Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B028908.849ON64864833610.0
NCAS0C003208.849ON60864413810.0
Suva_13.4748.849ON60261313770.0
Smik_13.5008.849ON60262313730.0
YMR284W (YKU70)8.849ON60262313730.0
KAFR0L019508.849ON58863413700.0
TDEL0B001808.849ON58261713580.0
ZYRO0C14850g8.849ON59462713561e-180
Skud_13.4578.849ON60262813431e-178
NDAI0K003608.849ON62064413421e-178
SAKL0D01188g8.849ON58161413151e-174
Kwal_27.101998.849ON57260212281e-161
TPHA0I003108.849ON60862212241e-160
KNAG0M02650singletonON57461212181e-160
KLTH0C03586g8.849ON57861912021e-157
CAGL0I02662g8.849ON60664011961e-156
KLLA0C06226g8.849ON59263211501e-149
Kpol_1068.18.849ON51452211401e-149
AFR443CsingletonON5766178971e-112
Ecym_46208.849ON5975908072e-98
ABL117C8.849ON6025996186e-71
TBLA0B090202.444ON681190980.004
Smik_11.3585.702ON1878116810.45
Kpol_1018.1592.444ON629162790.67
YKR095W (MLP1)5.702ON187576771.2
Suva_13.2832.444ON621172761.6
NDAI0B033802.325ON1446198761.9
NCAS0F014802.444ON625162733.2
Skud_13.2642.444ON622242724.2
Kpol_1036.173.122ON763149715.9
ABR139W5.34ON1270115717.2
SAKL0E09768g2.201ON144895709.3
Smik_13.2922.444ON626176699.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B02890
         (648 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.8...  1299   0.0  
NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}...   536   0.0  
Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284...   535   0.0  
Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284...   533   0.0  
YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subu...   533   0.0  
KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8....   532   0.0  
TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849...   527   0.0  
ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} simi...   526   e-180
Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284...   521   e-178
NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849     521   e-178
SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON...   511   e-174
Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284...   477   e-161
TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849...   476   e-160
KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {...   473   e-160
KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} simila...   467   e-157
CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} simila...   465   e-156
KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} simila...   447   e-149
Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON} com...   443   e-149
AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}...   350   e-112
Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {O...   315   2e-98
ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON} S...   242   6e-71
TBLA0B09020 Chr2 complement(2138426..2140471) [2046 bp, 681 aa] ...    42   0.004
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...    36   0.45 
Kpol_1018.159 s1018 (408890..410779) [1890 bp, 629 aa] {ON} (408...    35   0.67 
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...    34   1.2  
Suva_13.283 Chr13 complement(459944..461809) [1866 bp, 621 aa] {...    34   1.6  
NDAI0B03380 Chr2 (859629..863969) [4341 bp, 1446 aa] {ON} Anc_2....    34   1.9  
NCAS0F01480 Chr6 complement(295334..297211) [1878 bp, 625 aa] {O...    33   3.2  
Skud_13.264 Chr13 complement(453586..455454) [1869 bp, 622 aa] {...    32   4.2  
Kpol_1036.17 s1036 (45392..47683) [2292 bp, 763 aa] {ON} (45392....    32   5.9  
ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic h...    32   7.2  
SAKL0E09768g Chr5 complement(813986..818332) [4347 bp, 1448 aa] ...    32   9.3  
Smik_13.292 Chr13 complement(462805..464685) [1881 bp, 626 aa] {...    31   9.6  

>TBLA0B02890 Chr2 (666770..668716) [1947 bp, 648 aa] {ON} Anc_8.849
           YMR284W
          Length = 648

 Score = 1299 bits (3361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/648 (98%), Positives = 638/648 (98%)

Query: 1   MSFFSNNSNHLMDDNDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILE 60
           MSFFSNNSNHLMDDNDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILE
Sbjct: 1   MSFFSNNSNHLMDDNDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILE 60

Query: 61  SLSDLFEQLIISRPNTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLED 120
           SLSDLFEQLIISRPNTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLED
Sbjct: 61  SLSDLFEQLIISRPNTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLED 120

Query: 121 LSHDRKKLEDIFKFDNSRPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPI 180
           LSHDRKKLEDIFKFDNSRPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPI
Sbjct: 121 LSHDRKKLEDIFKFDNSRPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPI 180

Query: 181 ESENNETRKKLRRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVE 240
           ESENNETRKKLRRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVE
Sbjct: 181 ESENNETRKKLRRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVE 240

Query: 241 DYYDDAGENGNHYLLINDLXXXXXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQ 300
           DYYDDAGENGNHYLLINDL          RKINPSLRRFCRPNTKPIEASNIKQRILRKQ
Sbjct: 241 DYYDDAGENGNHYLLINDLKDTSKSKTTDRKINPSLRRFCRPNTKPIEASNIKQRILRKQ 300

Query: 301 EIRRVRFQCPLILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDP 360
           EIRRVRFQCPLILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDP
Sbjct: 301 EIRRVRFQCPLILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDP 360

Query: 361 NTGEELKDEDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNN 420
           NTGEELKDEDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNN
Sbjct: 361 NTGEELKDEDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNN 420

Query: 421 IDKASFVVPDESSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEH 480
           IDKASFVVPDESSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEH
Sbjct: 421 IDKASFVVPDESSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEH 480

Query: 481 NEGLYLFQVPFLDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSY 540
           NEGLYLFQVPFLDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSY
Sbjct: 481 NEGLYLFQVPFLDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSY 540

Query: 541 RNPALQKYYKILHDYLLQIEDTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPE 600
           RNPALQKYYKILHDYLLQIEDTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPE
Sbjct: 541 RNPALQKYYKILHDYLLQIEDTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPE 600

Query: 601 LYNQRLSKFIEHWNRVFKKINEDAQMDIEPTPVTLKKRKQKEKLALNL 648
           LYNQRLSKFIEHWNRVFKKINEDAQMDIEPTPVTLKKRKQKEKLALNL
Sbjct: 601 LYNQRLSKFIEHWNRVFKKINEDAQMDIEPTPVTLKKRKQKEKLALNL 648

>NCAS0C00320 Chr3 complement(44190..46016) [1827 bp, 608 aa] {ON}
           Anc_8.849
          Length = 608

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/644 (45%), Positives = 414/644 (64%), Gaps = 45/644 (6%)

Query: 12  MDDNDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLII 71
           +D+ +   + S+KK+ IHEGIIFC+ELS  MFE +PEL  K QLLEILESL +L  QL+I
Sbjct: 3   VDEIENGDHPSFKKYDIHEGIIFCIELSKSMFEEVPELNYKVQLLEILESLHELMSQLVI 62

Query: 72  SRPNTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDI 131
            RP+T IG Y FH+       +K GIYEFF L D+N + MKKV+DL+EDL+  R  L + 
Sbjct: 63  IRPSTGIGCY-FHYCDRKNGDSKNGIYEFFPLRDVNARDMKKVSDLIEDLTLKRITLLEY 121

Query: 132 FKFD------NSRPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENN 185
           F FD      + +   LE +FN + +QF    +   S  ++ KK+FLFT+ND P E  + 
Sbjct: 122 FNFDPTLDNDSQKRVPLETLFNFLLDQFTKLTA--DSNKYHSKKIFLFTDNDSPHEVNDK 179

Query: 186 ETRKKLRRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDD 245
           +   ++RR+V+D+N++ I F TFFI +    F ++FYS+ILKL      S+++ E+    
Sbjct: 180 DATLRIRRIVDDMNDNYINFVTFFIGREGKPFKNSFYSNILKL-----GSKVNKENLAQS 234

Query: 246 AGENGNHYLLINDLXXXXXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRV 305
            G     Y                         +  PNT PI AS IK +ILRK+EI+R 
Sbjct: 235 DGTGDEEY-----------------------SEYDGPNTTPIPASYIKSKILRKKEIKRT 271

Query: 306 RFQCPLILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEE 365
            FQCPLIL E +NFI+ + GY I + EKP TRYKLVYEHEN+RKEA SRRKFL+PNTGEE
Sbjct: 272 MFQCPLILKEENNFIVSVRGYAIVTQEKPATRYKLVYEHENIRKEASSRRKFLNPNTGEE 331

Query: 366 LKDEDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKAS 425
           +K ++  KV+ YGD +IEL+D+    I ++Y ++  F+K++GFRS   S++Y+NNIDKA 
Sbjct: 332 IKPDELCKVFPYGDQDIELNDKEVAKINDDYSKHESFLKVIGFRSTKNSIRYFNNIDKAL 391

Query: 426 FVVPDESSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLY 485
           FVVPDES YEG+IKTMASLFR L K+ K  IVWG   S  +  ++ILSP+   + NEG Y
Sbjct: 392 FVVPDESQYEGTIKTMASLFRVLKKRDKCMIVWGKVKSNSNLRLYILSPTTNIDRNEGFY 451

Query: 486 LFQVPFLDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPAL 545
           L+++PFLDEIR+FP L  Y+  T     +Y  + ++TE I+G  +L+KGYRPS ++NP+L
Sbjct: 452 LYRIPFLDEIRKFPKLLDYNHITTS--EDYLNLVRITENIIGYFNLKKGYRPSDFKNPSL 509

Query: 546 QKYYKILHDYLLQIEDTSLTDTPQE-VLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQ 604
           Q++YK LHDYLLQ+E     D   +    R + EDDTL ++  +R++II S ++ ++  Q
Sbjct: 510 QRHYKTLHDYLLQVEQPVREDGDSDGQTSRFLKEDDTLNKILHIREKIIASKESDDVTQQ 569

Query: 605 RLSKFIEHWNRVFKKINEDAQMDIEPTPVTLKKRKQKEKLALNL 648
           RLSK++  WN  + K+ +++ +DI+ +      + +K K  LNL
Sbjct: 570 RLSKYVSLWNTFYIKMEKESGIDIDTS-----HKLKKGKFELNL 608

>Suva_13.474 Chr13 (820105..821913) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/613 (45%), Positives = 407/613 (66%), Gaps = 48/613 (7%)

Query: 15  NDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRP 74
           ND + +ASY+KF IHEGI+FC+ELS+ MF+  PEL  KS LLEILESL++L  QL+I+RP
Sbjct: 15  NDITEDASYRKFDIHEGILFCIELSASMFKESPELNYKSPLLEILESLNELMSQLVITRP 74

Query: 75  NTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKF 134
            T+IG Y ++   D  ++   GIYE F L DIN K MK + DLLED+S  R  L + F F
Sbjct: 75  GTSIGCYFYYCGRDDAKE---GIYELFPLRDINAKFMKILNDLLEDVSSGRITLFEYFNF 131

Query: 135 DNSRP---TKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKL 191
            +S       L  +F  + + FL    +   K  + KK+FLFT+NDKP ES++ + R +L
Sbjct: 132 QHSEKQMQMPLGKLFTFMLDTFLQ--DIPGQKQLSSKKIFLFTDNDKPQESQDADERARL 189

Query: 192 RRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGN 251
           RR+  DL ++++ F+TFFI   ++ FD+ FYSDIL+L  + +   +D++  +D       
Sbjct: 190 RRLTIDLFDNKVNFATFFIGYGNNSFDNEFYSDILQLGSHKNKG-VDLDSEFDG------ 242

Query: 252 HYLLINDLXXXXXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPL 311
                                         PNTKPI+A  IK +ILRK+E++R+ FQCPL
Sbjct: 243 ------------------------------PNTKPIDAKYIKSKILRKKEVKRIAFQCPL 272

Query: 312 ILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDF 371
           I DE +NFIIG+ GY + S EK G RYKLVYEHE++R+EA+S+RKFL+P TG ++     
Sbjct: 273 IFDEDTNFIIGVKGYTMHSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNPTTGADVTGSTV 332

Query: 372 QKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDE 431
            KVY YGD++I LS++  Q I   Y +   F++++GFRS   S+ Y+NNI+K++F+VPDE
Sbjct: 333 -KVYPYGDLDINLSEKQNQVIMEAYTQKDGFLRIIGFRSPTSSIHYFNNIEKSTFIVPDE 391

