  I+ K++  I   ++L       +S     F 
Sbjct: 202 TVFVVIN-THLYWK----YDEVKLSQCLTIMRKLERIIK--SLLMGVEGVTYSKVKILFS 254

Query: 319 GDFNS 323
           GD NS
Sbjct: 255 GDLNS 259

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/247 (26%), Positives = 106/247 (42%), Gaps = 63/247 (25%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVLLNE-FKHYNPDIICLQEIDHVQYQ 177
           F+L+TYN L+Q+ +  +++       K W  R K+L  E  K YN DIICLQE+    Y+
Sbjct: 22  FTLLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYEILKLYNADIICLQELTSRDYE 81

Query: 178 SFWKEEFSKLGYECQFY-KKPSKN--------HGVSVVWKKELFEMTD------------ 216
            +W+++ SK      F  K P K          GV + +  ++FE+ D            
Sbjct: 82  YYWRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIFYNLDMFELIDSNGIRLSDFLIS 141

Query: 217 ------------RMLVDYDKE-----LSGDIEPRTTTNNIALLLSLKFSKKVTERFPKNI 259
                       R LV  D E     +S  ++     N + L ++LK  +          
Sbjct: 142 DFEQPELDYLASRKLVLTDGEGRQIKVSNILDVLEEKNQVCLFMTLKHKR---------- 191

Query: 260 NKTGILIGTTHLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDFSHWYP-F 316
               +++ TTHL+W     Y+  +  QC II+ ++ +      I+++   KD S +    
Sbjct: 192 TGATVVVVTTHLYWK----YDEIKLTQCMIIMRQLSK------IMKDQLKKDGSSFVKVL 241

Query: 317 FCGDFNS 323
           F GD NS
Sbjct: 242 FAGDLNS 248

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 99/243 (40%), Gaps = 41/243 (16%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVLLNEFKH-YNPDIICLQEIDHVQYQ 177
           F+ MTYN L+   +  +++    +  K W  R ++L  E  + Y  DI+C+QE+    Y 
Sbjct: 34  FTFMTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLYRADIMCVQELTCKDYD 93

Query: 178 SFWKEEF-SKLGYECQFYKK---------PSKNHGVSVVWKKELFEMTDRMLVDYDKELS 227
            FWK  F SK+ Y   F  K         P +  GV + +  + FE      + Y  +L 
Sbjct: 94  GFWKGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDKFEHISTTSI-YLNDLI 152

Query: 228 GDIEPR----------TTTNNIA------LLLSLKFSKKVTERFPKNINK---TGILIGT 268
           G               T TN          LL++   +     F   ++K   T  ++  
Sbjct: 153 GLFNISELNYLKSTIITLTNGAGEPVDKDSLLNVLHGRNQVSLFVSLMHKETRTLFVVIN 212

Query: 269 THLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPF 326
           THL+W     Y+  +  QC  I+ K+   I   ++L       +S     F GD NS P 
Sbjct: 213 THLYW----KYDEVKLCQCLTIMRKLHRVIK--SLLMGREGVTYSKVKILFAGDLNSAP- 265

Query: 327 DSP 329
           DSP
Sbjct: 266 DSP 268

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 106/247 (42%), Gaps = 58/247 (23%)

Query: 119 KFSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVLLNE-FKHYNPDIICLQEIDHVQY 176
           +F+++TYN L+   +  +++    D  K W  R ++L +E F  Y  DIICLQE+    Y
Sbjct: 33  RFTMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDY 92

Query: 177 QSFWKEE-FSKLGYECQFYKKPSKNH---------GVSVVWKKELFE--------MTDRM 218
             FWK++  +++ Y   F  K    +         GV + +  + FE        + D +
Sbjct: 93  NEFWKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLNDLV 152

Query: 219 LVDYDKEL-------------SGDIEPRTTTNNIA-------LLLSLKFSKKVTERFPKN 258
                +EL             +GD+    +  N+A       L + L+  +         
Sbjct: 153 GTFDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCLFVMLRHRE--------- 203

Query: 259 INKTGILIGTTHLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDFSHWYPF 316
            +K+ I++  THL+W     Y+  +  QC II+ K++  I    +L       +S+    
Sbjct: 204 -SKSIIVVINTHLYW----KYDEVKLVQCLIIMRKLQRIIK--GLLMGIEGVTYSNVKIL 256

