Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B022405.473ON37337318550.0
Kpol_440.125.473ON36837314700.0
NDAI0C014105.473ON36937314640.0
KNAG0B040705.473ON37337514640.0
YOR136W (IDH2)5.473ON36937314570.0
Smik_15.3165.473ON36937314550.0
Suva_8.1885.473ON36937314530.0
NCAS0H022505.473ON42237314550.0
CAGL0I07227g5.473ON36837314430.0
SAKL0G03520g5.473ON36937314360.0
Skud_15.3005.473ON36937314350.0
Ecym_23135.473ON37037314130.0
TDEL0A033705.473ON37137314050.0
Kwal_55.212735.473ON36836113990.0
Kpol_543.85.473ON36836613980.0
AFR137C5.473ON36737313950.0
KLTH0F15048g5.473ON36837313890.0
KLLA0E03125g5.473ON36837313860.0
KAFR0B063705.473ON37834913760.0
TPHA0J027705.473ON37637713640.0
ZYRO0D11220g5.473ON36837313290.0
TPHA0E014805.473ON37736412651e-174
ADL223W2.278ON3623496666e-84
NDAI0B035902.278ON3593636649e-84
Smik_14.2902.278ON3603466641e-83
Ecym_33162.278ON3623766631e-83
KLLA0F04103g2.278ON3613436632e-83
YNL037C (IDH1)2.278ON3603466562e-82
KLTH0G10186g2.278ON3603456535e-82
TBLA0B069102.278ON3653776511e-81
Kwal_23.50122.278ON3613456483e-81
Skud_14.2932.278ON3613466474e-81
ZYRO0D02838g2.278ON3613656458e-81
SAKL0E07876g2.278ON3613456441e-80
TDEL0C038402.278ON3613796283e-78
CAGL0G02673g2.278ON3583436264e-78
KNAG0A052802.278ON3613456275e-78
TPHA0D015602.278ON3603786222e-77
NCAS0B062902.278ON3593436161e-76
Kpol_1039.352.278ON3593436152e-76
KAFR0J014102.278ON3503436003e-74
Suva_14.3022.278ON3002855242e-63
Kpol_1003.392.287ON3703604002e-44
NDAI0B035502.287ON3723973977e-44
NCAS0B062502.287ON3733963942e-43
CAGL0G02585g2.287ON3723943907e-43
Smik_9.852.287ON3713983862e-42
KNAG0A054202.287ON3723943853e-42
YIL094C (LYS12)2.287ON3713983845e-42
ADL214C2.287ON3673543836e-42
ZYRO0A01914g2.287ON3683943836e-42
TBLA0B059402.287ON3693563828e-42
Skud_9.792.287ON3713983821e-41
Suva_9.1052.287ON3713983783e-41
Ecym_33262.287ON3663533783e-41
KLLA0E08339g2.287ON3693603722e-40
TDEL0G021802.287ON3693943696e-40
SAKL0E07656g2.287ON3683543653e-39
KLTH0G10384g2.287ON3673543619e-39
Kwal_27.115282.287ON3673583564e-38
KAFR0J013602.287ON3733933574e-38
TPHA0C034102.287ON3713543531e-37
AAL012C1.402ON3723492188e-19
Skud_3.431.402ON3643562117e-18
Ecym_12961.402ON3632702091e-17
Smik_3.661.402ON3643572081e-17
YCL018W (LEU2)1.402ON3643522045e-17
TBLA0C015001.402ON3653532046e-17
Suva_3.31.402ON3643552038e-17
NDAI0G042301.402ON3633622011e-16
KLLA0D04906g1.402ON3623532001e-16
Kwal_0.2251.402ON3643541983e-16
ZYRO0E04796g1.402ON3622681983e-16
NCAS0C048701.402ON3653521957e-16
KAFR0I022001.402ON3652701886e-15
TDEL0B060001.402ON3623511887e-15
SAKL0D08690g1.402ON3643521824e-14
CAGL0H03795g1.402ON3653581771e-13
KLTH0H12188g1.402ON3643541753e-13
Kpol_1048.631.402ON3642681744e-13
KNAG0I012801.402ON4473531745e-13
TPHA0B037301.402ON3653521727e-13
Suva_14.303singletonON5351906e-04
ADR028W3.425ON83254704.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B02240
         (373 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   719   0.0  
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   570   0.0  
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   568   0.0  
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   568   0.0  
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   565   0.0  
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   565   0.0  
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   564   0.0  
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    565   0.0  
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   560   0.0  
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   557   0.0  
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   557   0.0  
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   548   0.0  
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   545   0.0  
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   543   0.0  
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   543   0.0  
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   541   0.0  
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   539   0.0  
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   538   0.0  
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   534   0.0  
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   530   0.0  
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   516   0.0  
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   491   e-174
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   261   6e-84
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   260   9e-84
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   260   1e-83
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   259   1e-83
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   259   2e-83
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   257   2e-82
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   256   5e-82
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            255   1e-81
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   254   3e-81
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   253   4e-81
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   253   8e-81
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   252   1e-80
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   246   3e-78
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   245   4e-78
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              246   5e-78
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   244   2e-77
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   241   1e-76
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   241   2e-76
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   235   3e-74
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   206   2e-63
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   158   2e-44
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   157   7e-44
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   156   2e-43
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   154   7e-43
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   153   2e-42
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              152   3e-42
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   152   5e-42
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   152   6e-42
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   152   6e-42
TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   151   8e-42
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   151   1e-41
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   150   3e-41
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   150   3e-41
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   147   2e-40
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   146   6e-40
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   145   3e-39
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   143   9e-39
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   141   4e-38
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   142   4e-38
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   140   1e-37
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...    89   8e-19
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)    86   7e-18
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...    85   1e-17
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)    85   1e-17
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...    83   5e-17
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...    83   6e-17
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)       83   8e-17
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...    82   1e-16
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...    82   1e-16
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...    81   3e-16
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...    81   3e-16
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...    80   7e-16
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...    77   6e-15
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...    77   7e-15
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...    75   4e-14
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}              73   1e-13
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...    72   3e-13
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...    72   4e-13
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...    72   5e-13
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...    71   7e-13
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    39   6e-04
ADR028W Chr4 (753946..756444) [2499 bp, 832 aa] {ON} Syntenic ho...    32   4.0  

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/373 (95%), Positives = 355/373 (95%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK
Sbjct: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120
           DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL
Sbjct: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120

Query: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT
Sbjct: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180

Query: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240
           RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI
Sbjct: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240

Query: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVH 300
           DNTVLNVVRDPPSYTDAVTVCPNLYGDI                  ANIGNEVSIFEAVH
Sbjct: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVH 300

Query: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360
           GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA
Sbjct: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360

Query: 361 TTSSFTESVIKNL 373
           TTSSFTESVIKNL
Sbjct: 361 TTSSFTESVIKNL 373

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/373 (73%), Positives = 314/373 (84%), Gaps = 5/373 (1%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLR    + S  R+ +T         +G++ G PNP TG++TVPFIEGDGVGPEISKSVK
Sbjct: 1   MLRNTIYRGSFARMMTTGQP-----NIGRFTGKPNPVTGKYTVPFIEGDGVGPEISKSVK 55

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120
           DIF AA+VP++WE CDV P+ +NGLTTIP+ AVQ INKH +ALKGPLATPIGKGHRSLNL
Sbjct: 56  DIFAAAKVPIEWEPCDVGPIFVNGLTTIPDAAVQSINKHLVALKGPLATPIGKGHRSLNL 115

Query: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTF LFANVRPARS+  Y+TTY+NVDLVLIRENTEGEYSGIEHV++PGV+QSIKLIT
Sbjct: 116 TLRKTFNLFANVRPARSVPNYKTTYQNVDLVLIRENTEGEYSGIEHVISPGVIQSIKLIT 175

Query: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240
           +DASERVIRYA+EY RAIGRPRLVVVHKSTIQ++ADGLFVN+AKELA E+PDI+L+TELI
Sbjct: 176 KDASERVIRYAFEYTRAIGRPRLVVVHKSTIQRMADGLFVNVAKELASEYPDIELQTELI 235

Query: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVH 300
           DNT+LNVV  P SYTDAV+VCPNLYGDI                  ANIG++VSIFEAVH
Sbjct: 236 DNTILNVVTHPESYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVH 295

Query: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360
           GSAPDIAGQNKANPTALLLSS MMLN+MGL  ++ KIENAIL+TIASGSENRTGDLAGTA
Sbjct: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTA 355

Query: 361 TTSSFTESVIKNL 373
           TTSSFTE+VI  L
Sbjct: 356 TTSSFTEAVINKL 368

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/373 (73%), Positives = 315/373 (84%), Gaps = 4/373 (1%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           M R I  + + RR  S    ++    +GK+ G PNPSTG+FTV FIEGDG+GPEIS+SVK
Sbjct: 1   MFRNIILRNTTRRFLS----VKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVK 56

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120
            IF AA+VP+DWE CDVSPL INGLTTIPEPAVQ INK+ +ALKGPLATPIGKGHRSLNL
Sbjct: 57  QIFDAAKVPIDWEPCDVSPLFINGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNL 116

Query: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTFGLFANVRPA+SI G++T Y NVDLV+IRENTEGEYSGIEHVV PGVVQSIKLIT
Sbjct: 117 TLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVTPGVVQSIKLIT 176

Query: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240
           RDASERVIRYAYEYARAIGRPR++VVHKSTIQ+LADGLFV++AKEL+ E+PDI+LETELI
Sbjct: 177 RDASERVIRYAYEYARAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQEYPDIQLETELI 236

Query: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVH 300
           DNTVLNVV +P SY++AV+VCPNLYGDI                  ANIG+EVSIFEAVH
Sbjct: 237 DNTVLNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHEVSIFEAVH 296

Query: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360
           GSAPDIAGQNKANPTALLLSS MMLN+MGL ++++KIE A+L+TIASG E RTGDLAG A
Sbjct: 297 GSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIASGPEGRTGDLAGKA 356

Query: 361 TTSSFTESVIKNL 373
           TTSSFT++VI  L
Sbjct: 357 TTSSFTDAVIGRL 369

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/375 (73%), Positives = 319/375 (85%), Gaps = 4/375 (1%)

Query: 1   MLRTIAAKQS--ARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKS 58
           MLR    + S  ARR  +TS  ++    +G++ G PNP+TG+F V FIEGDG+GPEIS+S
Sbjct: 1   MLRNSLLRNSFTARRFLATS--VKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQS 58

Query: 59  VKDIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSL 118
           VKDIFKAA+VP++WE+CDV+P+ +NGLTTIP+PAV  INK+ IALKGPLATPIGKGHRSL
Sbjct: 59  VKDIFKAAEVPINWEFCDVTPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSL 118

Query: 119 NLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKL 178
           NLTLRKTF LFANVRPA+SI G++TTY +VDLVLIRENTEGEYSGIEHVVAPGVVQSIKL
Sbjct: 119 NLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVVAPGVVQSIKL 178

Query: 179 ITRDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETE 238
           ITRDASERVIRYA+EYA+AIGRPR+VVVHKSTIQ+LADGLFVN+AKEL+ E+P+IKLETE
Sbjct: 179 ITRDASERVIRYAFEYAKAIGRPRVVVVHKSTIQRLADGLFVNVAKELSKEYPEIKLETE 238

Query: 239 LIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEA 298
           LIDNTVLNVV +P  YTDAV+VCPNLYGDI                  ANIGNE+SIFEA
Sbjct: 239 LIDNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEISIFEA 298

Query: 299 VHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAG 358
           VHGSAPDIAGQNKANPTALLLSS MMLN+MGL   +++IE A+L TIAS S+NRTGDL G
Sbjct: 299 VHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIERAVLTTIASSSKNRTGDLGG 358

Query: 359 TATTSSFTESVIKNL 373
           +ATTSSFT++VIKNL
Sbjct: 359 SATTSSFTDAVIKNL 373

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/373 (72%), Positives = 317/373 (84%), Gaps = 4/373 (1%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLR    + ++RR  +T         +G+Y G PNPSTG++TV FIEGDG+GPEISKSVK
Sbjct: 1   MLRNTFFRNTSRRFLATVK----QPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVK 56

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120
            IF AA VP++WE CDVSP+ +NGLTTIP+PAVQ I K+ +ALKGPLATPIGKGHRSLNL
Sbjct: 57  KIFSAANVPIEWESCDVSPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNL 116

Query: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTFGLFANVRPA+SI G++TTY+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT
Sbjct: 117 TLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLIT 176

Query: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240
           RDASERVIRYA+EYARAIGRPR++VVHKSTIQ+LADGLFVN+AKEL+ E+PD+ LETELI
Sbjct: 177 RDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDLTLETELI 236

Query: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVH 300
           DN+VL VV +P +YTDAV+VCPNLYGDI                  ANIG+++SIFEAVH
Sbjct: 237 DNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVH 296

Query: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360
           GSAPDIAGQ+KANPTALLLSS MMLN+MGL +++++I+NA+L+TIASG ENRTGDLAGTA
Sbjct: 297 GSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTA 356

Query: 361 TTSSFTESVIKNL 373
           TTSSFTE+VIK L
Sbjct: 357 TTSSFTEAVIKRL 369

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/373 (72%), Positives = 317/373 (84%), Gaps = 4/373 (1%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLR    + ++RR  +T         +GKY G PNPSTG++TV FIEGDG+GPEISKSVK
Sbjct: 1   MLRNTFFRNTSRRFLATVK----QPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVK 56

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120
            IF AA VP++WE+CDV+P+ +NGLTTIP+PAVQ I K+ +ALKGPLATPIGKGHRSLNL
Sbjct: 57  KIFSAANVPIEWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNL 116

Query: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTFGLFANVRPA+S+ G++TTY+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT
Sbjct: 117 TLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLIT 176