Query: 432 SSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPF 491
           + YEGSI+T+ASL +TL KK KVAIVWG   S  HP++ +LSPS+  E+NEG YL+++PF
Sbjct: 392 AKYEGSIRTLASLLKTLRKKDKVAIVWGKLKSNSHPSLFVLSPSSIEEYNEGFYLYRIPF 451

Query: 492 LDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQKYYKI 551
           LDEIR+FP+L SY  G    + EY+ MK++++ I+G  +LR GY PS ++NP+LQ+++K+
Sbjct: 452 LDEIRKFPSLLSYDSGEKHEL-EYDNMKRISQSIMGYFNLRDGYNPSDFKNPSLQRHFKV 510

Query: 552 LHDYLLQIE-DTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQRLSKFI 610
           LHDYLLQIE +    +T +  + R ++EDD+L +L  +R +I++S ++ +   QRL+K++
Sbjct: 511 LHDYLLQIEVNIEENETSEARINRVIHEDDSLRKLYHIRNKILESEKSEDPAIQRLNKYV 570

Query: 611 EHWNRVFKKINED 623
           + WN  + K N+D
Sbjct: 571 KIWNTFYNKFNDD 583

>Smik_13.500 Chr13 (820721..822529) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/623 (46%), Positives = 403/623 (64%), Gaps = 49/623 (7%)

Query: 6   NNSNHLMDD-NDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSD 64
           NN+    DD N+      Y+KF +HEGI+FCVELS  MF+   EL  KS LLEILESL++
Sbjct: 5   NNAFGSTDDFNNEMDEPGYRKFDMHEGILFCVELSETMFKESSELDYKSPLLEILESLNE 64

Query: 65  LFEQLIISRPNTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHD 124
           L  QL+I+RP TAIG Y ++   D  ++   GIYE F L DINV+ MKK+ DLLEDLS +
Sbjct: 65  LMSQLVITRPGTAIGCYFYYCYRDDAKE---GIYELFPLRDINVRFMKKLNDLLEDLSSE 121

Query: 125 RKKLEDIFKF---DNSRPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIE 181
           R  L + F F   +N +   L  +F  + + FL   S    K  N K+VFLFT+NDKP E
Sbjct: 122 RVTLYEYFNFQKTENQKQMPLASLFTFILDTFLQDSS--GQKQLNNKRVFLFTDNDKPQE 179

Query: 182 SENNETRKKLRRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVED 241
           ++N + R +LRR+  DL +++I F+TFFI   ++ FD+ FYSDIL+L             
Sbjct: 180 AQNADDRARLRRLTVDLFDNKINFTTFFIGYVNNSFDNEFYSDILQL------------- 226

Query: 242 YYDDAGENGNHYLLINDLXXXXXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQE 301
                G + N  + +N                     F  PNTKPI+A  IK RILRK+E
Sbjct: 227 -----GSHKNKTIGLNS-------------------EFDGPNTKPIDAKYIKSRILRKRE 262

Query: 302 IRRVRFQCPLILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPN 361
           ++R+ FQC LI DE ++FIIGI GY ++S EK G RYKLVYEHE++R+EA+S+RKFL+  
Sbjct: 263 VKRIMFQCQLIFDEKTDFIIGIKGYTMYSHEKAGVRYKLVYEHEDIRQEAYSKRKFLNFM 322

Query: 362 TGEELKDEDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNI 421
           +GE++ D    KVY YGD++I LS+   Q +   Y     F+K+ GFRS  IS+ Y+NNI
Sbjct: 323 SGEDVTDNTV-KVYPYGDLDINLSEHQDQIVMEAYTRKDAFLKITGFRSSSISMHYFNNI 381

Query: 422 DKASFVVPDESSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHN 481
           +K+SF+VPDE  YEGSI+ + SL + L KK K+AI+WG   S  HP++ +LSPSN  E+N
Sbjct: 382 EKSSFIVPDEEKYEGSIRALTSLLKILRKKDKIAILWGKLKSNSHPSLFVLSPSNIKEYN 441

Query: 482 EGLYLFQVPFLDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYR 541
           EG YL++VPFLDEIR+FP+L SY  G++  I +Y+ MKK+T+ I+G  +LR GY PS ++
Sbjct: 442 EGFYLYRVPFLDEIRKFPSLLSYDDGSDHEI-DYDNMKKVTQSIIGYFNLRDGYNPSDFK 500

Query: 542 NPALQKYYKILHDYLLQIEDT-SLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPE 600
           NP LQK+YK+LHDYLLQ E      +T    ++R V+EDD+L +L  +R +I++S ++ +
Sbjct: 501 NPLLQKHYKVLHDYLLQTETAFEENETSDTKMDRIVHEDDSLRKLYHIRNKILESEKSED 560

Query: 601 LYNQRLSKFIEHWNRVFKKINED 623
              QRL+K+++ WN  +KK N D
Sbjct: 561 PAIQRLNKYVKIWNMFYKKFNVD 583

>YMR284W Chr13 (838187..839995) [1809 bp, 602 aa] {ON}  YKU70Subunit
           of the telomeric Ku complex (Yku70p-Yku80p), involved in
           telomere length maintenance, structure and telomere
           position effect; relocates to sites of double-strand
           cleavage to promote nonhomologous end joining during DSB
           repair
          Length = 602

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/623 (46%), Positives = 403/623 (64%), Gaps = 53/623 (8%)

Query: 6   NNSNHLMDDNDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDL 65
            NS  L   ND      Y+KF IHEGI+FC+ELS  MF+   +L+ KS LLEILESL +L
Sbjct: 9   GNSGEL---NDQVDETGYRKFDIHEGILFCIELSETMFKESSDLEYKSPLLEILESLDEL 65

Query: 66  FEQLIISRPNTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDR 125
             QL+I+RP TAIG Y ++      E  K GIYE F L DIN   MKK+ DLLEDLS  R
Sbjct: 66  MSQLVITRPGTAIGCYFYYCNR---EDAKEGIYELFPLRDINATFMKKLNDLLEDLSSGR 122

Query: 126 KKLEDIFKFDNS---RPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIES 182
             L D F F  +   +  +L  +F  + + FL  + +   K  + K+VFLFT+ DKP E+
Sbjct: 123 ISLYDYFMFQQTGSEKQVRLSVLFTFMLDTFL--EEIPGQKQLSNKRVFLFTDIDKPQEA 180

Query: 183 ENNETRKKLRRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDY 242
           ++ + R +LRR+  DL ++++ F+TFFI   D  FD+ FYSDIL+L              
Sbjct: 181 QDIDERARLRRLTIDLFDNKVNFATFFIGYADKPFDNEFYSDILQL-------------- 226

Query: 243 YDDAGENGNHYLLINDLXXXXXXXXXXRKINPSL-RRFCRPNTKPIEASNIKQRILRKQE 301
               G + N                     N  L   F  P+TKPI+A  IK RILRK+E
Sbjct: 227 ----GSHTNE--------------------NTGLDSEFDGPSTKPIDAKYIKSRILRKKE 262

Query: 302 IRRVRFQCPLILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPN 361
           ++R+ FQCPLILDE +NFI+G+ GY +++ EK G RYKLVYEHE++R+EA+S+RKFL+P 
Sbjct: 263 VKRIMFQCPLILDEKTNFIVGVKGYTMYTHEKAGVRYKLVYEHEDIRQEAYSKRKFLNPI 322

Query: 362 TGEELKDEDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNI 421
           TGE++  +   KVY YGD++I LSD   Q +   Y +   F+K++GFRS   S+ Y+NNI
Sbjct: 323 TGEDVTGKTV-KVYPYGDLDINLSDSQDQIVMEAYTQKDAFLKIIGFRSSSKSIHYFNNI 381

Query: 422 DKASFVVPDESSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHN 481
           DK+SF+VPDE+ YEGSI+T+ASL + L KK K+AI+WG   S  HP+++ LSPS+  ++N
Sbjct: 382 DKSSFIVPDEAKYEGSIRTLASLLKILRKKDKIAILWGKLKSNSHPSLYTLSPSSVKDYN 441

Query: 482 EGLYLFQVPFLDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYR 541
           EG YL++VPFLDEIR+FP+L SY  G+   + +Y+ MKK+T+ I+G  +LR GY PS ++
Sbjct: 442 EGFYLYRVPFLDEIRKFPSLLSYDDGSEHKL-DYDNMKKVTQSIMGYFNLRDGYNPSDFK 500

Query: 542 NPALQKYYKILHDYLLQIEDT-SLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPE 600
           NP LQK+YK+LHDYLLQIE T    +TP    +R + EDD+L +L  +R +I++S ++ +
Sbjct: 501 NPLLQKHYKVLHDYLLQIETTFDENETPNTKKDRMMREDDSLRKLYYIRNKILESEKSED 560

Query: 601 LYNQRLSKFIEHWNRVFKKINED 623
              QRL+K+++ WN  +KK N+D
Sbjct: 561 PIIQRLNKYVKIWNMFYKKFNDD 583

>KAFR0L01950 Chr12 (368933..370699) [1767 bp, 588 aa] {ON} Anc_8.849
           YMR284W
          Length = 588

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/634 (45%), Positives = 400/634 (63%), Gaps = 54/634 (8%)

Query: 15  NDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRP 74
           N+  +NASYKKF  HE +IF VELS  MFE +PEL  K QL+EILESL +L  QLI+ RP
Sbjct: 9   NEDDQNASYKKFESHEAMIFSVELSDGMFETVPEL-NKIQLIEILESLEELMSQLIVVRP 67

Query: 75  NTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKF 134
           N AIG Y FH+     E N +GIYEFF LSDIN K MKK++DLLEDL  DR  L D F++
Sbjct: 68  NAAIGCY-FHYCGK--EGNDYGIYEFFPLSDINAKNMKKLSDLLEDLRLDRINLIDFFQY 124

Query: 135 DNSRPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRM 194
           +N++ T +E +F     QF     +   + +  +++FLFT+ND PI+ E+ E +  LR++
Sbjct: 125 NNAKKTSMEKLFTFYLNQFSM--EVAGQRKYTFQRIFLFTDNDSPIDKEDKEAKSILRKI 182

Query: 195 VNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYL 254
           V+DL+ES + F  FFI +PD+ F+   YS+ILKL    D+S       YD          
Sbjct: 183 VDDLDESHVNFVPFFIGRPDAPFNSALYSEILKLGARKDSS-----TEYDG--------- 228

Query: 255 LINDLXXXXXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPLILD 314
                                      PNT PI+AS IK ++LRK+EI+RV F+CPLIL+
Sbjct: 229 ---------------------------PNTTPIQASYIKSKVLRKREIKRVAFRCPLILN 261

Query: 315 EASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDFQKV 374
           E  NFI+G+ GY   S EK  TRYKLVYE+EN+R+EAFSRRKFL   T EE+K ++  K+
Sbjct: 262 EKKNFIVGLRGYIFVSHEKVATRYKLVYEYENLRQEAFSRRKFLSSETAEEIKGKELTKI 321

Query: 375 YKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESSY 434
           +  GD++IE+ +     ++    + R F+K++GFRS    +KY NNIDK  FVVPDE  Y
Sbjct: 322 FTLGDLDIEVDERRFFEVEKADDDVRSFLKVVGFRSIKSCVKYINNIDKVMFVVPDEMQY 381

Query: 435 EGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPFLDE 494
             SIK + SLF+TL  K K AI+WG   +  +P++ +L PS E + NEG YL +VPFLDE
Sbjct: 382 VNSIKILTSLFKTLRTKGKAAIIWGKLKANSNPSLFVLEPSGEKDPNEGFYLHRVPFLDE 441

Query: 495 IRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQKYYKILHD 554
           IR+ P + +Y  G  +N S+YE + K+TEYI+   +L+ GY P   +NP +QKY+KILHD
Sbjct: 442 IRKLPTMITYECG--ENTSDYENLIKVTEYIMAYFNLKGGYNPMDLKNPCIQKYFKILHD 499