Query: 317 FCGDFNS 323
           F GDFNS
Sbjct: 257 FSGDFNS 263

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 98/236 (41%), Gaps = 36/236 (15%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGD-ALKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQS 178
           F+L++YN L Q     K++      AL W  R + L ++   Y  DI+CLQE++   ++ 
Sbjct: 526 FTLLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSYQSDILCLQEVESKTFEE 585

Query: 179 FWKEEFSKLGYECQFY----------KKPSKNHGVSVVWKKELFEMTDRMLVDYDK---- 224
           FW     K  Y+  F+          K   K  G  + +KK  F++  +  +D+      
Sbjct: 586 FWSPLLEKYDYQGIFHIKTRAKTMQSKDSKKVDGCCIFFKKSKFKLLFKEAMDFSGTWMK 645

Query: 225 ----ELSGDIEPRTTT-NNIALLLSLKFSKKVTERFPKNINKTGILIGTTHLFWHPFGTY 279
               + + D   R    +N+AL L L+             +   + + TTHL W P    
Sbjct: 646 HKKFQRTEDYLNRAMNKDNVALYLKLQ----------SLTSGESVWVVTTHLHWDPKFND 695

Query: 280 ERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFDSPYLSMTS 335
            +T Q  I+L+ M+  +      + N  +D        CGD NS  FDS    + S
Sbjct: 696 VKTFQVGILLDHMEALLK-----EENPKQDVKKANVVICGDLNSY-FDSAVYELLS 745

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 107/238 (44%), Gaps = 42/238 (17%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVLLNEF-KHYNPDIICLQEIDHVQYQ 177
           F+L++YN L+ + +  +++    +  K W+ R K+L  E    Y  DI+CLQE+    Y 
Sbjct: 22  FTLLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDYS 81

Query: 178 SFWKEEF-SKLGYEC--------QFYKKPSKNH-GVSVVWKKELFEMTDRMLVDYDKELS 227
           +FWK+   + + Y          Q++K+P +   GV + +  + FE   R  + Y  +L 
Sbjct: 82  NFWKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYNLDKFEFISRSGI-YLNQLL 140

Query: 228 G----------DIEPRTTTNNI-------ALLLSLKFSKKVTERFPKNINKTG--ILIGT 268
           G          + +P T T+         +LL  LK   +V         +TG   ++  
Sbjct: 141 GVFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQVALFVSLKHKETGNVFVVIN 200

Query: 269 THLFWHPFGTYERTR--QCYIILNKMKEFIDRVNI-LQNNGDKDFSHWYPFFCGDFNS 323
           THL+W     Y+  +  QC II+ ++   I++  + L+N  D         F GD NS
Sbjct: 201 THLYW----KYDDVKLTQCMIIMRELARIIEKHLVGLENVTDDKIK---ILFTGDLNS 251

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 101/251 (40%), Gaps = 59/251 (23%)

Query: 115 VKGFKFSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVLLNEF-KHYNPDIICLQEID 172
           + G KF+L+TYN L+   +  +++    D  K W  R  +L +E  + Y  D++CLQE+ 
Sbjct: 32  IPGHKFTLLTYNMLSPYYMWPQVYNYVPDEFKDWKYRHMLLEDELLRTYKADVMCLQELT 91

Query: 173 HVQYQSFWKEEFSK-LGYECQFYKK-PSK------------------------------- 199
              Y S+WK  F K L Y  +F  K P K                               
Sbjct: 92  WEDYLSYWKPVFGKQLNYGSKFVAKTPPKYWDKTEQQMDGEGIFFNLDKFEYISSTRLFL 151

Query: 200 NHGVSVVWKKELFEMTDRM--LVDYDKELSGD---IEPRTTTNNIALLLSLKFSKKVTER 254
           N  V+   + EL  M  ++  L D      G+    E     N + L +SLK        
Sbjct: 152 NDVVNTFEEHELNYMKRKIVKLTDGAGNPVGEETLYEILKNRNQVCLFVSLKH------- 204

Query: 255 FPKNINKTGILIGTTHLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDFSH 312
             K  N   ++I  THL+W     Y+  +  QC II+ K+ + I+ + I     D   S 
Sbjct: 205 --KETNNVFVVIN-THLYW----KYDEVKLTQCMIIMRKLSQIINELLI---GADPSLSK 254