Query: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240
           RDASERVIRYA+EYARAIGRPR++VVHKSTIQ+LADGLFVN+AKEL+ E+PDI LETELI
Sbjct: 177 RDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDITLETELI 236

Query: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVH 300
           DN+VL VV +P +YT+AV+VCPNLYGDI                  ANIG+++SIFEAVH
Sbjct: 237 DNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVH 296

Query: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360
           GSAPDIAGQ+KANPTALLLSS MMLN+MGL +Y+++I+NA+L+TIASG ENRTGDLAG A
Sbjct: 297 GSAPDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLSTIASGPENRTGDLAGAA 356

Query: 361 TTSSFTESVIKNL 373
           TTSSFTE+VIK L
Sbjct: 357 TTSSFTEAVIKRL 369

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/373 (72%), Positives = 317/373 (84%), Gaps = 4/373 (1%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLR    + ++RR  ST         +G+Y G P+PSTGR+TV FIEGDG+GPEISKSVK
Sbjct: 1   MLRNTFLRNTSRRFLSTVK----QPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVK 56

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120
            IF AA VP++WE+CDV+P+ +NGLTTIP+PAVQ I K+ +ALKGPLATPIGKGHRSLNL
Sbjct: 57  KIFSAADVPINWEFCDVNPIFVNGLTTIPDPAVQSITKNLVALKGPLATPIGKGHRSLNL 116

Query: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTFGLFANVRPA+SI G++TTY+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT
Sbjct: 117 TLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLIT 176

Query: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240
           R+ASERVIRYA+EYARAIGRPR++VVHKSTIQ+LADGLFVN+AKEL+ E+PDI  ETELI
Sbjct: 177 REASERVIRYAFEYARAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKEYPDITFETELI 236

Query: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVH 300
           DN VLNVV +P +YT+AV+VCPNLYGDI                  ANIG++VSIFEAVH
Sbjct: 237 DNKVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVH 296

Query: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360
           GSAPDIAG++KANPTALLLSS MMLN+MGL S++++I+NA+L+TIASG ENRTGDLAGTA
Sbjct: 297 GSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIASGPENRTGDLAGTA 356

Query: 361 TTSSFTESVIKNL 373
           TTSSFTE+VIK L
Sbjct: 357 TTSSFTEAVIKRL 369

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/373 (72%), Positives = 315/373 (84%), Gaps = 4/373 (1%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           M R+   + + RRL S    ++    +GKY G PNPSTG++TV FIEGDG+GPEIS SVK
Sbjct: 54  MFRSSILRTTTRRLLS----VKHQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISNSVK 109

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120
            IF AA+VP++WE CDV+PL I+GLTTIPEPAVQ INK+ +ALKGPLATPIGKGHRSLNL
Sbjct: 110 QIFSAAKVPIEWETCDVTPLFIDGLTTIPEPAVQSINKNLVALKGPLATPIGKGHRSLNL 169

Query: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTFGLFANVRPARS++G++TTY NVDLVLIRENTEGEYSGIEHVV PGVVQSIKLIT
Sbjct: 170 TLRKTFGLFANVRPARSVKGFKTTYPNVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLIT 229

Query: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240
           R+ASERVIRYA+EY RAIGRPRLVVVHKSTIQ+L+DGLFVN+AKEL+ E+PDI+ ETELI
Sbjct: 230 REASERVIRYAFEYCRAIGRPRLVVVHKSTIQRLSDGLFVNVAKELSKEYPDIQFETELI 289

Query: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVH 300
           DNTVL VV +P SYTDAV+VCPNLYGDI                   NIGNE+SIFEAVH
Sbjct: 290 DNTVLKVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVH 349

Query: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360
           GSAPDIAG+N ANPTALLLSS MMLN+MGL  ++++IENA+L+TIASG E+RTGDLAGTA
Sbjct: 350 GSAPDIAGKNMANPTALLLSSVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTA 409

Query: 361 TTSSFTESVIKNL 373
           TTS+FT++VIK L
Sbjct: 410 TTSTFTDAVIKKL 422

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/373 (72%), Positives = 315/373 (84%), Gaps = 5/373 (1%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           ML   + + +ARR  +T+        +G++ G PNPSTG+FTV FIEGDG+GPEIS SVK
Sbjct: 1   MLGIRSFRLNARRFLATAQP-----SIGRFTGKPNPSTGKFTVSFIEGDGIGPEISSSVK 55

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120
            IF+AA VPV+WE CDV+P+ +NGLTTIP+PAVQ INK+ +ALKGPLATPIGKGHRSLNL
Sbjct: 56  RIFQAADVPVEWETCDVTPIFVNGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNL 115

Query: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTF LFANVRPA+SI G++TTY+NVDLVLIRENTEGEYSGIEH+V+PGVVQSIKLIT
Sbjct: 116 TLRKTFNLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHLVSPGVVQSIKLIT 175

Query: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240
           RDASERVIRYAYEYARAIGRPRL+VVHKSTIQ+LADGLFVN+AKELA E+PDI+LETELI
Sbjct: 176 RDASERVIRYAYEYARAIGRPRLIVVHKSTIQRLADGLFVNVAKELAAEYPDIQLETELI 235

Query: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVH 300
           DNT LNVV +P SYTDAV+VCPNLYGDI                  ANIG++VSIFEAVH
Sbjct: 236 DNTCLNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVH 295

Query: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360
           GSAPDIAGQNKANPTALLLSS MMLN+MG+  ++++IE A+L TIA GSE RTGDL G+A
Sbjct: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGSEYRTGDLGGSA 355

Query: 361 TTSSFTESVIKNL 373
           +T+SFT+++IK L
Sbjct: 356 STTSFTDAIIKKL 368

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/373 (71%), Positives = 315/373 (84%), Gaps = 4/373 (1%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLR+   +Q  RR  S+    +    +G++ G PNPSTG++TV FIEGDGVGPEISKSVK
Sbjct: 1   MLRSQVLRQLPRRFLSS----KKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVK 56

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120
           DIF AA+VPV+WE CDV+PL INGLTTIP+PAV  INK+ IALKGPLATPIGKGHRSLNL
Sbjct: 57  DIFAAAEVPVEWESCDVTPLFINGLTTIPQPAVDSINKNLIALKGPLATPIGKGHRSLNL 116

Query: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTFGLFANVRPA+S+ G++TTY+NVDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT
Sbjct: 117 TLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLIT 176

Query: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240
           RDASERVIRYA+EYARA+GRP+++VVHKSTIQ+LADGLFV++AKEL+ E+PDI+L+ +L+
Sbjct: 177 RDASERVIRYAFEYARAVGRPKVMVVHKSTIQRLADGLFVDVAKELSSEYPDIQLQLQLL 236

Query: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVH 300
           DNTVLNVV +P +Y D V+VCPNLYGDI                  ANIG++VSIFEAVH
Sbjct: 237 DNTVLNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKVSIFEAVH 296

Query: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360
           GSAPDIAGQNKANPTALLLSS MMLN+MGL   ++ IE A+L+TIASG ENRT DLAG+A
Sbjct: 297 GSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLSTIASGPENRTADLAGSA 356

Query: 361 TTSSFTESVIKNL 373
           +TSSFTE+VIK L
Sbjct: 357 STSSFTEAVIKRL 369

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/373 (71%), Positives = 316/373 (84%), Gaps = 4/373 (1%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLR+   + ++RR  +T         +G++ G PNPSTGR+TV FIEGDG+GPEISKSVK
Sbjct: 1   MLRSNLFRNTSRRFLATVK----QPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVK 56

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120
            IF AA VP++WE CDV+P+ +NGLTTIP+ AVQ I  + IALKGPLATPIGKGHRSLNL
Sbjct: 57  KIFNAANVPIEWESCDVNPIFVNGLTTIPDAAVQSITNNLIALKGPLATPIGKGHRSLNL 116

Query: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTFGLFANVRPA+S+ G++TTY+NVDLVLIRENTEGEYSGIEH+V PGVVQSIKLIT
Sbjct: 117 TLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVCPGVVQSIKLIT 176

Query: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240
           RDASERVIRYA+EYARAIGRPR++VVHKSTIQ+LADGLFVN+AKEL+ E+PDI LETELI
Sbjct: 177 RDASERVIRYAFEYARAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKEYPDIILETELI 236

Query: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVH 300
           DN+VL VV +P +YT+AV+VCPNLYGDI                  ANIG+++SIFEAVH
Sbjct: 237 DNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHKISIFEAVH 296

Query: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360
           GSAPDIAGQ+KANPTALLLSS MMLN+MGL +++++I+NA+L+TIASG ENRTGDLAGTA
Sbjct: 297 GSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASGPENRTGDLAGTA 356

Query: 361 TTSSFTESVIKNL 373
           TTSSFTE+VIK L
Sbjct: 357 TTSSFTEAVIKRL 369

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/373 (71%), Positives = 311/373 (83%), Gaps = 3/373 (0%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           M +    K S R L S S   R    +G++ G PNP TG++TV FIEGDG+GPEIS+SVK
Sbjct: 1   MFKQSIFKGSRRYLASAS---RKQPSIGRFTGKPNPKTGKYTVSFIEGDGIGPEISQSVK 57

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120
           DIF AA+VPV+WEYCDV+P+ INGLTTIP+PAVQ INK+ +ALKGPLATPIGKGHRSLNL
Sbjct: 58  DIFSAAKVPVEWEYCDVTPIFINGLTTIPDPAVQSINKNLVALKGPLATPIGKGHRSLNL 117

Query: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTFGLFANVRPA+SI G++TTY+NVDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT
Sbjct: 118 TLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLIT 177

Query: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240
           RDASERVIRYA+EYARA+GRP++VVVHKSTIQ+LADGLFVN+A+E+  E+PDI+L+ ELI
Sbjct: 178 RDASERVIRYAFEYARAVGRPKVVVVHKSTIQRLADGLFVNVAQEVGKEYPDIELQPELI 237

Query: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVH 300
           DNTVLNVV  P  Y+D+V VCPNLYGDI                  ANIG+ VSIFEAVH
Sbjct: 238 DNTVLNVVSKPEKYSDSVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVH 297

Query: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360
           GSAPDIAGQN ANPTALLLSS MMLN+MGL  ++++IE+A+L T+AS  +NRT DLAGTA
Sbjct: 298 GSAPDIAGQNCANPTALLLSSVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTA 357

Query: 361 TTSSFTESVIKNL 373
           TTSSFT++VI+ L
Sbjct: 358 TTSSFTKAVIERL 370

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/373 (69%), Positives = 314/373 (84%), Gaps = 2/373 (0%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLR+   +++  R+ ++++  + S  +GKY G P+P TG++TV FIEGDGVGPEISKSVK
Sbjct: 1   MLRSQICRRTVNRMLASATHKQPS--IGKYTGKPDPKTGKYTVSFIEGDGVGPEISKSVK 58

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120
           DIF AA+VP+ WE C V+PLL+NG+TTIPE A + IN++ +ALKGPLATPIGKGHRS+NL
Sbjct: 59  DIFAAAKVPIVWESCPVTPLLVNGVTTIPEQAQESINRNLVALKGPLATPIGKGHRSMNL 118

Query: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTFGLFANVRPA+S+ G++TTY++VDLVLIRENTEGEY+GIEHV+ PGVVQSIKLIT
Sbjct: 119 TLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLIRENTEGEYAGIEHVIVPGVVQSIKLIT 178

Query: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240
           R+ASERVIRYAYEYARA+GRP+LVVVHKSTIQ+LADGLFV +AKELA EFPDI+L+TELI
Sbjct: 179 REASERVIRYAYEYARAVGRPKLVVVHKSTIQRLADGLFVTVAKELAHEFPDIQLQTELI 238

Query: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVH 300
           DNTVLNVV +P  Y+D V VCPNLYGDI                   NIG++VSIFEAVH
Sbjct: 239 DNTVLNVVSNPSKYSDVVYVCPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVH 298

Query: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360
           GSAPDIAGQNKANPTALLLSS MMLN+MGL  +++KIE A+L TIA+G E+RTGDLAG+A
Sbjct: 299 GSAPDIAGQNKANPTALLLSSVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSA 358

Query: 361 TTSSFTESVIKNL 373
           +TSSFTE+VI  L
Sbjct: 359 STSSFTEAVISRL 371

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/361 (72%), Positives = 304/361 (84%), Gaps = 4/361 (1%)

Query: 13  RLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDW 72
           R F+T    +    +G+Y G P+P+TG++TV FIEGDGVGPEISK+VKDIF AA+ P+ W
Sbjct: 12  RFFAT----KKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVKDIFAAAKAPIQW 67

Query: 73  EYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNLTLRKTFGLFANV 132
           E CDV+PL INGLTTIP+PA   INK+ IALKGPLATPIGKGHRSLNLTLRKTFGLFANV
Sbjct: 68  ETCDVTPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNLTLRKTFGLFANV 127

Query: 133 RPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAY 192
           RPA+SI+G++T Y NVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT+DASERVIRYA+
Sbjct: 128 RPAKSIQGFKTAYDNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITQDASERVIRYAF 187

Query: 193 EYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPP 252
           EYARA+ RP+++VVHKSTIQ+LADGLFV++A++LA E+PDI+L+TELIDNTVL+ VRDP 
Sbjct: 188 EYARAVERPKVLVVHKSTIQRLADGLFVSVAEKLAKEYPDIELQTELIDNTVLHTVRDPL 247

Query: 253 SYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKA 312
            Y+D V VCPNLYGDI                  ANIG+EVSIFEAVHGSAPDIAGQNKA
Sbjct: 248 KYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKA 307

Query: 313 NPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKN 372
           NPTALLLSS MMLN+MGL  +++KIE A+ +TIASG ENRTGDLAG+A+TSSF E+VI  
Sbjct: 308 NPTALLLSSVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISR 367

Query: 373 L 373
           L
Sbjct: 368 L 368

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/366 (70%), Positives = 307/366 (83%), Gaps = 2/366 (0%)