Query: 555 YLLQIEDTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQRLSKFIEHWN 614
           YLLQIED +  ++  E  +R + EDDTL ++  +R++II SS++ +   Q+LSK+I+ WN
Sbjct: 500 YLLQIEDKTSDESSTERKQRLLREDDTLRKVSHIREKIISSSRSEDAGAQKLSKYIKVWN 559

Query: 615 RVFKKINEDAQMDIEPTPVTLKKRKQKEKLALNL 648
             + KI E   + +EP+    K +K+K    LNL
Sbjct: 560 NFYAKI-EKESVSLEPS----KTKKRKPAPTLNL 588

>TDEL0B00180 Chr2 (35263..37011) [1749 bp, 582 aa] {ON} Anc_8.849
           YMR284W
          Length = 582

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/617 (45%), Positives = 395/617 (64%), Gaps = 52/617 (8%)

Query: 22  SYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRPNTAIGFY 81
            Y+++ IHEGIIFC+ELS+ MF+ LPEL  K QL+EILE+L  L  QL+I+RP+T IG Y
Sbjct: 15  GYRRYDIHEGIIFCIELSNGMFDELPELNYKIQLIEILETLDQLMSQLVITRPSTGIGCY 74

Query: 82  LFH-HTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKFDNSRPT 140
            F+ + SD+    K GIY F  L D+N +TMKK++DLLEDL ++R  L     +D S+ T
Sbjct: 75  FFNCNRSDA----KDGIYPFLPLKDVNAQTMKKLSDLLEDLQYERTTLRQFLPYDASKHT 130

Query: 141 KLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRMVNDLNE 200
            LE +  +V+E+F+    +   K FN KK+F FT+ND P E+ + + + +LR +VNDL++
Sbjct: 131 PLESLLELVREEFVK--DVPDQKAFNNKKIFYFTDNDSPPEASDIDAKSRLRHLVNDLDD 188

Query: 201 SEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYLLINDLX 260
             I F+TFFI KP   FD+ FYSDIL+L      S+                        
Sbjct: 189 RFINFTTFFIGKPGLPFDEGFYSDILRLGATTKASD------------------------ 224

Query: 261 XXXXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPLILDEASNFI 320
                             F  PNT PI A+ IK R+LRKQEI+R+ FQCPLIL+E S FI
Sbjct: 225 -----------------EFDGPNTTPISAAYIKSRVLRKQEIKRIMFQCPLILEEKSKFI 267

Query: 321 IGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDFQKVYKYGDI 380
           +G+ GY I S EKPG RYKLVYE+E++R+EAFSRRK+L+  TGEE+KD    KVY YGD+
Sbjct: 268 VGVKGYTIISHEKPGVRYKLVYENEDIRQEAFSRRKYLNAKTGEEIKD-GLTKVYPYGDL 326

Query: 381 NIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESSYEGSIKT 440
           +IELS+     I+N+Y     F+K++GF+S +  L YYNNI+KA+FVVPDE  YEGSI+T
Sbjct: 327 DIELSESDIAEIRNDYAGEESFLKVIGFQSTETCLHYYNNIEKATFVVPDEGRYEGSIRT 386

Query: 441 MASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPFLDEIRRFPA 500
           ++SLF+ L +K KVAIVWG   S  +P I    PS+E   NEG YL++VPFLDE+RR P 
Sbjct: 387 LSSLFKNLRQKNKVAIVWGKLKSNSNPAIFFFVPSDEASPNEGFYLYRVPFLDELRRIPP 446

Query: 501 LTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQKYYKILHDYLLQIE 560
           +   S G  ++  +YE +K+ T+ ++   +L+ G+ PS ++NP LQK++KILHDYLLQIE
Sbjct: 447 ML-ISHGEIQD-DDYENLKEATKKLINHFNLKNGFEPSEFKNPGLQKHFKILHDYLLQIE 504

Query: 561 DTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQRLSKFIEHWNRVFKKI 620
           +    D  +    + + EDD+L R+ ++R +I +S+ + +   Q+LSK++  WN ++ KI
Sbjct: 505 EEPEKDDVEWQRSKLLEEDDSLRRISQIRDKIDESANSKDPNKQKLSKYLAIWNSLYDKI 564

Query: 621 NEDAQMDIEPTPVTLKK 637
             D +  I   P T KK
Sbjct: 565 F-DQETAIADAPKTKKK 580

>ZYRO0C14850g Chr3 (1154196..1155980) [1785 bp, 594 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 594

 Score =  526 bits (1356), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 272/627 (43%), Positives = 397/627 (63%), Gaps = 48/627 (7%)

Query: 14  DNDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISR 73
           D   +++ SY+K+ +HEGIIFC+ELS+ MF+ L EL  K QL+EILE+L  L  QL+I R
Sbjct: 15  DKQHTQSKSYRKYEVHEGIIFCIELSAGMFQELSELNYKVQLVEILETLEQLMSQLVIVR 74

Query: 74  PNTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFK 133
           P T IG Y ++   D  + +   IYEFF L DIN K+MKK++DLL+DL++DR  L+    
Sbjct: 75  PGTGIGCYFYNCNKDDAKNH---IYEFFPLRDINAKSMKKLSDLLDDLANDRITLQKFLP 131

Query: 134 FDNSRPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRR 193
           +D S  T L+ ++  +Q++FL    +   K FN KKVFLFT+ND P E+E+NET+ +LR 
Sbjct: 132 YDESERTPLDFLYGFIQDEFLK--EVEGQKAFNNKKVFLFTDNDSPPEAEDNETKSRLRH 189

Query: 194 MVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHY 253
           +V+D+++  I F+TFFI K ++ FDD+FYSD+LKL                   E+ N  
Sbjct: 190 LVDDMDDHFINFTTFFIGKEEAPFDDSFYSDVLKLGA---------------TAEDPN-- 232

Query: 254 LLINDLXXXXXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPLIL 313
                                    F  PNT PI AS IK R+LRKQE++R+ FQC LIL
Sbjct: 233 -----------------------TEFDGPNTTPISASYIKSRVLRKQEVKRIMFQCCLIL 269

Query: 314 DEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDFQK 373
           +E   F++GI GY I   E+PG RY+LVYE + VRKEA S+RKFLD NTGE + +E   K
Sbjct: 270 EERMQFMVGIKGYTIIIQERPGQRYRLVYEKDEVRKEANSKRKFLDSNTGEVI-EEGLTK 328

Query: 374 VYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESS 433
           V+ YGD++I ++DE    ++  Y E   F+K++GFR  +  + Y+NNID+A FVVPDE  
Sbjct: 329 VFPYGDLDITITDEELNEVRKSYTEEESFLKIIGFRDYNKCIHYFNNIDRALFVVPDEFR 388

Query: 434 YEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPFLD 493
           +EGSI+T+ASLF+ L  K KVA+VWG   +  HP + +LSPS   + NEG YL+++PF +
Sbjct: 389 FEGSIRTLASLFKNLRAKGKVAVVWGKLKTNSHPAVFVLSPSRNEDPNEGFYLYRIPFAE 448

Query: 494 EIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQKYYKILH 553
           E+RRFP   S     + +  EY ++K  T+ I+      KGYRPS +RNP LQK++KILH
Sbjct: 449 ELRRFPQ--SLIRHNSYDTPEYNQLKDTTKSIIDHFQFAKGYRPSEFRNPDLQKHFKILH 506

Query: 554 DYLLQIEDTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQRLSKFIEHW 613
           DYLLQ+E     D+P+   +R + EDD+L +L ++R +I+ S+Q+ +    +L ++ + W
Sbjct: 507 DYLLQVEQEEEDDSPESSKQRLLSEDDSLLKLAQIRDKIMDSAQSSDPKKFQLDEYFQLW 566

Query: 614 NRVFKKINEDAQMDIEPTPVTLKKRKQ 640
           NR+++ +++   ++  P P   + RK+
Sbjct: 567 NRLYEDVSKATTLEDAPRPKPKQPRKK 593

>Skud_13.457 Chr13 (811730..813538) [1809 bp, 602 aa] {ON} YMR284W
           (REAL)
          Length = 602

 Score =  521 bits (1343), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 278/628 (44%), Positives = 400/628 (63%), Gaps = 48/628 (7%)

Query: 1   MSFFSNNSNHLMDDNDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILE 60
           M   SN    + + ND   +A Y+KF IHEGI+FCVELS  MF+   EL  KS LLEILE
Sbjct: 1   MQASSNAFGGIGELNDVMDDAGYRKFDIHEGILFCVELSETMFKESQELDYKSPLLEILE 60

Query: 61  SLSDLFEQLIISRPNTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLED 120
           SL++L  QL+I+RP TAIG Y ++ + D  ++   GI+EF  L DIN   MK++ DLLED
Sbjct: 61  SLNELMSQLVITRPGTAIGCYFYYCSRDDAKQ---GIFEFSPLRDINATFMKRLNDLLED 117

Query: 121 LSHDRKKLEDIFKF---DNSRPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNND 177
           LS  R  L + F F   +  R   L  +F  + + FL    +   +  + KKVFLFT+ND
Sbjct: 118 LSSGRMTLYEYFNFQPTEKQRQMPLGVLFTFMLDTFLQ--DIPGQRQLSSKKVFLFTDND 175

Query: 178 KPIESENNETRKKLRRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEI 237
            P E+++ + R +LR +  DL ++++ FSTFFI   +  FD+ FYSDIL+L         
Sbjct: 176 IPQEAQDTDDRARLRSLTIDLFDNKVNFSTFFIGYANKSFDNEFYSDILQL--------- 226

Query: 238 DVEDYYDDAGENGNHYLLINDLXXXXXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRIL 297
                    G + N  + +N                     F  PNTKPI A  IK +IL
Sbjct: 227 ---------GSHTNKGVGLNS-------------------EFDGPNTKPINAKYIKSKIL 258

Query: 298 RKQEIRRVRFQCPLILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKF 357
           RK+EI+R+ FQCPL+  E  +F +G+ GY ++S EK G RYKLVYEHE+VR+EAFS+RKF
Sbjct: 259 RKKEIKRIMFQCPLMFGENEDFTVGVKGYTMYSHEKAGVRYKLVYEHEDVRREAFSKRKF 318

Query: 358 LDPNTGEELKDEDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKY 417
           L+P TGE++      KVY YGD++I  S+   Q +   Y +   F++++GFRS   ++ Y
Sbjct: 319 LNPMTGEDVTSSTV-KVYPYGDLDINFSENQNQIVMEAYTQKDAFLRIIGFRSSSKAIHY 377

Query: 418 YNNIDKASFVVPDESSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNE 477
           +NNI+K++F+VPDE+ YEGS++T+ SLF+TL KK K+AI+WG   +  H ++ +LSPS+ 
Sbjct: 378 FNNIEKSAFIVPDEAKYEGSVRTLTSLFKTLRKKDKIAILWGKLKTNSHASLFVLSPSSI 437

Query: 478 NEHNEGLYLFQVPFLDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRP 537
            E+NEG YL++VPFLDEIR+FP+L SY  G    + +YE MKK+T+ I+G  +L+ GY P
Sbjct: 438 KEYNEGFYLYRVPFLDEIRKFPSLLSYDNGEKYKL-DYENMKKITQNIMGYFNLKDGYNP 496

Query: 538 SSYRNPALQKYYKILHDYLLQIEDT-SLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSS 596
           S +RNP+LQK++K+LHDYLLQIE T    +TP   L R ++EDD+L +L  +R +I+ S 
Sbjct: 497 SDFRNPSLQKHFKVLHDYLLQIETTPEGNETPDAKLNRIIHEDDSLRKLYHIRNKILDSE 556

Query: 597 QAPELYNQRLSKFIEHWNRVFKKINEDA 624
           ++ +   QRL+K+++ WN  + K N+D+
Sbjct: 557 KSEDPAIQRLNKYVKIWNVFYNKFNDDS 584

>NDAI0K00360 Chr11 (76452..78314) [1863 bp, 620 aa] {ON} Anc_8.849
          Length = 620