Query: 313 WYPFFCGDFNS 323
              F  GD NS
Sbjct: 255 DVIFITGDLNS 265

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 63/244 (25%), Positives = 106/244 (43%), Gaps = 39/244 (15%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVLLNEFKH-YNPDIICLQEIDHVQYQ 177
           F+LMTYN L+   +  +++    +  K W  R ++L  E  + Y  DI+C+QE+    Y+
Sbjct: 30  FTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCVQELTCKDYE 89

Query: 178 SFWKEEF-SKLGYEC--------QFYKKPS-KNHGVSVVWKKELFE--------MTDRML 219
            FWK  F +K+ Y          +++K+P  +  GV + +    FE        + D + 
Sbjct: 90  GFWKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHISTSSIYLNDLIG 149

Query: 220 VDYDKELSGDIEPRTTTNNIA-------LLLSLKFSKKVTERFPKNINK---TGILIGTT 269
           +    EL+       T  N A        LL++   +     F   ++K   T  ++  T
Sbjct: 150 LFNISELNYLKSTIITLTNGAGEPIDKDSLLNVLHGRNQVSLFVSLLHKETRTLFVVVNT 209

Query: 270 HLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQPFD 327
           HL+W     Y+  +  QC  I+ K+   I   ++L       +S     F GD NS P D
Sbjct: 210 HLYW----KYDEVKLCQCLTIMRKLHRVIK--SLLMGMEGVTYSKVKILFAGDLNSAP-D 262

Query: 328 SPYL 331
           SP +
Sbjct: 263 SPVI 266

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 98/237 (41%), Gaps = 40/237 (16%)

Query: 120 FSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVLLNE-FKHYNPDIICLQEIDHVQYQ 177
            S++TYN L+   +  +++    D  K W+ R K+L  E F  +  DI+CLQE+    Y 
Sbjct: 30  LSVLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADILCLQELTTEDYN 89

Query: 178 SFWKEEFS-KLGYECQFYKKPSKNH---------GVSVVWKKELFEMTDRMLVDYDKELS 227
            FW+++   +L Y   F  KP   +         GV   +  E  E     ++  +  LS
Sbjct: 90  QFWRKQMKRRLSYGSNFISKPPPKYWTAGLQEMDGVGTFYNTEKLEFISSTVIYLNDFLS 149

Query: 228 -------------------GDIEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGILIGT 268
                              G  +P TT + +++LL             K+  K+ I++  
Sbjct: 150 MFSKRELDWMSRRQITQTNGANDPVTTRSLLSILLDRNQVCLFVCLREKD-TKSLIVVVN 208

Query: 269 THLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNS 323
           THL+W     Y+  +  QC  I+ K+K+ I+++          +S       GD NS
Sbjct: 209 THLYWK----YDEVKLSQCLTIMRKLKQVINKLTTTLEG--VTYSQIKIILGGDLNS 259

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 104/248 (41%), Gaps = 60/248 (24%)

Query: 119 KFSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVLLNE-FKHYNPDIICLQEIDHVQY 176
           K S++TYN L+   +  +++    D  K W+ R K+L  E    Y  DI+CLQE+  + Y
Sbjct: 21  KLSVLTYNMLSPYYMWPQVYTYVPDEYKKWNYRHKLLQKEILGLYRADIMCLQELTSLDY 80

Query: 177 QSFW-KEEFSKLGYECQFYKKP---------SKNHGVSV--------------VWKKELF 212
           Q +W K    K  Y  ++  KP         S+  GV V              ++  +LF
Sbjct: 81  QQYWNKVLMEKYNYGSKYIAKPPPKYWERSLSEMDGVGVFYDLNKFDYISSTGIYLNDLF 140

Query: 213 EMTD---------RMLVDYDKELSGDIEPRTTT------NNIALLLSLKFSKKVTERFPK 257
              D         +ML   D +    +E  T +      N + + +SL+   K T  F  
Sbjct: 141 GTFDLKEQNYLEHKMLQLTDGQ-GNPMEKMTLSDVLKGRNQVCMFVSLR--HKATNTF-- 195

Query: 258 NINKTGILIGTTHLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDFSHWYP 315
                 +++  THL+W     Y+  +  QC II+ ++ + I   ++L    D  ++    
Sbjct: 196 ------LIVINTHLYW----KYDEVKLAQCMIIMRRLSKIIK--DLLIGVQDTTYNKVKI 243