Query: 10  SARRLFSTSSTLRVSGQ--VGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQ 67
           ++R    T S    +GQ  +G++ G P+P+TG+FTVPFIEGDGVGPEIS+SVK IF AA+
Sbjct: 3   NSRLQLRTVSRFLSTGQPSIGRFTGKPDPATGKFTVPFIEGDGVGPEISESVKKIFSAAK 62

Query: 68  VPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNLTLRKTFG 127
           VP++W  CDV P+ +NG TTIPEPAV+ INKH IALKGPLATPIGKGHRSLNLTLRKTF 
Sbjct: 63  VPIEWVPCDVGPIFVNGQTTIPEPAVELINKHLIALKGPLATPIGKGHRSLNLTLRKTFN 122

Query: 128 LFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERV 187
           LFANVRPARSI  Y++TY+NVDLVLIRENTEGEYSGIEHV+ PGV+QSIKLITR+A+ERV
Sbjct: 123 LFANVRPARSIPNYKSTYENVDLVLIRENTEGEYSGIEHVITPGVIQSIKLITREATERV 182

Query: 188 IRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNV 247
           +RYA+EY +AIGRPRL+V+HKSTIQ++ADGLFV +A+ELA E+PDIKLETE+ID ++LNV
Sbjct: 183 VRYAFEYTQAIGRPRLLVIHKSTIQRMADGLFVKVAEELASEYPDIKLETEIIDKSILNV 242

Query: 248 VRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVHGSAPDIA 307
           V  P  Y+DAV+VCPNLYGDI                  ANIG++VSIFEAVHGSAPDIA
Sbjct: 243 VSKPELYSDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIA 302

Query: 308 GQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTE 367
           GQNKANPTALLLSS MML +MGL+ ++NKIENA+L TIASGSENRT DL+GTA+TSSFTE
Sbjct: 303 GQNKANPTALLLSSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTE 362

Query: 368 SVIKNL 373
            VI+ L
Sbjct: 363 EVIQRL 368

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/373 (71%), Positives = 306/373 (82%), Gaps = 6/373 (1%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLR    + S R L S          +G+Y G PN + G++TV FIEGDGVGPEIS+SVK
Sbjct: 1   MLRQKLFQGSRRWLASVRQP-----SIGRYAGKPN-AAGKYTVSFIEGDGVGPEISQSVK 54

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120
           DIF AA VPV+WEYCDV+PLL+NGLTTIPEPAV  INK+ +ALKGPLATPIGKGHRSLNL
Sbjct: 55  DIFSAASVPVEWEYCDVTPLLVNGLTTIPEPAVASINKNLVALKGPLATPIGKGHRSLNL 114

Query: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTFGLFANVRPA+SI GY+TTY +VDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT
Sbjct: 115 TLRKTFGLFANVRPAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLIT 174

Query: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240
           R+ASERVIRYA+EYAR +GRP++VVVHKSTIQ+LADGLFVN+A+EL  E+PDI+L+TEL+
Sbjct: 175 REASERVIRYAFEYARTVGRPKVVVVHKSTIQRLADGLFVNVAQELGREYPDIELQTELL 234

Query: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVH 300
           DNTVLNVV  P +Y D V VCPNLYGDI                  ANIG++VSIFEAVH
Sbjct: 235 DNTVLNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVH 294

Query: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360
           GSAPDIAGQN+ANPTALLLSS MMLN+MGL  ++ +IE A+L+TIAS  ENRT DLAGTA
Sbjct: 295 GSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSRENRTADLAGTA 354

Query: 361 TTSSFTESVIKNL 373
           +TSSFT +VI+ L
Sbjct: 355 STSSFTNAVIERL 367

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/373 (69%), Positives = 307/373 (82%), Gaps = 5/373 (1%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           M ++   + SAR L +     +    +G+Y G P+P+TG++TV FIEGDGVGPEISK+VK
Sbjct: 1   MFKSSFVRNSARFLAT-----KKQPSIGRYTGKPDPATGKYTVSFIEGDGVGPEISKAVK 55

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120
           DIF AA+ P+ WE CDVSPL INGLTTIP+PA   INK+ IALKGPLATPIGKGHRSLNL
Sbjct: 56  DIFAAAKAPIQWESCDVSPLFINGLTTIPQPAQDSINKNLIALKGPLATPIGKGHRSLNL 115

Query: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTFGLFANVRPA+S++GY+T Y NVDLVLIRENTEGEYSGIEHVV+PGVVQSIKLIT
Sbjct: 116 TLRKTFGLFANVRPAKSVQGYKTAYDNVDLVLIRENTEGEYSGIEHVVSPGVVQSIKLIT 175

Query: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240
           +DASERVIRYA+EYARA+ RP++VVVHKSTIQ+LADGLFV++A++L+ E+PDI+L+TELI
Sbjct: 176 QDASERVIRYAFEYARAVERPKVVVVHKSTIQRLADGLFVSVAEQLSKEYPDIELQTELI 235

Query: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVH 300
           DNTVL+ VRDP  Y+D V VCPNLYGDI                  ANIG++VSIFEAVH
Sbjct: 236 DNTVLHTVRDPTKYSDVVVVCPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVH 295

Query: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360
           GSAPDIAGQNKANPTALLLSS MMLN+MGL  +++KIE A+  TIA+G E+RTGDL G+A
Sbjct: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSA 355

Query: 361 TTSSFTESVIKNL 373
           +TSSF E+VI  L
Sbjct: 356 STSSFAEAVISRL 368

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  538 bits (1386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/373 (69%), Positives = 307/373 (82%), Gaps = 5/373 (1%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           M R    KQS R L +     +    +G+Y G PNP TG++TV FIEGDGVGPEISKSVK
Sbjct: 1   MFRQSIVKQSCRFLAT-----KKQPSIGRYTGKPNPKTGKYTVSFIEGDGVGPEISKSVK 55

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120
            IF AA+VP++WE CDVSP+ +NGLTTIP+PAV  INK+ IALKGPLATPIGKGHRSLNL
Sbjct: 56  AIFSAAKVPIEWESCDVSPIFVNGLTTIPDPAVASINKNLIALKGPLATPIGKGHRSLNL 115

Query: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTFGLFANVRPA+SI GY+TTY+NV+LVLIRENTEGEYSGIEHVVAPGVVQSIKLIT
Sbjct: 116 TLRKTFGLFANVRPAKSIEGYKTTYENVNLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 175

Query: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240
           +DASERVIRYA+EYARA+ R +++VVHKSTIQ+LADGLFV++AK+L+ E+PDI+L+TEL+
Sbjct: 176 QDASERVIRYAFEYARAVDRSKVLVVHKSTIQRLADGLFVDVAKKLSSEYPDIELQTELL 235

Query: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVH 300
           DNTVL  V+ P +Y D V VCPNLYGDI                  ANIG+ VSIFEAVH
Sbjct: 236 DNTVLKTVQHPEAYDDVVVVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVH 295

Query: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360
           GSAPDIAGQNKANPTALLLSS MMLN+MGL  +++KIE A+L TIAS ++NRTGDL G+A
Sbjct: 296 GSAPDIAGQNKANPTALLLSSVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSA 355

Query: 361 TTSSFTESVIKNL 373
           +TSSFT++VI+ L
Sbjct: 356 STSSFTDAVIERL 368

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/349 (72%), Positives = 300/349 (85%), Gaps = 2/349 (0%)

Query: 27  VGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLT 86
           +G++ G P+ +TG++TV FIEGDG+GPEIS+SVKDIF+AA VP+ WE CDVSP+L++GLT
Sbjct: 30  IGRFTGKPDHATGKYTVSFIEGDGIGPEISRSVKDIFQAASVPITWETCDVSPILVDGLT 89

Query: 87  TIPEPAVQQINKHKIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSIRGYETTYK 146
           TIP+ AV+ INK+ + LKGPLATPIGKGHRSLNLTLRKTF LFANVRPA+S+RG++TTY 
Sbjct: 90  TIPDEAVKSINKNLVGLKGPLATPIGKGHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYD 149

Query: 147 NVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVV 206
           NVDLVLIRENTEGEYSGIEHVV PGVVQSIKLITRDASERVIRYA+EYA+AIGRP+++VV
Sbjct: 150 NVDLVLIRENTEGEYSGIEHVVTPGVVQSIKLITRDASERVIRYAFEYAKAIGRPKVIVV 209

Query: 207 HKSTIQKLADGLFVNIAKELAPE--FPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNL 264
           HKSTIQ+L+DGLFVN+AKEL  E  F +I+L+TELIDNTVLNVV +P  Y+DAV VCPNL
Sbjct: 210 HKSTIQRLSDGLFVNVAKELQKEKNFQNIELDTELIDNTVLNVVMNPSKYSDAVFVCPNL 269

Query: 265 YGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMM 324
           YGDI                  ANIG+++SIFEAVHGSAPDIAGQNKANPTALLLSS MM
Sbjct: 270 YGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQNKANPTALLLSSVMM 329

Query: 325 LNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           L++MGL  Y +KIENA+L TIA+ S+NRTGDL GTATT+SFTE+VI NL
Sbjct: 330 LHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/377 (69%), Positives = 307/377 (81%), Gaps = 5/377 (1%)

Query: 1   MLRTIAA--KQSARRLFSTSSTLRVSGQ--VGKYKGSPNPSTGRFTVPFIEGDGVGPEIS 56
           MLR  AA  +++   L    ST  +S Q  +G++ G  N S+G +TVPFIEGDGVGPEIS
Sbjct: 1   MLRNTAAIAQKNTTLLKILGSTRSISNQPTIGRFTGKTN-SSGTYTVPFIEGDGVGPEIS 59

Query: 57  KSVKDIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHR 116
           KSVKDIF AA VP+ W+ CDV P+ +NGLTTIPEPAV+ I +  +ALKGPLATP+GKGHR
Sbjct: 60  KSVKDIFSAANVPIQWQPCDVGPIFVNGLTTIPEPAVKAIKESLVALKGPLATPVGKGHR 119

Query: 117 SLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSI 176
           SLNLTLRKTF LFANVRPA+S+  Y++TY+NVDLVLIRENTEGEYSGIEH+V PGVVQSI
Sbjct: 120 SLNLTLRKTFDLFANVRPAKSVPNYKSTYENVDLVLIRENTEGEYSGIEHIVTPGVVQSI 179

Query: 177 KLITRDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLE 236
           KLITR+ASE+VIRYAYEYA A+GRPRL+VVHKSTIQ+L DGLFV IA EL  E+P IKLE
Sbjct: 180 KLITREASEKVIRYAYEYAIAVGRPRLIVVHKSTIQRLGDGLFVQIANELQSEYPSIKLE 239

Query: 237 TELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIF 296
           T+++DNTVLNVV +P  Y DAV+VCPNLYGDI                  ANIG++VSIF
Sbjct: 240 TQILDNTVLNVVSNPTLYKDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIF 299

Query: 297 EAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDL 356
           EAVHGSAPDIAGQNKANPTALLLSS MMLN+MGLE ++++IENA+L+TIASG E+RTGDL
Sbjct: 300 EAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDL 359

Query: 357 AGTATTSSFTESVIKNL 373
            G+ATTSSFTE VIK L
Sbjct: 360 GGSATTSSFTECVIKKL 376

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  516 bits (1329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/373 (65%), Positives = 301/373 (80%), Gaps = 5/373 (1%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           M ++   +++  R+FS+         +GK+ G P+P TG + V FIEGDG+GPEISKSVK
Sbjct: 1   MFKSQVCRRAVARMFSSKQP-----SIGKFTGKPDPKTGNYKVSFIEGDGIGPEISKSVK 55

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNL 120
           DIF AA+VPVD+E   V P+L+NG+T+IPE A + IN + +ALKGPLATP+GKGHRS+NL
Sbjct: 56  DIFAAAKVPVDFESVVVKPILVNGVTSIPEEAQKSINTNLVALKGPLATPVGKGHRSMNL 115

Query: 121 TLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLIT 180
           TLRKTFGLFAN+RPA+S+ G++T Y NV+LVLIRENTEGEY+GIEH + PGVVQSIKLIT
Sbjct: 116 TLRKTFGLFANLRPAKSVEGFKTIYDNVNLVLIRENTEGEYAGIEHAIVPGVVQSIKLIT 175

Query: 181 RDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELI 240
           R+ASERVIR+AYEYARA  RPRL+VVHKSTIQ+L+DGLFV++AKEL  EFPDIKLETELI
Sbjct: 176 REASERVIRFAYEYARAAERPRLIVVHKSTIQRLSDGLFVDVAKELQSEFPDIKLETELI 235

Query: 241 DNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVH 300
           DN VLN V DP  Y+DAV+VCPNLYGDI                   NIG++VSIFEAVH
Sbjct: 236 DNAVLNTVTDPTKYSDAVSVCPNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVH 295

Query: 301 GSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTA 360
           GSAPDIAG++KANPTALLLSS MML++MGL  ++++IE A+L TIA+G E+RTGDL G+A
Sbjct: 296 GSAPDIAGKDKANPTALLLSSVMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSA 355

Query: 361 TTSSFTESVIKNL 373
           +TSSFTE+VIK L
Sbjct: 356 STSSFTEAVIKKL 368

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  491 bits (1265), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 238/364 (65%), Positives = 289/364 (79%), Gaps = 4/364 (1%)

Query: 10  SARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVP 69
           S  R F T++  ++S  +G +KG PNP TG +TVPFIEGDGVGPEISKSV+ IFKAA+VP
Sbjct: 17  SKLRYFMTAAD-KIS--IGNFKGKPNPETGNYTVPFIEGDGVGPEISKSVRTIFKAAKVP 73

Query: 70  VDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGKGHRSLNLTLRKTFGLF 129
           +DW  CD+ PLLING TTIP+ AV QIN   IALKGPLATP+G+GHRS+NLTLRKTFGLF
Sbjct: 74  IDWVNCDIGPLLINGETTIPQTAVDQINNSLIALKGPLATPVGQGHRSINLTLRKTFGLF 133