 Score =  521 bits (1342), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 289/644 (44%), Positives = 411/644 (63%), Gaps = 54/644 (8%)

Query: 17  ASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRPNT 76
            + +ASYKK+ IHEGIIFC+ELS EMF+ +PEL    QLLEILESL +L   L+I RP+T
Sbjct: 19  TAPSASYKKYDIHEGIIFCIELSKEMFQEVPELNYTVQLLEILESLLELMSHLVIIRPST 78

Query: 77  AIGFYLFH------HTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLED 130
            +G Y+ +      + ++   K+  GIYE F L D+N   MKK++DL EDL H+R  L  
Sbjct: 79  GVGCYIHYCNKPDNNATEVNAKHIDGIYELFPLRDVNAHDMKKLSDLFEDLQHERITLMK 138

Query: 131 IFKFDNS----RPTKLEDIFNVVQEQF--LNFDSLHHSKGFNIKKVFLFTNNDKPIESEN 184
            F+FDN     +   LE +F  + ++F   N D       ++ +K+FLFT+ND PIESE 
Sbjct: 139 YFQFDNDENFKKQVPLEKLFGFLLDKFTLANVDR----NSYHSRKIFLFTDNDSPIESEE 194

Query: 185 NETRKKLRRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYD 244
           +E + ++RR+V+D+N++ I F+TFFI  PD  FDD+FYSD+LKL     T E   +DY D
Sbjct: 195 HEAKLRIRRLVDDMNDNYINFTTFFIGTPDRPFDDSFYSDVLKL--GAKTRETSDQDYID 252

Query: 245 DAGENGNHYLLINDLXXXXXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRR 304
                                      ++     F  PNTKPI A  IK RILRK+EI+R
Sbjct: 253 --------------------------AVDDEYSEFDGPNTKPIPAKYIKSRILRKKEIKR 286

Query: 305 VRFQCPLILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGE 364
           + FQ PLIL+E + FIIGI GY ++S EKP TRYKLVYE ENVRKEAFS RK+L+PNTGE
Sbjct: 287 ITFQSPLILNEDAEFIIGIRGYMLYSHEKPNTRYKLVYEQENVRKEAFSSRKYLNPNTGE 346

Query: 365 ELKDEDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKA 424
           EL+++++ K++ YGD+NIEL+D+    ++ E      F+K++GFRSK+  L Y+NNI   
Sbjct: 347 ELQNDEYVKIFPYGDMNIELNDKEVYKVEEEISCPEAFLKIIGFRSKNQCLYYFNNITAT 406

Query: 425 SFVVPDESSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGL 484
           +FVVPDES YEGSI+TMASLFRTL KK KVAI+WG   +   P +++L P++ ++ NEG 
Sbjct: 407 TFVVPDESQYEGSIRTMASLFRTLKKKDKVAIIWGKMKTNSKPCLYLLCPTSNSDRNEGF 466

Query: 485 YLFQVPFLDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPA 544
           YL+++PFL+EIR+FP L  Y   ++    +Y  + K+T  I+    LR GY PS + NP+
Sbjct: 467 YLYRMPFLEEIRKFPKLLDYKDRSSN--PDYTNLIKITSKIVEYFHLRNGYIPSEFENPS 524

Query: 545 LQKYYKILHDYLLQIEDTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQ 604
           LQ++Y++LHDYLLQ+E +      Q  +++ + EDDTL ++ ++R +I+ S ++ +   Q
Sbjct: 525 LQRFYRVLHDYLLQVEQSMAEGDEQHQIQKLLEEDDTLRKISQIRDKILSSKKSDDPTQQ 584

Query: 605 RLSKFIEHWNRVFKKINEDAQMDIEPTPVTLKKRKQKEKLALNL 648
           RL K++  WN  + K+ E+  +   P        K+K K  LNL
Sbjct: 585 RLDKYMNLWNTYYVKLQEENSLSNPP--------KKKSKPTLNL 620

>SAKL0D01188g Chr4 complement(87783..89528) [1746 bp, 581 aa] {ON}
           similar to uniprot|P32807 Saccharomyces cerevisiae
           YMR284W YKU70 Forms heterodimer with Yku80p known as Ku
           binds chromosome ends and is involved in maintaining
           normal telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 581

 Score =  511 bits (1315), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 280/614 (45%), Positives = 376/614 (61%), Gaps = 51/614 (8%)

Query: 6   NNSNHLMDDNDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDL 65
            +S+ +   N       YKK+ +H GI+FC+EL+S M+  + EL  K QL+EILESL++L
Sbjct: 2   GDSDRVDGSNYGDDQTVYKKYEVHGGIVFCIELTSTMYRKVTELNHKIQLVEILESLAEL 61

Query: 66  FEQLIISRPNTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDR 125
             QLI++ PNT +G Y F    D+ E    GIYEF  L D+N K MKK+ DLLEDL   R
Sbjct: 62  MSQLIVTSPNTGVGCYFFQCNKDNSEH---GIYEFLPLKDVNAKNMKKLNDLLEDLQFKR 118

Query: 126 KKLEDIFKFDNSRPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENN 185
             LE+ F F  S    LE +   ++EQF+    L + K +N  KVFLFT+N KP   EN 
Sbjct: 119 ATLEEKFPFVPSLDVSLESVLVFLREQFIK--ELPNRKAYNNGKVFLFTDNGKPNGYENL 176

Query: 186 ETRKKLRRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDD 245
           E+R  LR++VNDLN+  I F+ FFI+  +  FD +FYSDILKL    D         Y D
Sbjct: 177 ESRSGLRKIVNDLNDCYINFTPFFIDTEEKPFDQSFYSDILKLRAKTD---------YVD 227

Query: 246 AGENGNHYLLINDLXXXXXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRV 305
             E                              F  PNT PI AS IK R+ RK+E RRV
Sbjct: 228 GSE-----------------------------MFDGPNTTPIPASYIKSRVSRKKETRRV 258

Query: 306 RFQCPLILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEE 365
           +FQCPLILD+ +NF I I GY I S EKPGTRYKLVYE+E +RKEAFS R++LD +TG +
Sbjct: 259 KFQCPLILDDRNNFTISIKGYTIISHEKPGTRYKLVYENEQLRKEAFSHRRYLDASTGVD 318

Query: 366 LKDEDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKAS 425
           + D+   K++ YGD NIELS E    +         F+K++GFRS D  L YYNN+DK +
Sbjct: 319 VSDK-VAKIFPYGDENIELSQEDMAKLDKLDPNYNSFLKIIGFRSTDQCLFYYNNVDKTA 377

Query: 426 FVVPDESSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLY 485
           FVVPDE +YEGSI+ MASL+R L  K K A+VWG      +P I++++PS EN+ NEG Y
Sbjct: 378 FVVPDEYTYEGSIRAMASLYRNLRTKGKSAVVWGKLKINSNPGIYLMTPSTENDPNEGFY 437

Query: 486 LFQVPFLDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPAL 545
           L ++PF+DEIRRFP++  Y  G   +  +Y  M + TE I+   +LR GY+PS ++NP L
Sbjct: 438 LTRIPFIDEIRRFPSVPQY--GDVLSSQDYGHMCQATETIIAYFNLRNGYKPSEFKNPGL 495

Query: 546 QKYYKILHDYLLQIEDTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQR 605
           Q Y+ +LHD LL+ ++ S  D  QE L     +DDTL +L ++R +II+SS++ E   QR
Sbjct: 496 QHYFSLLHDQLLEAKEESSADEEQESL-----KDDTLLKLSQIRDKIIESSKSDEPGRQR 550

Query: 606 LSKFIEHWNRVFKK 619
           LSK+ + WN ++ K
Sbjct: 551 LSKYFKGWNTLYNK 564

>Kwal_27.10199 s27 (238096..239814) [1719 bp, 572 aa] {ON} YMR284W
           (YKU70) - DNA binding protein [contig 39] FULL
          Length = 572

 Score =  477 bits (1228), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 257/602 (42%), Positives = 371/602 (61%), Gaps = 57/602 (9%)

Query: 23  YKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRPNTAIGFYL 82
           Y+KF +HEGIIFC+ELS  MFE   ++  K QL+EILE+L +L  Q+IIS P T IG Y 
Sbjct: 10  YQKFEVHEGIIFCIELSKGMFEKSSDM-NKVQLVEILETLLELMSQVIISLPGTGIGCYF 68

Query: 83  FHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKFDNSRPTKL 142
           FH   ++      GIYE   L D+N ++MKK+ DLL+D++     LE  F  D    T L
Sbjct: 69  FHCGHENATG---GIYELLPLLDVNARSMKKLNDLLDDITAANTTLEKQFPLDEQLSTPL 125

Query: 143 EDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRMVNDLNESE 202
           E +F ++QEQFLN   +   K +N KK+FLFT+ND P E+ +++TR +LR++V+DL++  
Sbjct: 126 ETVFILLQEQFLN--QVPGQKAYNNKKIFLFTDNDSPKEAHDSDTRLRLRKVVDDLDDCH 183

Query: 203 IFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYLLINDLXXX 262
           I F+TFFI      FD +FYSDILKL      S+          G               
Sbjct: 184 INFTTFFIGTEQKPFDQSFYSDILKLGAKKTASQ---------GGST------------- 221

Query: 263 XXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPLILDEASNFIIG 322
                           F  P+T PI A+ IK R LRK+EI+R+RFQC L L+EA++F + 
Sbjct: 222 ----------------FNGPSTAPINANLIKARALRKKEIKRIRFQCFLELNEATDFKVS 265

Query: 323 ITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDFQKVYKYGDINI 382
           I GY + S E+ GT+YK VY+H  +RKE  S RK+L+ NTGE++ D    +V+++ +I+I
Sbjct: 266 IKGYTVVSHERTGTKYKQVYDHNGLRKEVISHRKYLNANTGEDVTDS-IARVFRFAEIDI 324

Query: 383 ELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESSYEGSIKTMA 442
           E S+E    I  +Y  N  F+KL+GFR     L +Y+NI  +SFVVPDES  EGSIKTM+
Sbjct: 325 EFSEEELAKISKDYSPNDSFLKLIGFRDTSKCLFFYDNIGNSSFVVPDESVLEGSIKTMS 384

Query: 443 SLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPFLDEIRRFPALT 502
           SLFR+L KK+K A+VWG   S  +P ++ILSPS   + NEG YL +VPF+DE+R+FP + 
Sbjct: 385 SLFRSLSKKQKSAVVWGKLKSNSNPAVYILSPSTSKDLNEGFYLTRVPFVDEVRKFPPIP 444

Query: 503 SYS---PGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQKYYKILHDYLLQI 559
            Y     G N     +E+M K+TE ++    LR+ Y+PS ++NP LQK++K+L+DYLLQ+
Sbjct: 445 RYDEELGGKN-----FEQMCKITETLISYFSLRRPYKPSDFKNPTLQKHFKLLYDYLLQV 499

Query: 560 EDTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQRLSKFIEHWNRVFKK 619
           E     D   E ++  +  DDTL +L ++R++I +S  + +   +RL  +++ WN ++ K
Sbjct: 500 E----VDCSSESVDGALKHDDTLLKLYQVRRKIQESLSSKDPEEERLGTYVKAWNSLYNK 555

Query: 620 IN 621
           I+
Sbjct: 556 IS 557

>TPHA0I00310 Chr9 (59576..61402) [1827 bp, 608 aa] {ON} Anc_8.849
           YMR284W
          Length = 608

 Score =  476 bits (1224), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 270/622 (43%), Positives = 390/622 (62%), Gaps = 63/622 (10%)

Query: 21  ASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRPNTAIGF 80
           ASY+K+  HEG +FC+ELS  MF  + +L  K QL+E+LESL +L  QL+I+RP+T +G 
Sbjct: 33  ASYRKYESHEGYMFCIELSEHMFSEISQLNYKVQLIEVLESLMELMSQLVITRPSTGVGC 92