Query: 316 FFCGDFNS 323
            F GD NS
Sbjct: 244 IFAGDMNS 251

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 101/247 (40%), Gaps = 58/247 (23%)

Query: 119 KFSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVLLNE-FKHYNPDIICLQEIDHVQY 176
           KF+ MTYN L+   +  +++    D  K W+ R K+L  E    Y  DI+CLQE+    Y
Sbjct: 28  KFTFMTYNMLSPHYMWPQVYTYVPDEYKDWNYRHKLLEKEILNSYRADIMCLQELTASDY 87

Query: 177 QSFWKEEFSK-LGYECQFYKKPSKNH---------GVSVVWKKELFEMT-------DRML 219
             +W+E   +   Y  +F  KP   +         GV + +    F+         + ++
Sbjct: 88  HQYWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGIFYNLNKFDYISSTSIHLNDLI 147

Query: 220 VDYD-KELS-----------GDIEPR---------TTTNNIALLLSLKFSKKVTERFPKN 258
             +D  ELS           G   P+          + N + L ++LK          K+
Sbjct: 148 GSFDLDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRNQVGLFVALKH---------KD 198

Query: 259 INKTGILIGTTHLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDFSHWYPF 316
            N   ++I  THL+W     Y+  +  QC II+ K+ + I   ++L       ++     
Sbjct: 199 TNTIFVVI-NTHLYW----KYDEVKLTQCLIIMRKLAKIIR--DLLVGEHGTTYNKMKVV 251

Query: 317 FCGDFNS 323
           F GD NS
Sbjct: 252 FAGDLNS 258

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 101/241 (41%), Gaps = 40/241 (16%)

Query: 119 KFSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVLLNEF-KHYNPDIICLQEIDHVQY 176
           KF+++TYN L+   +  +++    D  K W  R K+L  E  + Y  DI+CLQE+    Y
Sbjct: 47  KFTMLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQELTWEDY 106

Query: 177 QSFWKEEFS-KLGYECQFYKKPSKNH---------GVSVVWKKELFEM---TDRML---- 219
            S+WK + + K+ Y  +F  K    +         G  + + +E FE    T   L    
Sbjct: 107 ISYWKPKCNEKMNYGSKFVAKTPPAYWEKTKQEMDGEGIFFNQEKFEYISSTKLFLNDVV 166

Query: 220 -------VDYDKE----LSGDIEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGILIGT 268
                  ++Y K+    L+      T TNN+  + + +    +          T  ++  
Sbjct: 167 GTFEEHEIEYMKKKIVTLTDGAGKPTGTNNLFTVATTRNQVCLFVSLRHKATNTVFVVIN 226

Query: 269 THLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDFSHWYP----FFCGDFN 322
           THL+W     Y+  +  QC II+ K+   I+ + I  N    D S         F GD N
Sbjct: 227 THLYWK----YDEVKLTQCMIIMRKLSHIINELLIGSNAKIVDNSTISKDVKIIFSGDLN 282

Query: 323 S 323
           S
Sbjct: 283 S 283

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 106/243 (43%), Gaps = 45/243 (18%)

Query: 116 KGFKFSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVL----LNEFKHYNPDIICLQE 170
           K  +F+L+TYN L+ + +  +++    +  K W  R K+L    LN FK    DI+CLQE
Sbjct: 23  KDARFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFK---ADIMCLQE 79

Query: 171 IDHVQYQSFWKEEFS-KLGYECQF--------YKKPSKNH-GVSVVWKKELFE------- 213
           +    Y+ +W++     + Y  +F        +K P K+  GVS+ +  E F+       
Sbjct: 80  MTARDYEDYWRDYIGVDINYGSKFIPKTPPKYWKNPVKDMDGVSIFYNLEKFDYISSTGI 139

Query: 214 -MTDRMLVDYDKELSGDIEPRTTTNNIA--------LLLSLKFSKKVTERFPKNINKTG- 263
            +   + V  ++EL      + T  + A        LL  LK   +V         +TG 
Sbjct: 140 YLNQLLNVFNERELKYLFNKKVTLTDGASNIVGEDSLLDVLKGKNQVCLFVSLKHKETGT 199