Query: 130 ANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIR 189
           ANVRPA+SI    +TY+NVDL++IRENTEGEYSGIEH + PGVVQSIKLITR ASE+VI+
Sbjct: 134 ANVRPAKSIPNLASTYENVDLIVIRENTEGEYSGIEHEIVPGVVQSIKLITRKASEKVIK 193

Query: 190 YAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVR 249
           YA+EY R+IGR  L+VVHK+TIQ+  DGLFV  A+E+A ++PD+ L+ ELIDNTVLN + 
Sbjct: 194 YAFEYTRSIGRSNLIVVHKATIQRRGDGLFVQTAQEMADKYPDVNLKLELIDNTVLNCIM 253

Query: 250 DPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQ 309
           +P  Y D+V+VCPNLYGDI                  ANIG E  ++EAVHGSAPDIAGQ
Sbjct: 254 NPEKYADSVSVCPNLYGDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQ 312

Query: 310 NKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESV 369
           +KANPTALLLSS MMLN+MGL+ Y++ IE A+L TI SG E RT DL G+ATT+SFT++V
Sbjct: 313 DKANPTALLLSSVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAV 372

Query: 370 IKNL 373
           I+NL
Sbjct: 373 IENL 376

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  261 bits (666), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 147/349 (42%), Positives = 207/349 (59%), Gaps = 9/349 (2%)

Query: 28  GKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLTT 87
           G+ +  P    GR+TV  I GDG+G E++ SV  IF+A  VPVDWE  ++S L  N    
Sbjct: 17  GREQLLPKKYGGRYTVTLIPGDGIGKEVTDSVVQIFEAENVPVDWESVELSALEENHEGV 76

Query: 88  IPEPAVQQINKHKIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSIRGYETTYK 146
             + AV+ + ++K+ LKG   TP  + GH SLN+  RK   +FANV   +S  G +T  +
Sbjct: 77  --QKAVESLKRNKVGLKGIWHTPADQTGHGSLNVAFRKQLDIFANVALFKSFPGVKTKLQ 134

Query: 147 NVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVV 206
           +VDLV+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+A+++A    R  +  V
Sbjct: 135 DVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIARFAFDFALKNNRKAVCAV 194

Query: 207 HKSTIQKLADGLFVNIAKEL-APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLY 265
           HK+ I KL DGLF N   E+ A E+P++ + + ++DN  +  V  P  +   V V PNLY
Sbjct: 195 HKANIMKLGDGLFRNTVSEIGAKEYPEVNVSSIIVDNASMQAVAKPHQFD--VLVTPNLY 252

Query: 266 GDIXXXXXXXXXXXXXXXXXXANIGNEVSIFE-AVHGSAPDIAGQNKANPTALLLSSCMM 324
           G I                  AN G E ++FE        DI GQ+ ANPTA++LSS +M
Sbjct: 253 GSI-LGNIGAALIGGPGLVPGANFGREYAVFEPGCRHVGLDIKGQDVANPTAMILSSTLM 311

Query: 325 LNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           L ++GL  Y+++I  A   TIA G    T D+ GTATT+ FT +VI  L
Sbjct: 312 LRHLGLNEYADRISRATYETIAEGKRT-TKDIGGTATTTEFTNAVIDKL 359

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  260 bits (664), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 149/363 (41%), Positives = 215/363 (59%), Gaps = 10/363 (2%)

Query: 14  LFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWE 73
           +F  S T R    + K    P    GRFTV  + GDGVG EI+ SV  IFK+  VP+DWE
Sbjct: 1   MFKHSVTKRSLVTLAKETIIPKKYGGRFTVTLLPGDGVGKEITDSVVSIFKSENVPIDWE 60

Query: 74  YCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGK-GHRSLNLTLRKTFGLFANV 132
             D+S L     T   + AV  + ++KI LKG   TP  + GH SLN+  RK   ++ANV
Sbjct: 61  TVDISGL---DHTEGVKAAVDSLKRNKIGLKGIWHTPADQVGHGSLNVAFRKQLDIYANV 117

Query: 133 RPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAY 192
              +SI G +T   NVDLV+IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+A+
Sbjct: 118 AIFKSIEGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESLKIITKSKSERIARFAF 177

Query: 193 EYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELA-PEFPDIKLETELIDNTVLNVVRDP 251
           ++A+   R  +  VHK+ I KL+DGLF N   ++   E+P+I+  + ++DN  +  V  P
Sbjct: 178 DFAKRNNRKSVTAVHKANIMKLSDGLFRNTVSKIGEEEYPEIQTSSIIVDNASMQAVAKP 237

Query: 252 PSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFE-AVHGSAPDIAGQN 310
             +   V V P++YG I                   N G + ++FE        DI GQN
Sbjct: 238 HQFD--VMVTPSMYGTI-VGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQN 294

Query: 311 KANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVI 370
            ANPTA+LLS+ ++L+++GLE  +N+I++A+ + IA G    T D+ G+A+T+ FT++VI
Sbjct: 295 VANPTAMLLSATLLLDHLGLEKSANRIKSAVYDVIAEGKAT-TQDIGGSASTTEFTQAVI 353

Query: 371 KNL 373
             L
Sbjct: 354 NKL 356

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  260 bits (664), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 143/346 (41%), Positives = 209/346 (60%), Gaps = 16/346 (4%)

Query: 34  PNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLTTIPE--- 90
           P    GRFTV  I GDGVG EI+ SVK IF+A ++PVDWE  ++        T   E   
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVKTIFEAEKIPVDWETVNIKQ------TDHKEGVY 75

Query: 91  PAVQQINKHKIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVD 149
            AV+ + ++KI LKG   TP  + GH SLN+ LRK   ++ANV   +S++G +T   ++D
Sbjct: 76  EAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDID 135

Query: 150 LVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVVHKS 209
           L++IRENTEGE+SG+EH   PGVV+S+K++TR  +ER+ R+A+++A+   R  +  VHK+
Sbjct: 136 LIVIRENTEGEFSGLEHESVPGVVESLKIMTRPKTERIARFAFDFAKKYNRKAVTAVHKA 195

Query: 210 TIQKLADGLFVNIAKELA-PEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDI 268
            I KL DGLF NI  E+   E+PDI + + ++DN  +  V  P  +   V V P++YG I
Sbjct: 196 NIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI 253

Query: 269 XXXXXXXXXXXXXXXXXXANIGNEVSIFE-AVHGSAPDIAGQNKANPTALLLSSCMMLNY 327
                             AN G + ++FE        DI GQN ANPTA++LSS +MLN+
Sbjct: 254 -LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSVLMLNH 312

Query: 328 MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           +GL  Y+ +I  A+  TIA G ++ T D+ G+++T+ FT  +I  L
Sbjct: 313 LGLNEYATRISKAVHETIAEG-KHTTKDIGGSSSTTDFTNEIINKL 357

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  259 bits (663), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 150/376 (39%), Positives = 218/376 (57%), Gaps = 20/376 (5%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLR    + S RR    S  L            P    GR+TV  I GDGVG E++ SV 
Sbjct: 1   MLRNTFVQISKRRFALASGQLL-----------PKKYGGRYTVTLIPGDGVGKEVTDSVV 49

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLATPIGK-GHRSLN 119
           +IF+A  VP+DWE  ++S L  N      + AV+ + ++K+ LKG  +TP  + GH SLN
Sbjct: 50  NIFEAENVPIDWESVELSGLEEN--MEGVQKAVESLKRNKVGLKGIWSTPADQTGHGSLN 107

Query: 120 LTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLI 179
           +  RK   +FANV   +S  G +T  K+VDLV+IRENTEGEYSG+EH   PGVV+S+K++
Sbjct: 108 VAFRKQLDIFANVALFKSFPGVKTKLKDVDLVIIRENTEGEYSGLEHESVPGVVESLKIM 167

Query: 180 TRDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKEL-APEFPDIKLETE 238
           T+  SER+ R+A+++A    R  +  VHK+ I KL DGLF N   E+ A E+P++++++ 
Sbjct: 168 TKAKSERIARFAFDFALKNNRRSVCAVHKANIMKLGDGLFRNTVNEIGAKEYPELEVKSI 227

Query: 239 LIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFE- 297
           ++DN  +  V  P  +   V V PNLYG I                  AN G E ++FE 
Sbjct: 228 IVDNASMQAVAKPHQFD--VLVTPNLYGSI-LGNVGAALIGSPGLVPGANFGREYAVFEP 284

Query: 298 AVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLA 357
                  DI GQ+ ANPTA++LSS +ML ++GL  Y+++I  A    IA G ++ T D+ 
Sbjct: 285 GSRHVGLDIKGQDVANPTAMILSSTLMLRHLGLNDYADRISKATYEVIAEG-KHTTKDIG 343

Query: 358 GTATTSSFTESVIKNL 373
           G A+T+ FT++++  L
Sbjct: 344 GHASTTQFTKAIVDKL 359

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  259 bits (663), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 145/343 (42%), Positives = 208/343 (60%), Gaps = 10/343 (2%)

Query: 34  PNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAV 93
           P    GR+TV  I GDGVG E++ SV  IF+   +P+DWE  D+S L     T   + AV
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVKIFENENIPIDWETIDISGL---ENTENVQRAV 79

Query: 94  QQINKHKIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152
           + + ++K+ LKG   TP  + GH SLN+ LRK   +FANV   +SI G +T   N+D+V+
Sbjct: 80  ESLKRNKVGLKGIWHTPADQTGHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVI 139

Query: 153 IRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVVHKSTIQ 212
           IRENTEGEYSG+EH   PGVV+S+K++TR  SER+ R+A+++A    R  +  VHK+ I 
Sbjct: 140 IRENTEGEYSGLEHESVPGVVESLKIMTRAKSERIARFAFDFALKNNRKSVCAVHKANIM 199

Query: 213 KLADGLFVNIAKEL-APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXX 271
           KL DGLF N   E+ A E+P++ ++  ++DN  +  V  P  +   V V PNLYG I   
Sbjct: 200 KLGDGLFRNTVNEIGANEYPELDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI-LG 256

Query: 272 XXXXXXXXXXXXXXXANIGNEVSIFE-AVHGSAPDIAGQNKANPTALLLSSCMMLNYMGL 330
                          AN G E ++FE        DI GQN ANPTA++LSS +ML ++GL
Sbjct: 257 NIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLRHLGL 316

Query: 331 ESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
            +Y+++I  A  + I+ G ++ T D+ G+A+TS FT +VI+ L
Sbjct: 317 NAYADRISKATYDVISEG-KSTTRDIGGSASTSEFTNAVIEKL 358

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  257 bits (656), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 208/346 (60%), Gaps = 16/346 (4%)

Query: 34  PNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLTTIPE--- 90
           P    GRFTV  I GDGVG EI+ SV+ IF+A  +P+DWE  ++        T   E   
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAENIPIDWETINIKQ------TDHKEGVY 75

Query: 91  PAVQQINKHKIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVD 149
            AV+ + ++KI LKG   TP  + GH SLN+ LRK   ++ANV   +S++G +T   ++D
Sbjct: 76  EAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDID 135

Query: 150 LVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVVHKS 209
           L++IRENTEGE+SG+EH   PGVV+S+K++TR  +ER+ R+A+++A+   R  +  VHK+
Sbjct: 136 LIVIRENTEGEFSGLEHESVPGVVESLKVMTRPKTERIARFAFDFAKKYNRKSVTAVHKA 195

Query: 210 TIQKLADGLFVNIAKELA-PEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDI 268
            I KL DGLF NI  E+   E+PDI + + ++DN  +  V  P  +   V V P++YG I
Sbjct: 196 NIMKLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI 253

Query: 269 XXXXXXXXXXXXXXXXXXANIGNEVSIFE-AVHGSAPDIAGQNKANPTALLLSSCMMLNY 327
                             AN G + ++FE        DI GQN ANPTA++LSS +MLN+
Sbjct: 254 -LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLMLNH 312

Query: 328 MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           +GL  Y+ +I  A+  TIA G ++ T D+ G+++T+ FT  +I  L
Sbjct: 313 LGLNEYATRISKAVHETIAEG-KHTTRDIGGSSSTTDFTNEIINKL 357

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  256 bits (653), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 143/345 (41%), Positives = 210/345 (60%), Gaps = 14/345 (4%)

Query: 34  PNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLTTIP--EP 91
           P    GR+TV  I GDGVG E++ SV  IF++  VP+DWE  ++S     GL      + 
Sbjct: 22  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENVPIDWETVEIS-----GLDNEEGVQK 76

Query: 92  AVQQINKHKIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDL 150
           AV  + ++K+ LKG   TP  + GH SLN+ LRK   +FANV   +++ G  + + NVDL
Sbjct: 77  AVDSLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVDL 136

Query: 151 VLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVVHKST 210
           V+IRENTEGEYSG+EH   PGVV+S+K++T+  S+R+ R+A+++A    R  +  VHK+ 
Sbjct: 137 VVIRENTEGEYSGLEHESVPGVVESLKIMTKAKSDRIGRFAFDFALKNNRKSVCAVHKAN 196

Query: 211 IQKLADGLFVNIAKEL-APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIX 269
           I KL DGLF N   E+ A E+P+I+++  ++DN  +  V  P  +   V V PNLYG I 
Sbjct: 197 IMKLGDGLFRNCINEIGAKEYPEIEVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI- 253

Query: 270 XXXXXXXXXXXXXXXXXANIGNEVSIFE-AVHGSAPDIAGQNKANPTALLLSSCMMLNYM 328
                            AN G E ++FE        DI GQN ANPTA++LSS +ML ++
Sbjct: 254 LGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAMILSSALMLRHL 313