Query: 81  YLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKFD--NSR 138
           + F+   D+ E  K  IYEF  L DINV  MKK+ DLL+D+  +R  + D FKFD  N +
Sbjct: 93  FFFN--CDNKESKK-RIYEFLPLRDINVSDMKKLHDLLDDVKEERLSIRDAFKFDEINDK 149

Query: 139 PTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRMVNDL 198
              LE +F ++Q++F N  ++   K +  KKVFLFT+NDKP ES + E   +LRR+ +D+
Sbjct: 150 GNSLESLFLLIQDRFSN--NIPGQKIYTNKKVFLFTDNDKPKESNDKEKTIRLRRLFDDI 207

Query: 199 NESEIFFSTFFINKPDSQ--FDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYLLI 256
           +++ I F TFFINK DS   FDD+FYSDILKL  N ++ E D                  
Sbjct: 208 SDNYIQFVTFFINKIDSSDNFDDSFYSDILKLR-NSNSIEFD------------------ 248

Query: 257 NDLXXXXXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPLILDEA 316
                                    P+TKPI  + IK ++LRK+EI+R+ FQCPLIL+  
Sbjct: 249 ------------------------GPSTKPISVAYIKNKVLRKKEIKRIMFQCPLILNAD 284

Query: 317 SNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDFQKVYK 376
           S+F + + GY I S EKPG+RYKLVYEHEN+R+EAFS+RK L+  TG  +  +D +K+++
Sbjct: 285 SDFQVNVKGYTIISHEKPGSRYKLVYEHENIRREAFSKRKLLNGKTGTVVTKDDTEKIFQ 344

Query: 377 YGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESSYEG 436
            G+ +I   +   +   +  +   PF+KL+GFRS + SL  +NNI KA F+VPDES   G
Sbjct: 345 LGNFSINSFENEFEKGNDNPLPQEPFLKLIGFRSPENSLHLFNNIGKALFIVPDESRCVG 404

Query: 437 SIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNEN-EHNEGLYLFQVPFLDEI 495
           SI+T++S++RT+  K + AIVWG   S  +P I ILSPS+   + NEG YL++VPFLDEI
Sbjct: 405 SIRTLSSMYRTMRTKNRNAIVWGKLKSNSNPNIWILSPSDPTKDQNEGFYLYKVPFLDEI 464

Query: 496 RRFPALTSYSPG----TNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQKYYKI 551
           R+ P+  ++ P      NK   +YE +K++T  ILG  +L  GY P  ++NP LQKYYK+
Sbjct: 465 RKIPSQYTHFPSDELIRNK---DYENLKRVTRNILGYFNLTNGYSPLEFKNPLLQKYYKL 521

Query: 552 LHDYLLQIEDTSLTDTPQEVLEREVY-EDDTLYRLDKLRKRIIQSSQAPELYNQRLSKFI 610
           LHDYLLQ+E    T+  +E L++++  EDDT+ +   +R +II+S+ + E + QRLS   
Sbjct: 522 LHDYLLQVETVPETEMSKEQLKQKILEEDDTIRKTFSIRDKIIKSASSTESHKQRLSANF 581

Query: 611 EHWNRVFKKI--NEDAQMDIEP 630
             WN ++ K+  NE A  +++P
Sbjct: 582 NIWNDIYSKLEGNEIAVKEMKP 603

>KNAG0M02650 Chr13 complement(490275..491999) [1725 bp, 574 aa] {ON}
           
          Length = 574

 Score =  473 bits (1218), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 257/612 (41%), Positives = 370/612 (60%), Gaps = 60/612 (9%)

Query: 22  SYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRPNTAIGFY 81
            YKK+  HEGI+FC+EL+  +FE +  L+G+S LLEIL SL +L  QL+I RP +++G  
Sbjct: 15  GYKKYDTHEGILFCIELTGTLFEPVESLQGRSNLLEILYSLKELMYQLVIVRPGSSVGC- 73

Query: 82  LFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKFDNSRPTK 141
           +FH+T   +     G+YEF  L D+N K MK ++D LED+   R  +   FKFD S+   
Sbjct: 74  IFHYTD--INGAVDGVYEFLPLRDVNAKDMKTLSDFLEDIEEKRINIFQYFKFDGSKHVS 131

Query: 142 LEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRMVNDLNES 201
           LE +F ++ E++   +     K F  K+ FLFT+ND P ES + E  +++ ++V+DL+E+
Sbjct: 132 LERLFQLIGEKYS--EEREDGKKFTHKRAFLFTDNDAPPESNDTEATRRISKIVDDLDET 189

Query: 202 EIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYLLINDLXX 261
            + F+TFFI   ++ FD+ FYS++LKL      S+ D                       
Sbjct: 190 AVSFTTFFIGSEEAPFDNRFYSNVLKLGAQLKHSDYD----------------------- 226

Query: 262 XXXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPLILDEASNFII 321
                               P+ +PI  S+IK RILR +EI+R  FQCPL L++ SNFII
Sbjct: 227 -------------------GPSVRPITGSDIKARILRGKEIKRTMFQCPLYLNKDSNFII 267

Query: 322 GITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDFQKVYKYGDIN 381
           GI GY I + EK GTRYKL YE E++R+EAFS+RK+L+  TGEE+  +D  KV  YGD+N
Sbjct: 268 GIRGYAIVTHEKYGTRYKLTYEKEDIRQEAFSKRKYLNSKTGEEVDPKDISKVIPYGDVN 327

Query: 382 IELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESSYEGSIKTM 441
           IELS EA Q ++  Y E  PFMK+LGFRS D+ +KY+NNIDK SF+VPDE  YEGSIKT+
Sbjct: 328 IELSAEALQQMRASYEEEGPFMKVLGFRSTDLCVKYFNNIDKPSFIVPDELQYEGSIKTL 387

Query: 442 ASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPFLDEIRRFPAL 501
           ASLFRTL  K K AI+WG   S  +  ++I+ PS+  + N+G Y+ ++PFLDE+R+ P  
Sbjct: 388 ASLFRTLRSKNKSAIIWGKPKSNSNSALYIMVPSHREDRNDGFYMHRIPFLDELRKVPIK 447

Query: 502 TSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQKYYKILHDYLLQIED 561
              +  T  +      +  +TE IL   +LR+GY PS ++NP +Q YYK+LHDY+LQ+E+
Sbjct: 448 MVDNDWTQLD----NDLLTVTETILKYFNLRQGYIPSEFKNPGIQNYYKVLHDYILQVEE 503

Query: 562 T--SLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQRLSKFIEHWNRVFKK 619
                 D  QE L R   +DDTL ++  +R +I  S+ +    ++ LS ++  WN  +K 
Sbjct: 504 IKHEGWDFSQEELLR---QDDTLKKISHIRGKIEASNDS----DKVLSGYMNMWNLFYKS 556

Query: 620 INEDAQMDIEPT 631
           +  +     EP 
Sbjct: 557 LETNNVKWSEPV 568

>KLTH0C03586g Chr3 (311969..313705) [1737 bp, 578 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 578

 Score =  467 bits (1202), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 264/619 (42%), Positives = 390/619 (63%), Gaps = 54/619 (8%)

Query: 21  ASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRPNTAIGF 80
           + YKKF +HEGIIFCVELS  MF+   +L  K QLLEILE+L +L  Q+II  P T IG 
Sbjct: 14  SKYKKFEVHEGIIFCVELSEAMFKEPFDL-NKVQLLEILETLLELMTQVIIILPGTGIGC 72

Query: 81  YLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKFDNSRPT 140
           + F     S E  K GIYEF  L D+N ++MKK+ DLL+DL  +   L + F F++ + T
Sbjct: 73  FFFQC---SHEGAKGGIYEFLPLLDVNARSMKKLNDLLDDLKMNITTLNEQFPFNDKQNT 129

Query: 141 KLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRMVNDLNE 200
            LE +F ++QEQF    S+   K +N KK+FLFT+ND+P ES++ E + +LR++++DL++
Sbjct: 130 SLEAVFVLLQEQFSR--SVQGQKAYNNKKIFLFTDNDRPKESDDREAKNRLRKVIDDLDD 187

Query: 201 SEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYLLINDLX 260
           S I    FF+      FD +FYSDILKL                                
Sbjct: 188 SFINIIPFFVGSEQRPFDQSFYSDILKL-------------------------------- 215

Query: 261 XXXXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPLILDEASNFI 320
                    +K +    ++  PNT PI A  IK R+LRK+EI+RVRFQC LIL+EAS+F 
Sbjct: 216 ------GAKKKASDGPFKYEGPNTTPISAKLIKSRVLRKKEIKRVRFQCSLILNEASDFQ 269

Query: 321 IGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDFQKVYKYGDI 380
           + I GY   S E+ G++YK VY+H+ +RKEA S RK+LD NTGE++  E   KV+K+ ++
Sbjct: 270 VSIKGYTTISHERAGSKYKQVYDHDGLRKEALSHRKYLDANTGEDVT-ERVVKVFKFAEV 328

Query: 381 NIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESSYEGSIKT 440
           +IELS++    +  +Y     F+KL+GFR  +  + Y+NNI  +SFVVPD+S ++GSIKT
Sbjct: 329 DIELSEDEIAKMNRDYSSYDSFLKLVGFRDTNRCVFYFNNISNSSFVVPDDSVFKGSIKT 388

Query: 441 MASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPFLDEIRRFPA 500
           MASLFR L +K+K A+VWG   S  +P+++ L+PSN N+HNEG YL +VPF+DEIR+FP 
Sbjct: 389 MASLFRKLREKQKSAVVWGKLKSNSNPSLYTLTPSNFNDHNEGFYLTRVPFIDEIRKFPP 448

Query: 501 LTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQKYYKILHDYLLQIE 560
            T+Y    +K  + +E+M K+TE ++    LR  YRPS + NP LQK++++LHDYLLQ+E
Sbjct: 449 -TAYHGNLSKTKT-FEQMCKITETLISYFSLRHSYRPSDFENPTLQKHFELLHDYLLQVE 506

Query: 561 DTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQRLSKFIEHWNRVFKKI 620
               + + + +L++    DDTL +L ++R +I++S+++ +    RLS +++ WN ++   
Sbjct: 507 VDPTSGSKEHLLKK----DDTLLKLHQVRAKILESAESDDPVQARLSNYVKAWNSMY--- 559

Query: 621 NEDAQMDIEPTPVTLKKRK 639
           N +   D+EP   + K +K
Sbjct: 560 NRELNGDLEPETTSKKSKK 578

>CAGL0I02662g Chr9 (237396..239216) [1821 bp, 606 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284w HDF1
           high-affinity DNA-binding protein
          Length = 606

 Score =  465 bits (1196), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 260/640 (40%), Positives = 394/640 (61%), Gaps = 60/640 (9%)

Query: 13  DDNDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIIS 72
           +D + ++ AS+K+F IHEGI+FC+ELS  MFE   EL GKSQ+  IL SLS+L E LI++
Sbjct: 21  EDGEVNKQASFKRFEIHEGIMFCIELSEHMFEVQDELDGKSQIEVILTSLSELMELLIVT 80

Query: 73  RPNTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIF 132
           RP+TAIG Y ++      E +K  I+EF  L D+NV+ MKKV DLLED+S+ R   ++  
Sbjct: 81  RPSTAIGCYFYNCER---EDSKESIFEFIPLVDLNVQWMKKVNDLLEDVSNQRITFKEYL 137

Query: 133 KFDNSR------PTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNE 186
            ++  +      P  LE +F+++ E F    ++   K FN KKVFLFT+ND P       
Sbjct: 138 NYNIDQNKKLNIPILLEKLFSLILETFNR--NIEGQKEFNSKKVFLFTDNDLPNVESQQR 195

Query: 187 TRKKLRRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDA 246
           +   L+ ++ D++++ I F+ FFI+K D  F+  FYS +L+   ND          Y+  
Sbjct: 196 SIDVLKGILKDIDDNMINFTNFFISKKDKPFNPAFYSKVLR---NDRD--------YNSL 244

Query: 247 GENGNHYLLINDLXXXXXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVR 306
           G                               +  P+TKPI  ++IK+RI +++EIRRV 
Sbjct: 245 GSQA----------------------------YFGPSTKPIGVNDIKERIFQRKEIRRVV 276