Query: 264 -ILIGTTHLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGD 320
             ++  THL+W     Y+  +  QC II+ ++ + I +   L +   K        F GD
Sbjct: 200 VFVVLNTHLYWK----YDEVKLTQCMIIMRELSKIIKQ---LLSGDVKSQRKVKILFTGD 252

Query: 321 FNS 323
            NS
Sbjct: 253 LNS 255

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/247 (24%), Positives = 98/247 (39%), Gaps = 60/247 (24%)

Query: 119 KFSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVLLNEF-KHYNPDIICLQEIDHVQY 176
           KF+L+TYN L+ + +  +++    D  K W  R K+L +E    Y  DI+CLQE+    Y
Sbjct: 29  KFTLLTYNMLSPSYMWPQVYTYVPDPYKDWQYRHKLLESELLGSYKADIMCLQEMTSRDY 88

Query: 177 QSFWKEEF-SKLGYECQFYKKP---------SKNHGVSVVWKKELFEMTDR--------- 217
              WK    S +GY  +F  K           +  GV + +  + F+             
Sbjct: 89  NENWKRLLGSGIGYGSKFIAKSPPLYWEREVDEIDGVGIFYNLKKFDFISSSGIYLNQFL 148

Query: 218 ----------------MLVDYDKELSGD---IEPRTTTNNIALLLSLKFSKKVTERFPKN 258
                           +L D      G+   ++  +  N + L +SLK  K+  E F   
Sbjct: 149 NVFSSTELEYLHSKRLVLTDGAGVPIGEKNLLDVISGKNQVCLFVSLK-HKETGEMF--- 204

Query: 259 INKTGILIGTTHLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDFSHWYPF 316
                 ++  THL+W     Y+  +  QC II+ ++ + ID +      G  D       
Sbjct: 205 ------VVINTHLYWK----YDEVKLTQCMIIMRELSKIIDEL----VKGVDDPGKVKIL 250

Query: 317 FCGDFNS 323
           F GD NS
Sbjct: 251 FTGDLNS 257

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 103/253 (40%), Gaps = 65/253 (25%)

Query: 116 KGFKFSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVL----LNEFKHYNPDIICLQE 170
           K  +F+L+TYN L+ + +  +++    +  K W  R K+L    LN FK    DI+CLQE
Sbjct: 23  KDARFTLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLLEKELLNSFK---ADIMCLQE 79

Query: 171 IDHVQYQSFWKEEFS-KLGYECQF--------YKKPSKNH-GVSVVWKKELFEMTDR--- 217
           +    Y+ +W +     + Y  +F        +KKP ++  GVS+ +  + F+       
Sbjct: 80  MTRRDYEDYWHDSIGVNINYGSKFISKTPPKYWKKPLEDMDGVSIFYNLDKFDFISSSGI 139

Query: 218 ----------------------MLVDYDKELSGD---IEPRTTTNNIALLLSLKFSKKVT 252
                                 +L D    + G+   ++     N + L +SLK  +   
Sbjct: 140 YLNQLLNVFNERELKYLYNKRVILTDGASNVVGEDSLLDVLKGKNQVCLFVSLKHKE--- 196

Query: 253 ERFPKNINKTGILIGTTHLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDF 310
                    T  ++  THL+W     Y+  +  QC II+ ++ + I++   L     K  
Sbjct: 197 -------TDTIFVVLNTHLYWK----YDEVKLTQCMIIMRELSKIIEQ---LLPGDAKGR 242

Query: 311 SHWYPFFCGDFNS 323
                 F GD NS
Sbjct: 243 GKVKILFTGDLNS 255

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 58/249 (23%), Positives = 105/249 (42%), Gaps = 65/249 (26%)

Query: 119 KFSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVL-LNEFKHYNPDIICLQEIDHVQY 176
           KF++++YN L+ + +  +++    D  K W+ R  +L L     Y  DI+C+QE+    Y
Sbjct: 29  KFTVLSYNMLSPSYMWPQVYTYVPDQYKDWNYRHTLLELELLDKYKADIMCVQEMTKRDY 88

Query: 177 QSFWKEEF-SKLGYECQFYKKPSKNH---------GVSVVW------------------- 207
             +W+ +  + +GY  +F  K    +         GV++ +                   
Sbjct: 89  IDYWQLKLGTTIGYGSKFIAKSPPKYWERHLLDLDGVAIFYNLQKFDFISSSGIYLNEFL 148