Query: 329 GLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           GL SY+++I  A  + IA  ++N T D+ G+A+T+ FT+++I+ L
Sbjct: 314 GLNSYADRISKATYDVIAE-AKNTTKDIGGSASTTDFTQAIIEKL 357

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  255 bits (651), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 152/377 (40%), Positives = 219/377 (58%), Gaps = 19/377 (5%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           M +T+ AK+         +T+  +G  G     P    GR+TV  I GDGVG E++ SV 
Sbjct: 1   MFKTVLAKRGL-------ATVPATGFRGFLNPLPKEYGGRYTVTLIPGDGVGKEVTDSVV 53

Query: 61  DIFKAAQVPVDWEYCDVSPL-LINGLTTIPEPAVQQINKHKIALKGPLATPIGKG-HRSL 118
            IF A  +P+DWE  D+S L    G+    E AV  + ++KI LKG   T  G+  H SL
Sbjct: 54  SIFNAENLPIDWERVDISGLDHEEGV----EAAVNSLKRNKIGLKGIWHTSAGQSDHGSL 109

Query: 119 NLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKL 178
           N+ LRK   ++ANV   +++ G +T   +VDLV+IRENTEGEYSG+EH   PGVV+S+K+
Sbjct: 110 NVALRKQLDIYANVAHFKTLPGVKTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKI 169

Query: 179 ITRDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAP-EFPDIKLET 237
           IT++ SER+ R+A+++A+   R  +  VHK+ I KL DGLF N    +   E+PDIK+ +
Sbjct: 170 ITKEKSERIARFAFDFAKRFDRKLVTAVHKANIMKLGDGLFRNSVTSIGETEYPDIKVSS 229

Query: 238 ELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFE 297
            ++DN  +  V  P  +   V V P++YG I                  AN G E ++FE
Sbjct: 230 IIVDNASMQSVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVPGANYGTECAVFE 286

Query: 298 -AVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDL 356
                   DI GQN ANPTA++LSS ++L ++GL + + KIE+A+  TIA G    T D+
Sbjct: 287 PGSRHVGLDIKGQNVANPTAMILSSTLLLKHLGLNNEAKKIEDAVYKTIAEGKVT-TRDI 345

Query: 357 AGTATTSSFTESVIKNL 373
            G+A+T+ FT  +IK L
Sbjct: 346 GGSASTTEFTNEIIKKL 362

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  254 bits (648), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 142/345 (41%), Positives = 208/345 (60%), Gaps = 14/345 (4%)

Query: 34  PNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLTTIP--EP 91
           P    GR+TV  I GDGVG E++ SV  IF++  +P+DWE  ++S     GL      + 
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFESENIPIDWETVEIS-----GLDNQEGVQK 77

Query: 92  AVQQINKHKIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDL 150
           AV+ + ++K+ LKG   TP  + GH SLN+ LRK   +FANV   +S+ G  + + NVD+
Sbjct: 78  AVESLKRNKVGLKGIWHTPSDQTGHGSLNVALRKQLDIFANVALFKSVPGVPSRHSNVDM 137

Query: 151 VLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVVHKST 210
           V+IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ R+A+++A    R  +  VHK+ 
Sbjct: 138 VVIRENTEGEYSGLEHESVPGVVESLKIMTKAKSERIGRFAFDFAVKNNRKSVCAVHKAN 197

Query: 211 IQKLADGLFVNIAKEL-APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIX 269
           I KL DGLF N   E+ A E+P+I ++  ++DN  +  V  P  +   V V PNLYG I 
Sbjct: 198 IMKLGDGLFRNCINEVGAKEYPEIDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI- 254

Query: 270 XXXXXXXXXXXXXXXXXANIGNEVSIFE-AVHGSAPDIAGQNKANPTALLLSSCMMLNYM 328
                            AN G E ++FE        DI GQN ANPTA++LSS +ML ++
Sbjct: 255 LGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSSLMLRHL 314

Query: 329 GLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           GL +Y+++I  A  + IA  ++  T D+ G+A+T+ FTE++I  L
Sbjct: 315 GLNAYADRISKATYDVIAE-AKTTTQDIGGSASTTEFTEAIISKL 358

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  253 bits (647), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 141/346 (40%), Positives = 208/346 (60%), Gaps = 16/346 (4%)

Query: 34  PNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLTTIPE--- 90
           P    GRFTV  I GDGVG EI+ SV+ IF+A ++PVDWE  ++        T   E   
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEITDSVRTIFEAERIPVDWETINIKQ------TDHKEGVY 75

Query: 91  PAVQQINKHKIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVD 149
            AV+ + ++KI LKG   TP  + GH SLN+ LRK   ++ANV   +S++G +T   ++D
Sbjct: 76  EAVESLKRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDID 135

Query: 150 LVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVVHKS 209
           L++IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+A+++A+   R  +  VHK+
Sbjct: 136 LIVIRENTEGEFSGLEHESVPGVVESLKVMTKPKTERIARFAFDFAKKYNRKAVTAVHKA 195

Query: 210 TIQKLADGLFVNIAKELAP-EFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDI 268
            I KL DGLF NI  E+   E+PDI + + ++DN  +  V  P  +   V V P++YG I
Sbjct: 196 NIMKLGDGLFRNIITEIGQTEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI 253

Query: 269 XXXXXXXXXXXXXXXXXXANIGNEVSIFE-AVHGSAPDIAGQNKANPTALLLSSCMMLNY 327
                             AN G + ++FE        DI GQN ANPTA++LSS +MLN+
Sbjct: 254 -LGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSSVLMLNH 312

Query: 328 MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           +GL   + +I  A+  TIA G ++ T D+ G+++T+ FT  VI  L
Sbjct: 313 LGLNENATRISKAVHETIAEG-KHTTRDIGGSSSTTDFTNEVINKL 357

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  253 bits (645), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 220/365 (60%), Gaps = 12/365 (3%)

Query: 14  LFSTSSTLRVSGQVGKY-KGSPNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDW 72
           +F  S T R    V    K  P    GR+TV  I GDGVG E++ SV  IFKA  VPVDW
Sbjct: 1   MFRHSLTKRTLATVATTEKMLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFKAENVPVDW 60

Query: 73  EYCDVSPLLINGLTTIPEPAVQQINKHKIALKGPLAT-PIGK-GHRSLNLTLRKTFGLFA 130
           +  D+S +         + AV+ + +++I LKG   T P  + GH SLN+ LRK   ++A
Sbjct: 61  DRVDISGV---DRAEDVKSAVESLKRNRIGLKGIWHTSPADQAGHGSLNVALRKELDIYA 117

Query: 131 NVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRY 190
           NV   +SI G +    +VDLV+IRENTEGE+SG+EH   PGVV+S+K++T+D  ER+ R+
Sbjct: 118 NVARFKSIPGVQVKIPDVDLVVIRENTEGEFSGLEHESVPGVVESLKIMTQDNIERIARF 177

Query: 191 AYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELA-PEFPDIKLETELIDNTVLNVVR 249
           A++YA+   R ++V VHK+ I K+ DGLF N+ +E+   E+P++++   ++DN  +  V 
Sbjct: 178 AFDYAKKNDRKQVVAVHKANIMKMGDGLFKNLVQEVGEKEYPELQVGNIIVDNASMQTVA 237

Query: 250 DPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFE-AVHGSAPDIAG 308
           +P  +   V V P++YG I                  AN G +V++FE        DI G
Sbjct: 238 NPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANYGRDVALFEPGSRHVGLDIKG 294

Query: 309 QNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTES 368
           QN ANPTA++LSS ++LN++GL + +++I  A+   IA G ++ T D+ GTA+T+ FTE+
Sbjct: 295 QNVANPTAMILSSVLLLNHLGLNTSADRISKAVHAVIAEG-KSVTRDIGGTASTTEFTEA 353

Query: 369 VIKNL 373
           VI  L
Sbjct: 354 VINKL 358

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  252 bits (644), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 142/345 (41%), Positives = 208/345 (60%), Gaps = 14/345 (4%)

Query: 34  PNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLTTIP--EP 91
           P    GR+TV  I GDGVG E++ SV  IF+A  VP+DWE  +++     G+ +    + 
Sbjct: 23  PKKYGGRYTVTLIPGDGVGKEVTDSVVSIFEAENVPIDWETINIT-----GVDSEEGVQK 77

Query: 92  AVQQINKHKIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDL 150
           AV+ + ++KI LKG   TP  + GH SLN+  RK   +FANV   +++ G +T   N+DL
Sbjct: 78  AVESLKRNKIGLKGIWHTPADQTGHGSLNVAFRKQLDIFANVALFKNVPGVKTKLSNIDL 137

Query: 151 VLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVVHKST 210
           V+IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+A+++A    R  +  VHK+ 
Sbjct: 138 VVIRENTEGEYSGLEHESVPGVVESLKIITKAKSERIARFAFDFALKNNRKSVCAVHKAN 197

Query: 211 IQKLADGLFVNIAKEL-APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIX 269
           I KL DGLF N   E+ A E+P+I ++  ++DN  +  V  P  +   V V PNLYG I 
Sbjct: 198 IMKLGDGLFRNTVNEVGASEYPEIDVKNIIVDNASMQAVAKPHQFD--VLVTPNLYGSI- 254

Query: 270 XXXXXXXXXXXXXXXXXANIGNEVSIFE-AVHGSAPDIAGQNKANPTALLLSSCMMLNYM 328
                            AN G E ++FE        DI G++ ANPTA++LSS +ML ++
Sbjct: 255 LGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGKDLANPTAMILSSTLMLRHL 314

Query: 329 GLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           GL  Y+++I  A  + IA G ++ T D+ G+++T+ FT+SVI  L
Sbjct: 315 GLNGYADRISKATYDVIAEG-KHTTKDIGGSSSTTEFTKSVIDKL 358

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  246 bits (628), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 147/379 (38%), Positives = 218/379 (57%), Gaps = 27/379 (7%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLR+   K    R+F++ +           K  P    GRF V  I GDGVG E++ SV 
Sbjct: 1   MLRSAVGK----RMFASVAAAE--------KVLPKKYGGRFVVTLIPGDGVGKEVTDSVV 48

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAVQQINKHKIALKG----PLATPIGKGHR 116
            IF+A  +P+DW+  D+S L         + AV  + ++KI LKG      A   GKG  
Sbjct: 49  SIFEAENLPIDWDRVDISGL---DHEEGVQAAVDSLKRNKIGLKGIWHTSAADQAGKG-- 103

Query: 117 SLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSI 176
           SLN+ LRK   ++ANV   +S+ G +T   NVDLV+IRENTEGEYSG+EH   PGVV+S+
Sbjct: 104 SLNVALRKELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESVPGVVESL 163

Query: 177 KLITRDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELAP-EFPDIKL 235
           K++T D +ER+ R+A+++A+   R  +  VHK+ I KL DGLF N+   +   E+PD+K+
Sbjct: 164 KIMTEDKTERIARFAFDFAKKYNRHAVTAVHKANIMKLGDGLFRNVVTRVGEQEYPDVKV 223

Query: 236 ETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSI 295
            + ++DN  +  V  P  +   V V P++YG I                  AN G E ++
Sbjct: 224 GSIIVDNASMQTVAKPHQFD--VLVTPSMYGTI-LGNIGAALIGGPGLVAGANYGREYAV 280

Query: 296 FE-AVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTG 354
           FE        DI  +N ANPTA++LS+ +ML+++GL + + KI NA+   IA G ++ T 
Sbjct: 281 FEPGSRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIAEG-KSTTP 339

Query: 355 DLAGTATTSSFTESVIKNL 373
           D+ G+A+T+ FT++VI+ L
Sbjct: 340 DIGGSASTTEFTQAVIEKL 358

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  245 bits (626), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 140/343 (40%), Positives = 204/343 (59%), Gaps = 10/343 (2%)

Query: 34  PNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAV 93
           P    GR+TV  I GDGVG EI+ SV  IF+A  +PVDWE  D+S    + +  + + AV
Sbjct: 20  PKKYGGRYTVTLIPGDGVGKEITDSVVSIFEAENIPVDWERVDISTS--DNIQDVSQ-AV 76

Query: 94  QQINKHKIALKGPLATPIG-KGHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152
           + + ++KI LKG   T      H S N+ LRK   +FA+V   +S+ G +T   NVDLV+
Sbjct: 77  ESLKRNKIGLKGIWHTSADIADHGSFNVALRKQLDMFAHVAFFKSVPGVKTKIPNVDLVV 136

Query: 153 IRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVVHKSTIQ 212
           IRENTEGEYSG+EH   PGVV+S+K+IT+  SER+ R+A+++A+   R  +  VHK+ I 
Sbjct: 137 IRENTEGEYSGLEHESVPGVVESLKIITKAKSERIARFAFDFAKKYNRKSVCAVHKANIM 196

Query: 213 KLADGLFVNIAKEL-APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXX 271
           K+ DGLF N   E+ A E+PDI+  + ++DN  +  V  P  +   V V P++YG I   
Sbjct: 197 KMGDGLFRNTVTEIGANEYPDIQTSSIIVDNASMQAVAKPHQFD--VMVTPSMYGTI-IG 253

Query: 272 XXXXXXXXXXXXXXXANIGNEVSIFE-AVHGSAPDIAGQNKANPTALLLSSCMMLNYMGL 330
                          A+ G E ++FE        DI G+N ANPTA++LSS +ML ++GL
Sbjct: 254 NIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDIKGKNVANPTAMILSSTLMLQHLGL 313

Query: 331 ESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
              + +I  A  + I+ G +  T D+ G+A+T+ FTE++IK L
Sbjct: 314 TESAKRIAKATHDVISLG-QVTTKDIGGSASTTEFTEAIIKRL 355

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  246 bits (627), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 142/345 (41%), Positives = 200/345 (57%), Gaps = 13/345 (3%)