Query: 307 FQCPLILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEEL 366
           FQCPL+LDE +NF+I I GY+IF+ EK   RYKLVYE++ +RKEAFS+RKF++P TGE++
Sbjct: 277 FQCPLVLDEGTNFVISIKGYSIFNHEKGSVRYKLVYENQEIRKEAFSKRKFINPKTGEDV 336

Query: 367 KDEDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASF 426
             +   K+  YG+  IE+ D+   N  N Y      + ++GF ++D SL +YNNIDK  F
Sbjct: 337 SKQTV-KIIPYGEKEIEMEDKNIANALNVYGNTSASLTVIGFLNEDNSLVFYNNIDKTLF 395

Query: 427 VVPDESSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYL 486
           + PDE+  EGS    ASLFRTL K KKV +VWG + S   P++++L PS ++++N+G YL
Sbjct: 396 ITPDENVIEGSFTAFASLFRTLKKLKKVGVVWGSTKSNSSPSLYLLWPSKDDDNNQGFYL 455

Query: 487 FQVPFLDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQ 546
            +VPF+DEIR++P L++ +   N+   EY+ +K+LT+ I+   +L+ GY    +RNPAL 
Sbjct: 456 TKVPFIDEIRKYPTLSNIN--INEEWEEYKNVKELTQGIISHFNLKSGYHAEEFRNPALN 513

Query: 547 KYYKILHDYLLQIEDTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQRL 606
           ++YK+LHDYLLQ+E   +     ++ +R + EDDTL ++ K+R+RI++ +   ++  +RL
Sbjct: 514 RHYKLLHDYLLQVE---IPQDDNDIRDRYLREDDTLLKITKIRERIMKDTTIDDVEKRRL 570

Query: 607 SKFIEHWNRVFKKINEDAQMDIEPTPVTLKKRKQKEKLAL 646
           SK++E WN  ++K  ED       T  +L K ++K KL L
Sbjct: 571 SKYLEVWNIYYRKFKEDTNQ----TSSSLLKSEKKPKLNL 606

>KLLA0C06226g Chr3 (550683..552461) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32807 Saccharomyces cerevisiae YMR284W YKU70
           Forms heterodimer with Yku80p known as Ku binds
           chromosome ends and is involved in maintaining normal
           telomere length and structure in addition to
           participating in the formation of silent chromatin at
           telomere-proximal genes
          Length = 592

 Score =  447 bits (1150), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 243/632 (38%), Positives = 388/632 (61%), Gaps = 59/632 (9%)

Query: 3   FFSNNSNHLMDDNDASRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESL 62
           F  +      DD+  S +  ++++  H+GI+FC++L+  M+ + P+L GK QLLEIL+SL
Sbjct: 8   FLKSQLTQTRDDDKESDHKKWRRYEAHDGIVFCIQLTPTMYLSNPDLGGKIQLLEILDSL 67

Query: 63  SDLFEQLIISRPNTAIGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLS 122
           +DL  QL++  P+TA+G Y+++ +  + E N   +YE   L D+N K MK+V+DLLED+ 
Sbjct: 68  NDLMSQLVVVMPSTAVGCYIYNCSHPNAEDN---VYELIPLRDVNYKNMKRVSDLLEDIE 124

Query: 123 HDRKKLED-IFKFDNSRPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIE 181
            DR  L+D I   D + P +L  +   V+E FL    +   K    KK+F FT++DKP E
Sbjct: 125 QDRILLKDEIPIADPNNPIELSPVLIKVRETFLQ--PIEGQKQLTNKKIFFFTDDDKPAE 182

Query: 182 SENNETRKKLRRMVNDLNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEI-DVE 240
             N ++R +LR++V+DL +  I F TFFI   D  FDD+ Y+DILK       S+I + +
Sbjct: 183 FLNVDSRSRLRKVVDDLYDYYINFVTFFIGSEDKPFDDSMYADILKW-----GSKINEAQ 237

Query: 241 DYYDDAGENGNHYLLINDLXXXXXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQ 300
            +    G                                  P+T PI AS IK ++ R +
Sbjct: 238 SWLSSHG----------------------------------PSTNPINASYIKSKVKRTK 263

Query: 301 EIRRVRFQCPLILDEASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDP 360
           EI+R++F+CPL+LDE ++ ++ + GY I S E PG++YKLVY + +VR+EA+S R++LD 
Sbjct: 264 EIKRIKFRCPLMLDERADLVVSVNGYTIVSHEIPGSKYKLVYANGSVRREAYSHREYLDA 323

Query: 361 NTGEELKDEDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNN 420
            TGE + +    KVY +GD  IEL+++    I++ Y E+  F+KL+GFRS +  L YY+N
Sbjct: 324 ETGEAVDNSQLSKVYTFGDEIIELTEDENLKIQSGYSEHESFLKLIGFRSTEQCLHYYDN 383

Query: 421 IDKASFVVPDESSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEH 480
           ID  +FVVP+E  Y GSIKT+ASL+RT+  KKK A+VWG       P++ +L+PS++ ++
Sbjct: 384 IDVPAFVVPNEEDYAGSIKTLASLYRTMLFKKKSAMVWGKLRPNSPPSMFVLTPSSKKDY 443

Query: 481 NEGLYLFQVPFLDEIRRFPALTSYSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSY 540
           N+G YL++VPF++E+R+ P   ++S     +  +Y+ M K+TE ++   +L+ GYRPS +
Sbjct: 444 NQGFYLYKVPFMEEVRKLPDFLNHSALIESD--DYKVMSKVTETLINFFNLKNGYRPSDF 501

Query: 541 RNPALQKYYKILHDYLLQIE-DTSLTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAP 599
            NPALQK++KIL +YLLQIE D S         + E   D+TL ++ ++  RI  S+++ 
Sbjct: 502 HNPALQKHFKILREYLLQIEVDKS---------KPEDEGDETLQKVKQIYARIASSAKSD 552

Query: 600 ELYNQRLSKFIEHWNRVFKKINEDAQMDIEPT 631
           ++  QRL K+++ WN  + +++ + ++D +PT
Sbjct: 553 DVKQQRLVKYLKLWNSFYNRLS-NLEVDTKPT 583

>Kpol_1068.1 s1068 complement(1..1542) [1542 bp, 514 aa] {ON}
           complement(1..1542) [1542 nt, 514 aa]
          Length = 514

 Score =  443 bits (1140), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 251/522 (48%), Positives = 339/522 (64%), Gaps = 44/522 (8%)

Query: 18  SRNASYKKFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRPNTA 77
            +  SY+K+ +HEGI+FCVELS +MF+ LPEL  K QLLEILESL +L  QL+I+RP T 
Sbjct: 36  GKRPSYRKYDVHEGIMFCVELSEQMFQQLPELNYKVQLLEILESLLELMSQLVITRPGTG 95

Query: 78  IGFYLFHHTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKFDNS 137
           +G Y+++   D+   N    + F  L D+NVK MKKV DLL+DLS++R  L   F +D +
Sbjct: 96  VGCYIYNCHKDNSNNNI---FNFIPLEDVNVKAMKKVNDLLDDLSNERTTLTKYFPYDKT 152

Query: 138 RPTKLEDIFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRMVND 197
           + T LE +  + Q++ +   ++   K FN KKVFLFT+ND P E+ +   + +LRR+ +D
Sbjct: 153 QRTPLESLLELTQDELVK--NVSTPKPFNNKKVFLFTDNDSPTEASDKAGKARLRRLFDD 210

Query: 198 LNESEIFFSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYLLIN 257
            NE+ I F  FFIN+ +  FD +FYSDI KL  N +    D E  +D             
Sbjct: 211 NNENFITFVPFFINRENKPFDSSFYSDIFKLG-NSENPSSDYEIEFDG------------ 257

Query: 258 DLXXXXXXXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPLILDEAS 317
                                   P+T+PI AS IK R+LRKQEI+RV FQC LIL++  
Sbjct: 258 ------------------------PSTRPISASYIKSRVLRKQEIKRVLFQCSLILNKEM 293

Query: 318 NFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDFQKVYKY 377
           NF + I GY+I S EK G+RYK+VYEHE+VRKEAFS+RK L+  T EE+K E   KV+ Y
Sbjct: 294 NFTVAIKGYSIVSQEKVGSRYKMVYEHEDVRKEAFSKRKILNCITAEEVK-EGLTKVFPY 352

Query: 378 GDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESSYEGS 437
           GD+NIELS+E  + +K  Y+E+ PF+KLLGFRS +ISL YYNNI K SFVVPDES  +GS
Sbjct: 353 GDLNIELSEEDIKKVKEAYLEDGPFLKLLGFRSLEISLHYYNNITKPSFVVPDESKIDGS 412

Query: 438 IKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPFLDEIRR 497
           I+ +ASLFRT+ KK KVA++WG      HP + +LS SN ++ NEG +L+++PFLDEIR+
Sbjct: 413 IRMLASLFRTMRKKNKVAVLWGKLKGNSHPGLWVLSASNASDPNEGFFLYRIPFLDEIRK 472

Query: 498 FPALTSYSPGTNK-NISEYEKMKKLTEYILGTLDLRKGYRPS 538
           FP +T+ S   N  N  EYE +K+ TE I+G  +L+ GY PS
Sbjct: 473 FPVITTSSFKENAMNTIEYENIKRTTENIVGYFNLKHGYIPS 514

>AFR443C Chr6 complement(1236336..1238066) [1731 bp, 576 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 576

 Score =  350 bits (897), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 226/617 (36%), Positives = 349/617 (56%), Gaps = 69/617 (11%)

Query: 25  KFHIHEGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRPNTAIGFYLFH 84
           ++++HEGI+FCVELS  M++  PEL+GK QLLEILE+L +L EQL+   P+T +G Y F 
Sbjct: 27  RYNVHEGIVFCVELSHNMYKPSPELEGKKQLLEILEALLELMEQLVAVMPDTGVGCYFFQ 86

Query: 85  HTSDSVEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKFDNSRPTKLED 144
                  + K GIYE F L D+NV  MKKV  LLE +   ++ LE+   +D   PT L+ 
Sbjct: 87  CRH---REAKQGIYELFPLRDVNVAHMKKVFLLLEGIRTGKRSLEEELPYDGRHPTSLDV 143

Query: 145 IFNVVQEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRMVNDLNESEIF 204
           +F  +Q+QFL    +   + +N KK+FLFT+ND P E E+  +R +LR++V+DLN+  I 
Sbjct: 144 VFTSIQDQFLQ--EVPEQRLYNNKKIFLFTDNDSPPEKESLGSRTRLRKVVDDLNDYYIN 201

Query: 205 FSTFFINKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYLLINDLXXXXX 264
           FSTFFI      FD++FYSDILKL      +E   +  YD                    
Sbjct: 202 FSTFFIGTEQRPFDESFYSDILKLGAQV-AAEGSSKPLYDG------------------- 241

Query: 265 XXXXXRKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPLILDEASNFIIGIT 324
                            P+TKPI  S I+ R+LRK+E+RR+R+ CPL L+E    ++ + 
Sbjct: 242 -----------------PSTKPISVSYIRSRVLRKKEVRRLRYSCPLFLNEEQGLVVSVK 284

Query: 325 GYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDFQKVYKYGDINIEL 384
           GY   + E+PG RY++VY+HE+V++EAFS R++LDP+TGEE   ED  KVY+ GD  ++L
Sbjct: 285 GYAATTYERPGARYRMVYQHEDVQREAFSHRRYLDPDTGEE-ATEDLCKVYQIGDDCLDL 343

Query: 385 SDEATQNIKN-EYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESSYEGSIKTMAS 443
            D+    I N     +  F+++LG R+    L YYNNI   +F+VPD+S Y GS   +AS
Sbjct: 344 PDDLENLITNFAAPTSDSFLRMLGSRTAVAVLPYYNNIHHVTFLVPDDSVYAGSAAVLAS 403