Query: 208 -----------KKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFP 256
                      K++  E+TD   +  D++   +I   +  N ++L + LK  K+  + F 
Sbjct: 149 DVFNPEELQYLKEKTLELTDGAGIKIDEKTLFEI--LSVKNQVSLFVCLK-HKETGQVF- 204

Query: 257 KNINKTGILIGTTHLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDFSHWY 314
                   +I  THL+W     Y+  +  QC II+ ++ + ID   +LQ   D   S   
Sbjct: 205 --------IIINTHLYWK----YDEVKLSQCIIIMRELSKIIDE--LLQ---DVRHSKVK 247

Query: 315 PFFCGDFNS 323
             F GD NS
Sbjct: 248 IIFAGDLNS 256

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 103/240 (42%), Gaps = 39/240 (16%)

Query: 116 KGFKFSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVLLNEF-KHYNPDIICLQEIDH 173
           K  +F+L+TYN L+ + +  +++    +  K W+ R K+L  E    +  DI+CLQE+  
Sbjct: 23  KDARFTLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLEKELLTTFKADIMCLQEMTT 82

Query: 174 VQYQSFWKEEFS-KLGYECQF--------YKKPSKNH-GVSVVWKKELFE--------MT 215
             Y+++W       + Y  +F        ++KP K+  GVS+ +  E F+        + 
Sbjct: 83  RDYENYWHNSIGVDINYGSKFISKTPPKYWEKPVKDMDGVSIFYNLEKFDYISSSGIYLN 142

Query: 216 DRMLVDYDKELSGDIEPRTTTNNIA--------LLLSLKFSKKVT--ERFPKNINKTGIL 265
             + V  ++EL      + T  + A        LL  LK   +V            T  +
Sbjct: 143 QLLNVFNERELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLKHKETNTIFV 202

Query: 266 IGTTHLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNS 323
           +  THL+W     Y+  +  QC II+ ++ + I ++     N  +        F GD NS
Sbjct: 203 VLNTHLYWK----YDEVKLTQCMIIMRELSKIIKQLLPGDANAQEKVK---ILFTGDLNS 255

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 102/243 (41%), Gaps = 45/243 (18%)

Query: 116 KGFKFSLMTYNCLAQALIRRKLFPEGGDALK-WHRRSKVL----LNEFKHYNPDIICLQE 170
           K  +F+L+TYN L+ + +  +++    +  K W  R ++L    LN FK    DI+CLQE
Sbjct: 23  KDARFTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFK---ADIMCLQE 79

Query: 171 IDHVQYQSFWKEEFS-KLGYECQF--------YKKPSKNH-GVSVVWKKELFEMTD---- 216
           +    Y+ +W +     + Y  +F        +KKP K+  GVS+ +    F+       
Sbjct: 80  MTARDYEDYWHDSIGVDVNYGSKFISKTPPKYWKKPVKDMDGVSIFYNLAKFDFISSSGI 139

Query: 217 ------------RMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGI 264
                        +   Y+K+++            +LL  LK   +V         +TG 
Sbjct: 140 YLNQLLNVFNQRELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLRHKETGT 199

Query: 265 L--IGTTHLFWHPFGTYERTR--QCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGD 320
           +  +  THL+W     Y+  +  QC II+ ++ + I ++      G +        F GD
Sbjct: 200 IFVVLNTHLYWK----YDEVKLTQCMIIMRELSKIIKQLLPGDVKGQERVK---ILFTGD 252

Query: 321 FNS 323
            NS
Sbjct: 253 LNS 255

>NDAI0K00220 Chr11 complement(34357..38238) [3882 bp, 1293 aa] {ON}
           Anc_8.865 YML091C
          Length = 1293

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 421 YSKVHPENSGIDNERNEPEISNWAHIWRGLLDYLFYIKSWDFTPN 465
           YSK+ P    + N+R+   ++   +IW  L D+L +IKS DF  N
Sbjct: 924 YSKILP----LVNDRSLKRLTTTTNIWETLPDFLNFIKSIDFPNN 964

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,263,032
Number of extensions: 2519286
Number of successful extensions: 6212
Number of sequences better than 10.0: 75
Number of HSP's gapped: 6227
Number of HSP's successfully gapped: 75
Length of query: 520
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 406
Effective length of database: 40,409,475
Effective search space: 16406246850
Effective search space used: 16406246850
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)