Query: 34  PNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPL-LINGLTTIPEPA 92
           PN   GR+TV  + GDGVG E + SV  +F A  +P+DWE  ++S L    G+      A
Sbjct: 20  PNKYGGRYTVTLLPGDGVGKECTDSVVSVFNAENIPIDWEIVNISGLDHKEGVAA----A 75

Query: 93  VQQINKHKIALKGPLATPIG--KGHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDL 150
           VQ + ++KI LKG   T      GH SLN+  RK   ++ANV   +S++G +T   +VDL
Sbjct: 76  VQSLRRNKIGLKGLWHTSNADQSGHGSLNVAFRKQLDIYANVAVFKSLKGVKTMIPDVDL 135

Query: 151 VLIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVVHKST 210
           V+IRENTEGE+SG+EH    GVV+S+K+ T   +ER+ R+A+ YA+  GR  +  VHK+ 
Sbjct: 136 VVIRENTEGEFSGLEHESVEGVVESLKVTTLPKTERIARFAFNYAQKNGRKAVCAVHKAN 195

Query: 211 IQKLADGLFVNIAKELA-PEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIX 269
           I KL DGLF N    +   E+PDI+  + ++DN  +  V  P  +   V V P++YG I 
Sbjct: 196 IMKLGDGLFRNTVTSIGEKEYPDIETSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI- 252

Query: 270 XXXXXXXXXXXXXXXXXANIGNEVSIFE-AVHGSAPDIAGQNKANPTALLLSSCMMLNYM 328
                            AN G E ++FE        DI GQN ANPTA+LLSS +MLN++
Sbjct: 253 IGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQNIANPTAMLLSSALMLNHL 312

Query: 329 GLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           GL     +I +A+   IA G + RT D+ G ATT+ FT++VI+ L
Sbjct: 313 GLTKSGKRISDAVREVIAEG-DVRTKDIGGDATTTEFTQAVIEKL 356

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  244 bits (622), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 147/378 (38%), Positives = 213/378 (56%), Gaps = 26/378 (6%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLR + +K+S        + +            P    GR+TV  I GDG+G E++ SV 
Sbjct: 1   MLRQVVSKRSIASFTKNHNIV------------PKKYGGRYTVTLIPGDGIGKEVTDSVV 48

Query: 61  DIFKAAQVPVDWEYCDVSPLLINGLTTIPE--PAVQQINKHKIALKGPLATPIGK-GHRS 117
            IF +  +P+DWE  DV      G++   E   AV+ + ++KI LKG   T   + G+ S
Sbjct: 49  KIFASQGLPIDWERIDVP-----GMSNENEVKKAVESLKRNKIGLKGIWHTSADQTGYGS 103

Query: 118 LNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPGVVQSIK 177
           LN+ LRK   +FANV   +S++G +T   +VDLV+IRENTEGEYSG+EH   PGVV+S+K
Sbjct: 104 LNVALRKQLDIFANVAIFKSLKGVKTKIPDVDLVVIRENTEGEYSGLEHESVPGVVESLK 163

Query: 178 LITRDASERVIRYAYEYARAIGRPRLVVVHKSTIQKLADGLFVNIAKELA-PEFPDIKLE 236
           +IT+  +ER+ R+A+++A    R  +  VHK+ I KL+DGLF N   E+   E+PDIK+ 
Sbjct: 164 IITKPKTERIARFAFDFALENNRSTVTAVHKANIMKLSDGLFKNTVAEVGEKEYPDIKVN 223

Query: 237 TELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIF 296
           T ++DN  +  V  P  +   V V P++YG I                  AN G E ++F
Sbjct: 224 TIIVDNASMQAVAKPHQFD--VMVTPSMYGTI-LGNIGAALIGGPGLIPGANYGREHAVF 280

Query: 297 E-AVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGD 355
           E        DI  QN ANPTA++LS+ +MLN +GL   S +I NA+   I  G +  T D
Sbjct: 281 EPGSRHVGLDIENQNIANPTAMILSATLMLNQLGLREESKRISNAVYAVIEEG-KTTTKD 339

Query: 356 LAGTATTSSFTESVIKNL 373
           + G A+T+ FT++VI  L
Sbjct: 340 IGGNASTTEFTDAVIDKL 357

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  241 bits (616), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 138/343 (40%), Positives = 200/343 (58%), Gaps = 11/343 (3%)

Query: 34  PNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPL-LINGLTTIPEPA 92
           P    GR TV  + GDGVG EI+ SV  IF+A  VP+DWE  D+S L   +G+      A
Sbjct: 22  PKKYGGRMTVTLLPGDGVGKEITDSVVSIFQAENVPIDWETVDISQLDHEDGVNA----A 77

Query: 93  VQQINKHKIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLV 151
           V+ + ++KI LKG   T   + GH SLN+  RK   ++ANV   +SI G +T   NVDLV
Sbjct: 78  VESLKRNKIGLKGIWHTSADQVGHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDLV 137

Query: 152 LIRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVVHKSTI 211
           +IRENTEGEYSG+EH   PGVV+S+K++T+  SER+ ++A+++A    R  +  VHK+ I
Sbjct: 138 IIRENTEGEYSGLEHESVPGVVESLKIVTKVNSERIAKFAFDFAMRHDRKMVTAVHKANI 197

Query: 212 QKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXX 271
            KL+DGLF N    +   +P IK ++ ++DN  +  V  P  +   V V P++YG I   
Sbjct: 198 MKLSDGLFRNTVARVGEAYPQIKNDSIIVDNASMQAVAKPHQFD--VMVTPSMYGTI-LG 254

Query: 272 XXXXXXXXXXXXXXXANIGNEVSIFE-AVHGSAPDIAGQNKANPTALLLSSCMMLNYMGL 330
                           N G E ++FE        DI GQN ANPTA++LSS ++L ++GL
Sbjct: 255 NIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSTLLLQHLGL 314

Query: 331 ESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
              +++I  A+ + I  G+   T D+ G A+T+ FT++VI  L
Sbjct: 315 NDTASRISKAVYDVIKEGNAT-TKDIGGNASTTEFTKAVIDKL 356

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  241 bits (615), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 137/343 (39%), Positives = 201/343 (58%), Gaps = 11/343 (3%)

Query: 34  PNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAV 93
           P    GR+TV  + GDGVG EI+ SV  IF+A  +P+DWE  ++S L    + T    AV
Sbjct: 22  PKKYGGRYTVTLLPGDGVGREITDSVVSIFEAENLPIDWERVELSGLEQEDVHT----AV 77

Query: 94  QQINKHKIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152
           + + ++KI LKG   T     GH S N+ LRK   ++ANV   +S +G +T   +VDLV+
Sbjct: 78  ESLKRNKIGLKGIWHTSADHDGHTSWNVALRKELDIYANVAIFKSFKGVDTRIPDVDLVI 137

Query: 153 IRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVVHKSTIQ 212
           IRENTEGEYSG+EH   PGVV+S+K++T   +ER+ R+A++YA    R  +  VHK+ I 
Sbjct: 138 IRENTEGEYSGLEHESVPGVVESLKIMTAQKTERIARFAFDYAMKYNRKSVTAVHKANIM 197

Query: 213 KLADGLFVNIAKEL-APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXX 271
           KL DGLF N+  E+ A E+P++ + + ++DN  +  V  P  +   V V P++YG I   
Sbjct: 198 KLGDGLFRNLVTEIGAKEYPEVGVSSIIVDNASMQAVAKPHQFD--VMVAPSMYGTI-LG 254

Query: 272 XXXXXXXXXXXXXXXANIGNEVSIFE-AVHGSAPDIAGQNKANPTALLLSSCMMLNYMGL 330
                          AN G + ++FE        DI  QN ANPTA++LS+ +MLN++G 
Sbjct: 255 NIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGLDIENQNIANPTAMILSATLMLNHLGF 314

Query: 331 ESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
            + + +I  A+   IA G +  T D+ G+ATT+ FT +VI  L
Sbjct: 315 RNDAARISKAVHEVIAEG-KTTTRDIGGSATTTEFTNAVIAKL 356

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  235 bits (600), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 137/343 (39%), Positives = 202/343 (58%), Gaps = 13/343 (3%)

Query: 33  SPNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLTTIPEPA 92
           SP    GRF +  I G+G+G E++ SV+ IF+A  +P+DWE  ++     +G+ T    A
Sbjct: 15  SPKKYGGRFQITLIPGNGIGKEVTDSVRSIFQAENLPIDWEIVNIESHR-DGIKT----A 69

Query: 93  VQQINKHKIALKGPLATPIGKGHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152
           V  I ++KIALKG  ++    G  SLN+ LRK   +FANV   +S     T   NVDLV+
Sbjct: 70  VDSIKRNKIALKGIWSSDPIDG--SLNVALRKQLDIFANVAIFKSFDNVNTRIPNVDLVV 127

Query: 153 IRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVVHKSTIQ 212
           IRENTEGE+SG+EH    GVV+S+K++T+  +ER+ R+A+++A+   R  +  VHK+ I 
Sbjct: 128 IRENTEGEFSGLEHESVDGVVESLKIVTKPKTERIARFAFDFAKKHNRNHVTAVHKANIM 187

Query: 213 KLADGLFVNIAKELA-PEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXX 271
           KL DGLF NI   +   E+P+IK  + ++DN  +  V  P  +   V V P++YG I   
Sbjct: 188 KLGDGLFKNIVAHIGNNEYPEIKNSSIIVDNASMQAVAKPHQFD--VLVSPSMYGTI-LG 244

Query: 272 XXXXXXXXXXXXXXXANIGNEVSIFE-AVHGSAPDIAGQNKANPTALLLSSCMMLNYMGL 330
                          AN G + ++FE        DI GQN ANPTA++LS+  ML ++GL
Sbjct: 245 NIGAALIGGPGLVPGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSATWMLRHLGL 304

Query: 331 ESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
            S + +I NA+ + IA G+   T D+ GTA+T+ FT++VI  L
Sbjct: 305 TSPAERITNAVKHVIAQGT-TVTKDIGGTASTTEFTDAVINEL 346

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  206 bits (524), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 115/285 (40%), Positives = 169/285 (59%), Gaps = 9/285 (3%)

Query: 34  PNPSTGRFTVPFIEGDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLTTIPEPAV 93
           P    GRFTV  I GDGVG E++ SVK IF+A  +P+DWE  ++     +    + E AV
Sbjct: 22  PKKYGGRFTVTLIPGDGVGKEVTDSVKTIFEAENIPIDWETINIKQ--TDHKEGVNE-AV 78

Query: 94  QQINKHKIALKGPLATPIGK-GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152
           + + ++KI LKG   TP  + GH SLN+ LRK   ++ANV   +S++G +T   ++DL++
Sbjct: 79  ESLRRNKIGLKGLWHTPADQTGHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 153 IRENTEGEYSGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVVHKSTIQ 212
           IRENTEGE+SG+EH   PGVV+S+K++T+  +ER+ R+A+++A+   R  +  VHK+ I 
Sbjct: 139 IRENTEGEFSGLEHESVPGVVESLKIMTKPKTERIARFAFDFAKKYNRKAVTAVHKANIM 198

Query: 213 KLADGLFVNIAKELA-PEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXX 271
           KL DGLF NI  E+   E+PDI + + ++DN  +  V  P  +   V V P++YG I   
Sbjct: 199 KLGDGLFRNIITEIGQKEYPDIDVSSIIVDNASMQAVAKPHQFD--VLVTPSMYGTI-LG 255

Query: 272 XXXXXXXXXXXXXXXANIGNEVSIFE-AVHGSAPDIAGQNKANPT 315
                          AN G + ++FE        DI GQN ANPT
Sbjct: 256 NIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPT 300

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  158 bits (400), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/360 (29%), Positives = 187/360 (51%), Gaps = 27/360 (7%)

Query: 35  NPSTGRFTVPFIEGDGVGPEISKSVKDIFK--AAQVPVDWEYCDVSPLLINGLTT---IP 89
           N +    T+  I GDG+G E+  + K + +    +  +D+++ D+       L T   +P
Sbjct: 17  NGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKFIDLHAGWQTFLDTGKALP 76

Query: 90  EPAVQQINKH-KIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYK 146
           +  V  + +  + AL G + +P  K  G+ S  + LRK  GL+AN+RP +S+ G  T  +
Sbjct: 77  DETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGLYANIRPVKSVSG--TNDR 134

Query: 147 NVDLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAYEYA----RA 197
            VD+V++RENTE  Y     + I+      V ++ K I+  A+ ++ + A + A    + 
Sbjct: 135 PVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATRKIAKIALDIALQRLKN 194

Query: 198 IGRPRLVVVHKSTIQKLADGLFVNIAKELAPE----FPDIKLETELIDNTVLNVVRDPPS 253
            G+  L V HKS +   +DGLF  + +++  +    + ++    +++D+ V  + R+P  
Sbjct: 195 TGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNEQIVDSMVYRIFREPEC 254

Query: 254 YTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKAN 313
           +   V V PNLYGDI                  AN+G ++ I E  HGSAPDI+GQ  +N
Sbjct: 255 FD--VVVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPDIIIGEPCHGSAPDISGQGISN 311

Query: 314 PTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           P A + S+ +ML ++G    +  I+NA+   I SG + +T DL G ++T+  T+ ++  L
Sbjct: 312 PVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSG-KIKTPDLGGDSSTTEVTDDILSKL 370

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  157 bits (397), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 122/397 (30%), Positives = 198/397 (49%), Gaps = 49/397 (12%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLRT A++ +  R ++T++  +                   T+  I GDG+G E+  + K
Sbjct: 1   MLRTTASRLATCRGYATNAIRK-----------------NLTIGLIPGDGIGKEVIPAGK 43

Query: 61  DIFKA--AQVPVDWEYCDVSPLLINGLTT---IPEPAVQQI-NKHKIALKGPLATPIGK- 113
            + +   ++  +++++ D+       L T   +P+  +Q + N+ + AL G + +P  K 
Sbjct: 44  QVLQNLNSKHGLNFDFIDLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKV 103