Query: 444 LFRTLHKKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPFLDEIRRFPALTS 503
           L RTL   ++  +++G   +   P ++ L+P+     +    L ++PF +E+R+FPAL+ 
Sbjct: 404 LHRTLRASQRAVVLYGKLRATSLPALYALAPAAAPLPDAVFILARLPFQEEVRKFPALS- 462

Query: 504 YSPGTNKNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQKYYKILHDYLLQIEDTS 563
             P  +    +Y  ++K+T  I+  L L   Y P+ ++NP +  ++++L D+L +     
Sbjct: 463 -PPQASLASPDYAVLQKITSRIIDLLVLSSPYAPADFKNPVIATHFRLLSDHLFETAQDP 521

Query: 564 LTDTPQEVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQRLSKFIEHWNRVFKKINED 623
            T             DDT+ RL +LR R++   ++      RL+K++ HWN  + +  + 
Sbjct: 522 RT-------------DDTIARLLRLRHRVLDDPES------RLAKYLRHWNAFYARHQQV 562

Query: 624 AQMDIEPTPVTLKKRKQ 640
           A     P+P    KR++
Sbjct: 563 AS----PSPTKYSKRRR 575

>Ecym_4620 Chr4 complement(1213899..1215692) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABL117C
          Length = 597

 Score =  315 bits (807), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 198/590 (33%), Positives = 322/590 (54%), Gaps = 53/590 (8%)

Query: 30  EGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRPNTAIGFYLFHHTSDS 89
           + II C+ELSS ++++  E+  K+QL E+LE+L +L +QL +  PN+ +  Y++     +
Sbjct: 22  QSIIVCIELSSRVYQS-SEISPKAQLAEMLEALLELMKQLAMLLPNSEVCCYVYQCRRLN 80

Query: 90  VEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKFDNSRPTKLEDIFNVV 149
           V   K GIYE   L  +NV+ + K++ LL D+ + +  L+D   F+    + L  +   +
Sbjct: 81  V---KDGIYELLPLEMVNVQKIHKISQLLSDIKNKKMFLKDEIPFEEIDGSPLSSVLAKI 137

Query: 150 QEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRMVNDLNESEIFFSTFF 209
           Q Q L   +    K F  K++ L T ND P E  + E +KK +  +N L +      TFF
Sbjct: 138 QHQ-LQGKTTDEWK-FRNKRIILITANDMPAEYFDAELQKKFKNTINALYDDSFSIVTFF 195

Query: 210 INKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYLLINDLXXXXXXXXXX 269
           I+     F+DTFY+D+LK     +  + +++ YYD                         
Sbjct: 196 IHSQTRPFNDTFYADLLKPLRRPEDLDKNIQ-YYDG------------------------ 230

Query: 270 RKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPLILDEASNFIIGITGYNIF 329
                       PNTKPIE   +K ++L+K+E  +  F+C  I+++ ++FII + G+   
Sbjct: 231 ------------PNTKPIEIKELKGKLLQKKEGNKFHFKCAFIINKQNDFIISLKGFFAI 278

Query: 330 SIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDFQKVYKYGDINIELSDEAT 389
           + EK G R+K +Y+     ++AFS RKF + N GE   D    KV+  G +NIE ++E  
Sbjct: 279 TQEKAGERFKYIYQKGAKPQDAFSHRKFYNANDGEA-ADSRLTKVFDIGGLNIEFTEEQD 337

Query: 390 QNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESSYEGSIKTMASLFRTLH 449
           Q + N + E+  F++L+GFRS D    YYNNI  +S+V+PD++ YEGS KT++ L+ ++ 
Sbjct: 338 QKMINSFSEHETFLELIGFRSVDKVNFYYNNISTSSYVIPDDNVYEGSSKTLSHLYASMT 397

Query: 450 KKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPFLDEIRRFPALTSYSPGTN 509
           KK K AIVWG  +   HP + ++   +    N+G YL ++PF++EIRRFP   +     +
Sbjct: 398 KKGKAAIVWGKLTRIAHPQLFLMVAMDRKNTNQGFYLVRLPFIEEIRRFP--QTLQKNRS 455

Query: 510 KNISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQKYYKILHDYLLQIEDTSLTDTPQ 569
            NI EY  MKK+T  I+   +L+  YR + + +P L+ +Y  L D LLQ    SL+D  Q
Sbjct: 456 VNIQEYALMKKITGNIIAFFNLKSSYRAAEFPSPVLKSFYTTLSDKLLQ---KSLSD--Q 510

Query: 570 EVLEREVYEDDTLYRLDKLRKRIIQSSQAPELYNQRLSKFIEHWNRVFKK 619
             +  ++  D TL ++  LR+ I +SSQ  E     L+K++++WN  + K
Sbjct: 511 WGMGFKLSNDITLGKVQHLRELINKSSQNME--QPILAKYMKYWNTYYNK 558

>ABL117C Chr2 complement(179060..180868) [1809 bp, 602 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR284W
           (YKU70)
          Length = 602

 Score =  242 bits (618), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 162/599 (27%), Positives = 297/599 (49%), Gaps = 74/599 (12%)

Query: 30  EGIIFCVELSSEMFENLPELKGKSQLLEILESLSDLFEQLIISRPNTAIGFYLFHHTSDS 89
           + I+ C+ELS  +      LKG + +LE++ +L  + E+LII +PN+A+G   F +    
Sbjct: 28  QNIVLCIELSQTLCSPAGSLKGNAPILEVVRALLHMVEELIIVQPNSAVGCLTFRNG--- 84

Query: 90  VEKNKFGIYEFFQLSDINVKTMKKVTDLLEDLSHDRKKLEDIFKFDNSRPTKLEDIFNVV 149
             + + GI E F L  ++   ++ ++D + DL  +   +   F F  + P  L D+    
Sbjct: 85  -RRAEDGIVEAFPLRPLDANYVRNISDCVADL-EETGMVGQHFPFTATVPASL-DVMLAA 141

Query: 150 QEQFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRMVNDLNESEIFFSTFF 209
            +++   D+ +        ++FL T+ D P+E  +    +K++  +  L    I  +TFF
Sbjct: 142 SDRYFTEDTQNADN-----RIFLVTDVDTPVEFTDPIRLEKVQARLLSLYRRRIDITTFF 196

Query: 210 INKPDSQFDDTFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYLLINDLXXXXXXXXXX 269
           ++   + F+D+ Y++ILK      T E  +                              
Sbjct: 197 LHTEHAAFNDSSYAEILK------TREWGI------------------------------ 220

Query: 270 RKINPSLRRFCRPNTKPIEASNIKQRILRKQEIRRVRFQCPLILDEASNFIIGITGYNIF 329
               P   +    +T P+    +++++L ++++ R  F CPL++++ ++ ++ + GY   
Sbjct: 221 ----PGAPQ----STSPLSICKLREKMLSQKDLNRAYFSCPLVINKTADLVVSVAGYVAT 272

Query: 330 SIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKDEDFQKVYKYGDINIELSDEAT 389
           + E+PGTRYK + +H+   K     RK+   +  + ++D D   VY  G   IE++D   
Sbjct: 273 THERPGTRYKYIVKHDGRTKSVHQCRKYKTVDNEKYIRDADRSSVYWIGGAGIEVTDAEL 332

Query: 390 QNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESSYEGSIKTMASLFRTLH 449
           + +     +   F+++LGFR+ + +  YY+NI +A +++P E  + GS K +ASL R++ 
Sbjct: 333 RKMTRGCSKYESFLEILGFRAINTAAPYYSNIGRAYYILPRELPFSGSAKVLASLNRSMF 392

Query: 450 KKKKVAIVWGVSSSGGHPTIHILSPSNENEHNEGLYLFQVPFLDEIRRFPALTSYSPGTN 509
           +K K AIVWG   +G HPT+  L PS+       L L ++PF++E+R FP L     G +
Sbjct: 393 EKGKAAIVWGQLKAGFHPTLFALIPSDGE--TCALRLVRIPFIEEVRCFPTLD----GED 446

Query: 510 K--NISEYEKMKKLTEYILGTLDLRKGYRPSSYRNPALQKYYKILHDYLLQIEDTSLTDT 567
           +  +  EYE +K +++ ++    LR  YRPS  RNP L+ +Y  L  Y  Q +D      
Sbjct: 447 RLFHTREYELVKTVSQNLIRHFSLRTSYRPSDIRNPLLRNFYSTL--YHEQSQDAK-RKM 503

Query: 568 PQEVLEREVYEDDTLYRLDKLRKRIIQS--SQAPELYNQRLSKFIEHWNRVFKKINEDA 624
           P+  L+     D TL+++  +R RI  S     P +    +S++I  WN  +  I + A
Sbjct: 504 PE--LQYLPESDSTLHKVQLVRDRIENSIIHDEPPI----ISEYINCWNIYYNHIIDKA 556

>TBLA0B09020 Chr2 complement(2138426..2140471) [2046 bp, 681 aa]
           {ON} Anc_2.444 YMR106C
          Length = 681

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 81/190 (42%), Gaps = 36/190 (18%)

Query: 371 FQKVYKYGDINIELSDEATQNIK-NEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVP 429
             KVY+YG   + L    T N+  N Y    P + + GF  ++ SL  +  I +++F+V 
Sbjct: 347 ISKVYRYGTDYVVLPTTLTDNLSFNTY----PGLDITGFMDEE-SLPRHYLISESTFIVA 401

Query: 430 DESSYEGSIKTMAS---LFRTLHKKKKVAIVWGVSSSGGHPTIHILSP------------ 474
           D  S  GS   M S   L   L++ KK+AI   V  +  +  + +L P            
Sbjct: 402 D--SRAGSTADMMSFEILVDVLYENKKIAIARYVQKNNTNAQMVMLCPVLVDHSDILSEQ 459

Query: 475 -----------SNENEHNEGLYLFQVPFLDE--IRRFPALTSYSPGTNKNISEYEKMKKL 521
                       NE  +  GL L ++PF ++  +  FP L++      K+  E E++  L
Sbjct: 460 DIQKYRSIHDDDNEEVNMRGLILSRLPFAEDERVSEFPKLSNRHMKNEKSKLEAEEIDSL 519

Query: 522 TEYILGTLDL 531
               +  LD+
Sbjct: 520 MGNFIDGLDM 529

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score = 35.8 bits (81), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 60/116 (51%), Gaps = 5/116 (4%)

Query: 97   IYEFFQLSDINVKTMKKVTDLLEDLSHD-RKKLEDIFKFDNSRPTKL----EDIFNVVQE 151
            I E+ +L + N K++K++    E+ S D   +++++    +S   K+    E IFN+  E
Sbjct: 919  IQEYKELYETNAKSLKQMHSKFEESSKDFSNRIKNLTNEKSSLEEKISLLKEQIFNLNNE 978

Query: 152  QFLNFDSLHHSKGFNIKKVFLFTNNDKPIESENNETRKKLRRMVNDLNESEIFFST 207
              L    +   K    KK+ +  NN+K +E+  +E   KL ++  DL++  I+ +T
Sbjct: 979  LDLQNKGMKEEKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQKDLDQQTIYANT 1034

>Kpol_1018.159 s1018 (408890..410779) [1890 bp, 629 aa] {ON}
           (408890..410779) [1890 nt, 630 aa]
          Length = 629

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 69/162 (42%), Gaps = 15/162 (9%)

Query: 371 FQKVYKYGDINIELSDEATQNIKNE-YMENRPFMKLLGFRSKDISLKYYNNIDKASFVVP 429
             K Y+YG   + L      +I +E + +  P + + GF  KD+  +YY + +       
Sbjct: 319 ISKAYRYGTDYVVLP----SSISDERFYKTSPGIDIRGFLDKDLLPRYYLSSESRVIFAD 374

Query: 430 DESSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSP----SNENEHNEGLY 485
            +      + +M +    + +  KVAIV  V        +  L P     N  + +E L 
Sbjct: 375 TKMGTLADVVSMGAFVDVMIENDKVAIVRYVQKPNSEVEMCALIPHIFKQNIGDESEDLR 434