Query: 114 -GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEG------EYSGIEH 166
            G+ S  + LRK  GL+ANVRP +S+ G  TT K VD+V++RENT        E + I+ 
Sbjct: 104 EGYSSPIVALRKEMGLYANVRPVKSVEG--TTDKPVDMVIVRENTRRFINIKLERTYIDR 161

Query: 167 VVAPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLFVNI 222
                V ++ K I+  A+ R+   A + A    +  G+  L V HKS +   +DGLF  I
Sbjct: 162 ATGTRVAEATKRISEIATRRIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREI 221

Query: 223 AKEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXX 278
            K++      ++  I    +++D+ V  + R+P  +   V V PNLYGDI          
Sbjct: 222 CKDVYESNKDKYGQINYNEQIVDSMVYRMFREPQCFD--VVVAPNLYGDILSDGAAALVG 279

Query: 279 XXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIE 338
                   AN+G E+ I E  HGSAPDIAG+  +NP A + S+ +ML ++G    +  I 
Sbjct: 280 SLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIH 338

Query: 339 NAILNTIASGSEN--RTGDLAGTATTSSFTESVIKNL 373
            A+    A+  EN  +T DL G +TT   TE V+  L
Sbjct: 339 RAVE---ANLKENKVKTPDLGGKSTTQEVTEDVLARL 372

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  156 bits (394), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 130/396 (32%), Positives = 196/396 (49%), Gaps = 46/396 (11%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLRT A++      F+TS T R          + N      T+  I GDG+G E+  + K
Sbjct: 1   MLRTAASR------FATS-TCRTY--------ATNALRKNLTIGLIPGDGIGKEVIPAGK 45

Query: 61  DIFKA--AQVPVDWEYCDVSPLLINGLTT---IPEPAVQQINKH-KIALKGPLATPIGK- 113
            + +   ++  + +++ D+       L T   +P+  VQ +    + AL G + +P  K 
Sbjct: 46  QVLENLNSKHGLKFDFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKV 105

Query: 114 -GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVV---A 169
            G+ S  + LRK  GLFANVRP +S+ G  T  + VD+V++RENTE  Y  IE      A
Sbjct: 106 EGYSSPIVALRKEMGLFANVRPVKSVSG--TKDRPVDMVIVRENTEDLYIKIEKTYIDKA 163

Query: 170 PG--VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLFVNIA 223
            G  V ++ K I+  A+ R+   A + A    +  G+  L V HKS +   +DGLF  I 
Sbjct: 164 TGTRVAEATKRISEIATRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREIC 223

Query: 224 KEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXX 279
           K++      ++  I    +++D+ V  + R+P  +   V V PNLYGDI           
Sbjct: 224 KDVYESNKDKYGSITYNEQIVDSMVYRMFREPQCFD--VIVAPNLYGDILSDGAAALVGS 281

Query: 280 XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIEN 339
                  AN+G E+ I E  HGSAPDIAG+  ANP A + S+ +ML ++G    +  I  
Sbjct: 282 LGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHR 340

Query: 340 AILNTIASGSEN--RTGDLAGTATTSSFTESVIKNL 373
           A+    A+  EN  +T DL G +TT   TE V+  L
Sbjct: 341 AVE---ANMRENKIKTPDLGGNSTTQQVTEDVLARL 373

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  154 bits (390), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 120/394 (30%), Positives = 195/394 (49%), Gaps = 43/394 (10%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLR  A + +A R FS++   + +                 T+  I GDG+G E+  + K
Sbjct: 1   MLRGSATRLTAMRGFSSTRLAQKA----------------LTIGLIPGDGIGKEVIPAGK 44

Query: 61  DIFKAA--QVPVDWEYCDVSP---LLINGLTTIPEPAVQQINKH-KIALKGPLATPIGK- 113
            I +    +  +D+++ D+        N    +P+  V+ + +  + AL G + +P  K 
Sbjct: 45  QILEKVGPKFDLDFKFIDLHAGWETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKV 104

Query: 114 -GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVV---A 169
            G+ S  + LRK  GLFANVRP +++ G  T  + VD+V++RENTE  Y  IE      A
Sbjct: 105 EGYSSPIVALRKAMGLFANVRPVKAVEG--TNDRPVDMVIVRENTEDLYIKIEKTYTDPA 162

Query: 170 PG--VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLFVNIA 223
            G  V ++ K I+  A+ R+   A + A    ++ G   L V HKS +   +DGLF  I 
Sbjct: 163 TGTRVAEATKRISEVATRRIATIALDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREIC 222

Query: 224 KEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXX 279
           K++      ++  I+   +++D+ V  + R+P  +   V V PNLYGDI           
Sbjct: 223 KDVYESNKDKYGKIQYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAALVGS 280

Query: 280 XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIEN 339
                  AN+G E+ I E  HGSAPDIAG+  ANP A + S+ +ML ++G    +  I  
Sbjct: 281 LGVVPS-ANVGPEIVIGEPCHGSAPDIAGRGIANPIATIRSTALMLEFLGYPEAAQPIYK 339

Query: 340 AILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           A+ + I   ++ +T DL G +TT    + ++  +
Sbjct: 340 AVDSNIRE-NQIKTPDLGGKSTTQQVVDDILSKI 372

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  153 bits (386), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 124/398 (31%), Positives = 192/398 (48%), Gaps = 52/398 (13%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLR++A + S  R  +T                 N +    T+  I GDG+G E+  + K
Sbjct: 1   MLRSVATRLSTCRGLAT-----------------NAARKSLTIGLIPGDGIGKEVIPAGK 43

Query: 61  DIFKA--AQVPVDWEYCDVSPLLINGLTT-------IPEPAVQQINKH-KIALKGPLATP 110
            + +   ++  + + + D    L  G  T       +P+  V+ + +  + AL G + +P
Sbjct: 44  QVLENLNSKHGLSFNFID----LYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSP 99

Query: 111 IGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVV 168
             K  G+ S  + LR+  GLFANVRP +S+ G +   K +D+V++RENTE  Y  IE   
Sbjct: 100 TTKVEGYSSPIVALRREMGLFANVRPVKSVEGGKD--KPIDMVIVRENTEDLYIKIEKTY 157

Query: 169 ---APG--VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLF 219
              A G  V  + K I+  A+ R+   A + A    +  G   L V HKS +   +DGLF
Sbjct: 158 IDKATGTRVADATKRISEIATRRIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLF 217

Query: 220 VNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXX 275
             I KE+      ++  IK   +++D+ V  + R+P  +   V V PNLYGDI       
Sbjct: 218 REICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAA 275

Query: 276 XXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSN 335
                      AN+G E+ I E  HGSAPDIAG+  ANP A + S+ +ML ++G  + + 
Sbjct: 276 LVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQ 334

Query: 336 KIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
            I  A+   +  G+  +T DL G A+T    E V+  L
Sbjct: 335 DIYKAVDANLREGA-IKTPDLGGKASTQQVVEDVLSRL 371

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  152 bits (385), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 118/394 (29%), Positives = 193/394 (48%), Gaps = 44/394 (11%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLR+ A K +  R  +T                 N +    T+  I GDG+G E+  + K
Sbjct: 2   MLRSAANKLAGCRGLAT-----------------NAARKSLTIGLIPGDGIGKEVIPAGK 44

Query: 61  DIFKAA--QVPVDWEYCDVSPLLINGLTT---IPEPAVQQIN-KHKIALKGPLATPIGK- 113
            + ++   +  +++++ D+         T   +P+  VQ +  K + AL G + +P  K 
Sbjct: 45  QVLQSLNPKHGLNFDFIDLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKV 104

Query: 114 -GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVV---A 169
            G+ S  + LRK  GL+AN+RP +S+ G  +  + VD++++RENTE  Y  IE      A
Sbjct: 105 EGYSSPIVALRKAMGLYANIRPVKSVEG--SNERPVDMIIVRENTEDLYIKIEKTYIDKA 162

Query: 170 PG--VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLFVNIA 223
            G  V ++ K I+  A++R+   A + A    +  G+  L V HKS +   +DGLF  + 
Sbjct: 163 TGTRVAEATKRISEIATQRIATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVC 222

Query: 224 KEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXX 279
           +E+      ++  I    +++D+ V  + R+P  +   V V PNLYGDI           
Sbjct: 223 REMYEANKDKYAGITYNEQIVDSMVYRMFREPECFD--VIVAPNLYGDILSDGAAALVGS 280

Query: 280 XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIEN 339
                  AN+G E+ I E  HGSAPDIAG+  ANP A + S+ +ML ++G    +  I  
Sbjct: 281 LGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHK 339

Query: 340 AILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           A+   +  G   +T DL G ATT +  + ++  L
Sbjct: 340 AVDANLRDGLV-KTADLGGNATTQNVVDDILARL 372

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  152 bits (384), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 123/398 (30%), Positives = 192/398 (48%), Gaps = 52/398 (13%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           M R++A + SA R  ++                 N +    T+  I GDG+G E+  + K
Sbjct: 1   MFRSVATRLSACRGLAS-----------------NAARKSLTIGLIPGDGIGKEVIPAGK 43

Query: 61  DIFKA--AQVPVDWEYCDVSPLLINGLTT-------IPEPAVQQINKH-KIALKGPLATP 110
            + +   ++  + + + D    L  G  T       +P+  V+ + +  + AL G + +P
Sbjct: 44  QVLENLNSKHGLSFNFID----LYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSP 99

Query: 111 IGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVV 168
             K  G+ S  + LR+  GLFANVRP +S+ G +   K +D+V++RENTE  Y  IE   
Sbjct: 100 TTKVEGYSSPIVALRREMGLFANVRPVKSVEGEKG--KPIDMVIVRENTEDLYIKIEKTY 157

Query: 169 ---APG--VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLF 219
              A G  V  + K I+  A+ R+   A + A    +  G+  L V HKS +   +DGLF
Sbjct: 158 IDKATGTRVADATKRISEIATRRIATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLF 217

Query: 220 VNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXX 275
             I KE+      ++  IK   +++D+ V  + R+P  +   V V PNLYGDI       
Sbjct: 218 REICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAA 275

Query: 276 XXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSN 335
                      AN+G E+ I E  HGSAPDIAG+  ANP A + S+ +ML ++G    + 
Sbjct: 276 LVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQ 334

Query: 336 KIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
            I  A+   +  GS  +T DL G A+T    + V+  L
Sbjct: 335 DIYKAVDANLREGS-IKTPDLGGKASTQQVVDDVLSRL 371

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  152 bits (383), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 106/354 (29%), Positives = 176/354 (49%), Gaps = 28/354 (7%)

Query: 41  FTVPFIEGDGVGPEI----SKSVKDIFKAAQVPVDWEYCDVS-PLLINGLTTIPEPAVQQ 95
            T+  I GDG+G E+     + ++ I K   +   +E+ D      +     +P   V+ 
Sbjct: 21  LTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHLDAGWQTFLETGNALPGATVEA 80

Query: 96  INKH-KIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152
           + +  + AL G + +P  K  G+ S  + LR+  GL+AN+RP +S+ G   T + VDLV+
Sbjct: 81  LRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYANIRPVKSVSG---TGQPVDLVI 137

Query: 153 IRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERV----IRYAYEYARAIGRPRL 203
           +RENTE  Y     + ++      V ++IK I+  A+ER+    +R A +  R  GR  L
Sbjct: 138 VRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIAEISLRLALQRQRMGGRGAL 197

Query: 204 VVVHKSTIQKLADGLFVNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVT 259
            V HKS +    DGLF  + +E+       +  I+   +++D+ V  + ++P  +   V 
Sbjct: 198 TVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIVDSMVYRLFKEPHCFD--VV 255

Query: 260 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLL 319
           V PNLYGD+                   N+GN + I E  HGSAPDIAG+  ANP A + 
Sbjct: 256 VAPNLYGDLLSDGAAALVGSLGLVPS-VNVGNNIIIGEPCHGSAPDIAGRGIANPIATIR 314

Query: 320 SSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           S  +ML ++GLE  ++ I+ A+   +    +  + DL G  TT    + ++  +
Sbjct: 315 SVSLMLQFLGLEEAASDIDQAVTGNLKD-RQVVSPDLGGKNTTQEVLDDILARI 367

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  152 bits (383), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 111/394 (28%), Positives = 193/394 (48%), Gaps = 47/394 (11%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           M R+  AK +ARR +S   ++++                      I GDG+G E+  + K
Sbjct: 1   MFRSSVAKVAARRAYSAPKSMKIG--------------------LIPGDGIGKEVIPAGK 40

Query: 61  DIFKA--AQVPVDWEYCDVSP---LLINGLTTIPEPAVQQINKH-KIALKGPLATPIGK- 113
            + +A  ++  + +++ D+             +P+  V+ + +  + AL G + +P  K 
Sbjct: 41  QVLEALGSKHGLQFDFIDLKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKV 100

Query: 114 -GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEY-----SGIEHV 167
            G+ S  + LRK  GL+ANVRP +S+   +   +NVD++++RENTE  Y     + ++  
Sbjct: 101 AGYSSPIVALRKELGLYANVRPVKSVE--KGNDRNVDMIIVRENTEDLYIKTEKTYVDEA 158

Query: 168 VAPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLFVNIA 223
               V ++IK I+  A+ ++   A + +    ++ G   L V HKS +   +DGLF  I 
Sbjct: 159 TGTRVAEAIKRISEVATRKIATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREIC 218

Query: 224 KEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXX 279
           K++      ++ ++K   +++D+ V  + R+P  +   V V PNLYGDI           
Sbjct: 219 KDVYEKNKDKYGEVKYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAALVGS 276

Query: 280 XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIEN 339
                  AN+G E+ I E  HGSAPDIAG+  +NP A + S+ +ML ++G    +  I  
Sbjct: 277 LGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYK 335