Query: 486 LF---QVPFLDE--IRRFPALTS-YSPGTNKNISEYEKMKKL 521
           +F   ++PF ++  +  FP LT  YS    K  +  EK KK+
Sbjct: 435 VFILNRLPFAEDERVSDFPKLTERYSTSGKKLHTNIEKKKKI 476

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 8/76 (10%)

Query: 140  TKLEDIFNVVQEQFLNFDS--------LHHSKGFNIKKVFLFTNNDKPIESENNETRKKL 191
            T LED  ++++EQ  N ++        +   K    K++ +  NN+K +E+  +E   KL
Sbjct: 963  TSLEDKISLLKEQMFNLNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYESKL 1022

Query: 192  RRMVNDLNESEIFFST 207
             ++ NDL++  I+ +T
Sbjct: 1023 SKIQNDLDQQTIYANT 1038

>Suva_13.283 Chr13 complement(459944..461809) [1866 bp, 621 aa] {ON}
           YMR106C (REAL)
          Length = 621

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 78/172 (45%), Gaps = 20/172 (11%)

Query: 373 KVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDES 432
           K Y+YG   + L    +  +     E  P M L GF  ++   +YY    ++SF+V D  
Sbjct: 315 KAYRYGADYVVL---PSVLVDQTVYETFPGMDLRGFLDREALPRYYLT-SESSFIVAD-- 368

Query: 433 SYEGSIK-TMA--SLFRTLHKKKKVAIVWGVSSSGGHPTIHILSP------SNENEHNEG 483
           +  G +  +MA  +L   + + +K+A+   VS      T+  L P       +E +    
Sbjct: 369 TRLGCLSDSMAFSALVDVMLENRKIAVARYVSRKDSEVTMCALCPVLIEQAGSERKVVRS 428

Query: 484 LYLFQVPFLDE--IRRFPAL---TSYSPGTNKNISEYEKMKKLTEYILGTLD 530
           L   ++PF ++  +  FP L   T+ S    KN ++ +++  L E  + ++D
Sbjct: 429 LISCRLPFAEDERVTDFPKLLNRTTTSGVPLKNEADEDQIDDLMEQFVESMD 480

>NDAI0B03380 Chr2 (859629..863969) [4341 bp, 1446 aa] {ON} Anc_2.325
           YDL112W
          Length = 1446

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 91/198 (45%), Gaps = 37/198 (18%)

Query: 111 MKKVTDLLEDLSHDRKK----LEDIFKFDNSR-PTKLEDIFNVVQEQF-LNFDSLHHSKG 164
           +K VT+L+E   HD+ +    + +I + D SR P  ++++F+ +Q++F LNF  L     
Sbjct: 17  LKLVTELIE---HDQLEQLLEICNISELDLSRDPQTIDNLFHKIQQRFDLNFHDLRERTD 73

Query: 165 FNIKKVFLFTNNDKP-----IESENNETRKKLRRMVNDLNESEIFFSTFFINKPDSQFDD 219
            N+ ++  +  N        + ++ NE  KK    V +    +I    + ++     FD 
Sbjct: 74  SNLNQLNEYLENKDAQILAQLIAQTNELWKKFDAWVTN----KIL--QYILSNHKKLFDA 127

Query: 220 TFYSDILKLPINDDTSEIDVEDYYDDAGENGNHYLLINDLXXXXXXXXXXRKINPSLRRF 279
            FY++I+   +N+D    D+E     A EN   + ++ DL            +  S+  F
Sbjct: 128 EFYNEIMARFLNNDKMSYDIE-----AIENIEEFEIVYDL-----------HLLESVYLF 171

Query: 280 CRPNTKPIEASNIKQRIL 297
             P  KP+  SN   R+L
Sbjct: 172 EDPTRKPL-VSNTSDRLL 188

>NCAS0F01480 Chr6 complement(295334..297211) [1878 bp, 625 aa] {ON}
           Anc_2.444 YMR106C
          Length = 625

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 66/162 (40%), Gaps = 21/162 (12%)

Query: 369 EDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVV 428
           +   K Y+YG   + L       +     E  P + + GF   ++  +YY N  +++F++
Sbjct: 309 DSITKAYRYGADYVVLPSTLQSQL---VYETFPGLDIRGFMDMELLPRYYLN-SESTFII 364

Query: 429 PDE--SSYEGSIKTMASLFRTLHKKKKVAIVWGVSSSGGHPTIHILSP----------SN 476
            D        S+ T   L   L   +KVA+   V  +     + +L P          S 
Sbjct: 365 ADTRLGGLADSV-TFGVLVDVLLNNRKVAVARYVPKANSEVQMCVLVPLFVAHHDQSFSG 423

Query: 477 ENEHN--EGLYLFQVPFLDE--IRRFPALTSYSPGTNKNISE 514
           E E N    L L ++PF ++  +  FP LT+    + + + E
Sbjct: 424 EGEENFVRTLVLNRLPFAEDERVSDFPRLTNRRSTSGRTLPE 465

>Skud_13.264 Chr13 complement(453586..455454) [1869 bp, 622 aa] {ON}
           YMR106C (REAL)
          Length = 622

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 99/242 (40%), Gaps = 35/242 (14%)

Query: 316 ASNFIIGITGYNIFSIEKPGTRYKLVYEHENVRKEAFSRRKFLDPNTGEELKD------- 368
           A+  + G+    +   E    + K V     +  E  S  K    N  EE++        
Sbjct: 249 ATKAVSGLNRKTVVETEDSNMKKKFVAVKSIIEYEIHSEEKNKKANEDEEMESSYTSVVI 308

Query: 369 --EDFQKVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASF 426
             +   K Y+YG   + L    +  +     E  P + + GF  ++   +YY    ++SF
Sbjct: 309 SKDSVTKAYRYGADYVVL---PSVLVDQTVYETFPGLDVRGFLDREALPRYYLT-SESSF 364

Query: 427 VVPDESSYEGSIK-TMA--SLFRTLHKKKKVAIVWGVSSSGGHPTIHILSP--------S 475
           ++ D  +  G +  TMA  +L   + + +KVA+   VS       +  L P         
Sbjct: 365 IIAD--TRLGCLSDTMAFGALVDVMLENRKVAVARYVSKKDSEVNMCALCPILVEHADMD 422

Query: 476 NENEHNEGLYLFQVPFLDE--IRRFPAL-----TSYSPGTNKNISEYEKMKKLTEYILGT 528
           +E +    L L ++PF ++  +  FP L     TS +P   +   E+E + +L E ++ +
Sbjct: 423 SETKVVRSLTLCRLPFAEDERVTDFPKLLNRTTTSGTP-LEQETDEHE-IDELMEQLVDS 480

Query: 529 LD 530
           +D
Sbjct: 481 MD 482

>Kpol_1036.17 s1036 (45392..47683) [2292 bp, 763 aa] {ON}
           (45392..47683) [2292 nt, 764 aa]
          Length = 763

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 65/149 (43%), Gaps = 12/149 (8%)

Query: 281 RPNTKPIEASNIKQRILRKQEIRRVRFQCPLILDEASNFIIGITGYNIFSIEKPGTRYKL 340
           + NT PI       R L KQ    +R    LI+D++ + I+ +TG    SI+K       
Sbjct: 258 KSNTAPIGLIFTPTRELAKQVTDHLRKIASLIVDKSPHAILSLTGG--LSIQK------- 308

Query: 341 VYEHENVRKEAFSRRKFLDPNTGEELKDEDFQKVYKYGDINIELSDEATQNIKNEYM-EN 399
             +   ++ E   R     P    EL ++D   V ++  I+  + DEA + +++ +  E 
Sbjct: 309 --QERLLKYEGSGRIVVATPGRFLELIEKDKTLVERFSQISTLVLDEADRLLQDGHFDEF 366

Query: 400 RPFMKLLGFRSKDISLKYYNNIDKASFVV 428
              +K LG  SK+    +   I  A+F  
Sbjct: 367 ENILKYLGRESKNRKHNWQTMIFSATFAT 395

>ABR139W Chr2 (658141..661953) [3813 bp, 1270 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR270W (YTA7)
          Length = 1270

 Score = 32.0 bits (71), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 50/115 (43%), Gaps = 21/115 (18%)

Query: 381 NIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDESSYEGSIKT 440
           N++L    +++++   ME+      +  + +  S+ Y  N D  S  VP     E +I T
Sbjct: 759 NLDLGTLLSESLRT--MESAIVQTFIEAKKRQPSVIYIPNADIWSRTVP-----ESAIMT 811

Query: 441 MASLFRTLHKKKKV---AIVWGVSSSGGHPT-----------IHILSPSNENEHN 481
           +ASLFR+L   ++V   AI  G +    H T           + I  PS    HN
Sbjct: 812 LASLFRSLKTNERVLLLAIAEGFTEEELHNTPLSLFGFDLNIVSIREPSTAQRHN 866

>SAKL0E09768g Chr5 complement(813986..818332) [4347 bp, 1448 aa] {ON}
            highly similar to gnl|GLV|CAGL0J05610g Candida glabrata
            CAGL0J05610g uniprot|O93794 Candida glabrata DNA
            topoisomerase II identified start CAGL0J05610g|CAGL-
            IPF7937|CAGL-CDS0143.1 and similar to YNL088W
            uniprot|P06786 Saccharomyces cerevisiae YNL088W TOP2
            Essential type II topoisomerase catalyzes topology
            changes in DNA via transient breakage and rejoining of
            phosphodiester bonds in the DNA backbone localizes to
            axial cores in meiosis
          Length = 1448

 Score = 31.6 bits (70), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 44/95 (46%), Gaps = 10/95 (10%)

Query: 554  DYLLQIEDTSLTDTPQEVLEREVYEDDT-LYRLDKLRKRIIQSSQAPELYNQRLSKFIEH 612
            DYLL ++  SLT    E L  +  E +  L RL  L         A +L+NQ L  F+  
Sbjct: 1118 DYLLGMKLWSLTKERYEKLLNQQQEKEVELERLLSL--------SAKDLWNQDLDDFVTA 1169

Query: 613  WNRVFKKINEDAQMDIEPTPVTLKKRKQKEKLALN 647
            +   F K + DA+  + P     +K K K K+A N
Sbjct: 1170 FEE-FMKYDADARNSVIPDAAVKRKGKSKRKIAAN 1203

>Smik_13.292 Chr13 complement(462805..464685) [1881 bp, 626 aa] {ON}
           YMR106C (REAL)
          Length = 626

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 80/176 (45%), Gaps = 26/176 (14%)

Query: 373 KVYKYGDINIELSDEATQNIKNEYMENRPFMKLLGFRSKDISLKYYNNIDKASFVVPDES 432
           K Y+YG   I L    +  +     E  P + L GF  K+   +YY    ++SF++ D  
Sbjct: 315 KAYRYGTDYIVL---PSVLVDQTVYETFPGLDLRGFLDKEALPRYYLT-SESSFIIAD-- 368

Query: 433 SYEGSIK-TMA--SLFRTLHKKKKVAIVWGVSSSGGHPTIHILSP--------SNENEHN 481
           +  G +  +MA  +L   + + +K+A+   VS       +  L P        ++E +  
Sbjct: 369 TRLGCLSDSMAFGALVDVMLENRKIAVARYVSKKDSEVNMCALCPVLIEHSNINSEKKVV 428

Query: 482 EGLYLFQVPFLDE--IRRFPAL-----TSYSPGTNKNISEYEKMKKLTEYILGTLD 530
           + L L ++PF ++  +  FP L     TS +P   K  +E+E + +L E  +  +D
Sbjct: 429 KSLTLCRLPFAEDERVTDFPKLLNRTTTSGAP-LEKETAEHE-IDELMERFVDAMD 482

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,910,764
Number of extensions: 4006801
Number of successful extensions: 16487
Number of sequences better than 10.0: 117
Number of HSP's gapped: 17065
Number of HSP's successfully gapped: 128
Length of query: 648
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 532
Effective length of database: 40,180,143
Effective search space: 21375836076
Effective search space used: 21375836076
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)