Query: 340 AILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           A+   +  G  N T DL G ATT    + ++  +
Sbjct: 336 AVDANLIKGDVN-TPDLGGKATTQQVVDDILSKI 368

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  151 bits (382), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 115/356 (32%), Positives = 176/356 (49%), Gaps = 31/356 (8%)

Query: 41  FTVPFIEGDGVGPEISKSVKDIFKA--AQVPVDWEYCDVSPLLINGLTT---IPEPAVQQ 95
            T+  I GDG+G E+  + K + +    +  + +E+ D+       L T   +P   V  
Sbjct: 22  LTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDI 81

Query: 96  I-NKHKIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152
           + NK + AL G + +P  K  G+ S  + LRK  GLFANVRP +++ G  T  K +DLV+
Sbjct: 82  LKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVI 139

Query: 153 IRENTEGEYSGIEHVV-----APGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRL 203
           +RENTE  Y  IE           + ++ K IT  A++R+ + A + A    +  G   L
Sbjct: 140 VRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATL 199

Query: 204 VVVHKSTIQKLADGLFVNIAKELAPE----FPDIKLETELIDNTVLNVVRDPPSYTDAVT 259
            V HKS +   +DGLF  + KE+       +  +    +++D+ V  + R+P  +   V 
Sbjct: 200 TVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VI 257

Query: 260 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLL 319
           V PNLYGDI                  AN+G  + I E  HGSAPDIAG+  ANP A + 
Sbjct: 258 VAPNLYGDILSDGAAALVGSLGLVPS-ANVGPNIVIGEPCHGSAPDIAGKGIANPIATIR 316

Query: 320 SSCMMLNYMGLESYSNKIENAILNTIASGSEN--RTGDLAGTATTSSFTESVIKNL 373
           S+  ML Y+G   YSN  ++      A+  +N  +T DL G +TT    + ++  L
Sbjct: 317 STAQMLEYLG---YSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  151 bits (382), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 124/398 (31%), Positives = 187/398 (46%), Gaps = 52/398 (13%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           M R++A + SA R  +T                 N +    T+  I GDG+G E+  + K
Sbjct: 1   MFRSVATRVSACRGLAT-----------------NAARKSLTIGLIPGDGIGKEVIPAGK 43

Query: 61  DIFKA--AQVPVDWEYCDVSPLLINGLTT-------IPEPAVQQINKH-KIALKGPLATP 110
            + +   ++  + + + D    L  G  T       +P+  V  + K  + AL G + +P
Sbjct: 44  QVLENLNSKHGLSFNFID----LYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSP 99

Query: 111 IGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVV 168
             K  G+ S  + LR+  GLFANVRP +S+ G     K +D+V++RENTE  Y  IE   
Sbjct: 100 TTKVEGYSSPIVALRREMGLFANVRPVKSVEGSRN--KPIDMVIVRENTEDLYIKIEKTY 157

Query: 169 ---APG--VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLF 219
              A G  V  + K I+  A+ R+   A + A    +  G   L V HKS +    DGLF
Sbjct: 158 IDKATGTRVADATKRISEIATRRIATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLF 217

Query: 220 VNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXX 275
             I KE+      ++  IK   +++D+ V  + R+P  +   V V PNLYGDI       
Sbjct: 218 REICKEVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAA 275

Query: 276 XXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSN 335
                      AN+G E+ I E  HGSAPDIAG+  ANP A + S+ +ML ++G    + 
Sbjct: 276 LVGSLGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQ 334

Query: 336 KIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
            I  A+   +  G+   T DL G A+T    + V+  L
Sbjct: 335 DIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  150 bits (378), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 121/398 (30%), Positives = 193/398 (48%), Gaps = 52/398 (13%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           M R++A + SA R  ++                 N +    T+  I GDG+G E+  + K
Sbjct: 1   MFRSVATRISACRGLAS-----------------NAARKSLTIGLIPGDGIGKEVIPAGK 43

Query: 61  DIFKA--AQVPVDWEYCDVSPLLINGLTT-------IPEPAVQQI-NKHKIALKGPLATP 110
            I +   ++  + + + D    L  G  T       +P+  ++ + ++ + AL G + +P
Sbjct: 44  QILENLNSKHGLSFNFID----LYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSP 99

Query: 111 IGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVV 168
             K  G+ S  + LR+  GL+ANVRP +S+ G  T  K +D+V++RENTE  Y  IE   
Sbjct: 100 TTKVEGYSSPIVALRREMGLYANVRPVKSVEG--TKDKPIDMVIVRENTEDLYIKIEKTY 157

Query: 169 ---APG--VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLF 219
              A G  V  +IK I+  A+ R+ + A + A    +  G   L V HKS +   +DGLF
Sbjct: 158 IDKATGTRVADAIKRISEVATRRIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLF 217

Query: 220 VNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXX 275
             I K++      ++  IK   +++D+ V  + R+P  +   V V PNLYGDI       
Sbjct: 218 REICKDVYESNKDKYGQIKYNEQIVDSMVYRLFREPQCFD--VIVAPNLYGDILSDGAAA 275

Query: 276 XXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSN 335
                      AN+G ++ I E  HGSAPDIAG+  ANP A + S+ +ML ++G    + 
Sbjct: 276 LVGSLGVVPS-ANVGPDIVIGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQ 334

Query: 336 KIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
            I  A+   +  G+   T DL G A+T    + V+  L
Sbjct: 335 DIYKAVDANLREGAIT-TPDLGGKASTQQVVDDVLSRL 371

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  150 bits (378), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 110/353 (31%), Positives = 175/353 (49%), Gaps = 26/353 (7%)

Query: 41  FTVPFIEGDGVGPEISKSVKDIFK--AAQVPVDWEYCDVSPLLINGLTT---IPEPAVQQ 95
           FT+  I GDG+G E+    + + +    +  VD++Y D+       L T   +P+  V+Q
Sbjct: 20  FTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDLQAGWQTFLDTGKALPDDTVEQ 79

Query: 96  I-NKHKIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152
           + N  + AL G + +P  K  G+ S  + LRK  GL+AN+RP +S+ G  T  + VDLV+
Sbjct: 80  LRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYANIRPVKSVDG--TGDRPVDLVI 137

Query: 153 IRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRL 203
            RENTE  Y     + I+      V ++IK I+  A+  +   A E A    +  G   L
Sbjct: 138 ARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIANIALEIALQRLKEKGHATL 197

Query: 204 VVVHKSTIQKLADGLFVNIAKELA---PEFPDIKLETELIDNTVLNVVRDPPSYTDAVTV 260
            V HKS +   +DGLF  I K +     +F +++   +++D+ V  + ++P  +   V V
Sbjct: 198 TVTHKSNVLSQSDGLFREICKSVYQSNKKFANVQYNEQIVDSMVYRLFKEPQCFD--VIV 255

Query: 261 CPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLS 320
            PNLYGDI                   N+G  + I E  HGSAPDI GQ  ANP A + S
Sbjct: 256 APNLYGDILSDGAAALVGSLGVVPS-VNVGPNIVIGEPCHGSAPDIVGQGIANPIATIRS 314

Query: 321 SCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           + ++L ++GL   +  IE  +   I   ++ +T DL G +T       ++  +
Sbjct: 315 AALLLEFLGLPEAARHIEKVVDENIRE-NKIKTPDLGGNSTGEQVANDILSRI 366

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  147 bits (372), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 114/360 (31%), Positives = 170/360 (47%), Gaps = 39/360 (10%)

Query: 41  FTVPFIEGDGVGPEISKSVKDI-----------FKAAQVPVDWEYCDVSPLLINGLTTIP 89
            T+  I GDG+G E+  + K I           FK   +   WE         N    +P
Sbjct: 21  LTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDLQAGWE------TFQNTGKALP 74

Query: 90  EPAVQQI-NKHKIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYK 146
           +  +  + N+ + AL G + +P  K  G+ S  + LRK  GLFANVRP +S+ G  T  +
Sbjct: 75  DETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFANVRPVKSVDG--TKDR 132

Query: 147 NVDLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAYEYARAI--- 198
            VDLV++RENTE  Y     S I+      V  + K IT  A++ +   A + A+     
Sbjct: 133 KVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIATIALQIAQQRLEQ 192

Query: 199 -GRPRLVVVHKSTIQKLADGLFVNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPS 253
            G   L V HKS +   +DGLF  + +E       ++  ++   +++D+ V  + R+P  
Sbjct: 193 NGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIVDSMVYRMFREPEC 252

Query: 254 YTDAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKAN 313
           +   V V PNLYGDI                  AN+G  + I E  HGSAPDIAG+  +N
Sbjct: 253 FD--VVVAPNLYGDILSDGAAALVGSLGVVPS-ANVGPNIVIGEPCHGSAPDIAGKGISN 309

Query: 314 PTALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           P A + S+ +ML ++G    +  I  A+   I  G +  T DL G +TT    E V+  L
Sbjct: 310 PIATIRSTALMLEFLGYPEPAKDIHKAVDANIREG-KYLTPDLGGNSTTQQVLEDVLSKL 368

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  146 bits (369), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 117/394 (29%), Positives = 191/394 (48%), Gaps = 46/394 (11%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLR+   + + RR ++++    V G                    I GDG+G E+  + K
Sbjct: 1   MLRSAIGRLATRRAYASAPKSMVIG-------------------LIPGDGIGKEVIPAGK 41

Query: 61  DIFK--AAQVPVDWEYCDVSPLLINGLTT---IPEPAVQQI-NKHKIALKGPLATPIGK- 113
            + +  + +  +++++ D+         T   +PE  VQ + N+ + AL G + +P  K 
Sbjct: 42  QVLENLSGKHGLNFDFIDLQAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKV 101

Query: 114 -GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVV---A 169
            G+ S  + LRK  GL+ANVRP +S+ G  T  + VD+V++RENTE  Y  +E      A
Sbjct: 102 EGYSSPIVALRKELGLYANVRPVKSVEG--TKDRPVDMVIVRENTEDLYIKLEKTYVDKA 159

Query: 170 PG--VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLFVNIA 223
            G  V ++ K I+  A+ R+   A + A    +  G   L V HKS +   +DGLF  I 
Sbjct: 160 TGTRVAEATKRISEVATRRIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREIC 219

Query: 224 KEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXX 279
           K++      ++  +    +++D+ V  + R+P  +   V V PNLYGDI           
Sbjct: 220 KDVYESNKDKYGQVAYNEQIVDSMVYRMFREPECFD--VVVAPNLYGDILSDGAAALVGS 277

Query: 280 XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIEN 339
                  AN+G E+ I E  HGSAPDIAG+  +NP A + S+ +ML ++G    +  I  
Sbjct: 278 LGVVPS-ANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYR 336

Query: 340 AILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           A+   +    + +T DL G +TT    E ++  L
Sbjct: 337 AVDANLRE-DKVKTPDLGGNSTTQQVVEDILSKL 369

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  145 bits (365), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 104/354 (29%), Positives = 179/354 (50%), Gaps = 27/354 (7%)

Query: 41  FTVPFIEGDGVGPEISKSVKDIFK--AAQVPVDWEYCDVSPLLINGLTT---IPEPAVQQ 95
            T+  I GDG+G E+  + K + +  +++  + + + D+       L T   +P+  ++ 
Sbjct: 21  LTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDLQAGWQTFLDTGKALPDETIEI 80

Query: 96  INKH-KIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152
           +    + AL G + +P  K  G+ S  + LRK  GL+ANVRP +S++G  T  + VD+++
Sbjct: 81  LKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVQG--TNDRPVDMII 138

Query: 153 IRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRL 203
           +RENTE  Y     + I+      V ++IK I+  A+  + + A E +    +A G+  L
Sbjct: 139 VRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIAKIALEISLQRLKANGKATL 198

Query: 204 VVVHKSTIQKLADGLFVNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVT 259
            V HKS +   +DGLF  + K +       +  I    +++D+ V  + R+P  +   V 
Sbjct: 199 TVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIVDSMVYRLFREPECFD--VI 256

Query: 260 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLL 319
           V PNLYGDI                  AN+G++  + E  HGSAPDIAG+  +NP A + 
Sbjct: 257 VAPNLYGDILSDGAAALVGSLGVVPS-ANVGHDFIVGEPCHGSAPDIAGKGISNPIATIR 315

Query: 320 SSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           S+ +ML +MG    +  I  A+   I   ++ +T DL G +TT    + ++  +
Sbjct: 316 STALMLEFMGYTEAAQDIHKAVDTNIRE-NQIKTPDLGGKSTTQQVVDDILSKM 368

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  143 bits (361), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 105/354 (29%), Positives = 177/354 (50%), Gaps = 28/354 (7%)

Query: 41  FTVPFIEGDGVGPEISKSVKDIFK--AAQVPVDWEYCDVSPLLINGLTT---IPEPAVQQ 95
            T+  I GDG+G E+  + + + +  +++  + +++ D+         T   +P+  +  
Sbjct: 21  LTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDLQAGWQTFQETGKALPDETIDI 80

Query: 96  I-NKHKIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152
           + N+ + AL G + +P  K  G+ S  + LRK  GL+ANVRP +S+   E   + VD+++
Sbjct: 81  LRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLPQE---RPVDMII 137

Query: 153 IRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRL 203
           +RENTE  Y     + I+      V ++IK I+  A++ +   A E A    +  G   L
Sbjct: 138 VRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIANIALEIALQRQKVNGEATL 197

Query: 204 VVVHKSTIQKLADGLFVNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVT 259
            V HKS +   +DGLF  + +++      +F  IK   +++D+ V  + R+P  +   V 
Sbjct: 198 TVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIVDSMVYRMFREPECFD--VI 255

Query: 260 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLL 319
           V PNLYGDI                  AN+G +  + E  HGSAPDIAG+  +NP A + 
Sbjct: 256 VAPNLYGDILSDGAAALVGSLGVVPS-ANVGFDFVVGEPCHGSAPDIAGKGISNPVATIR 314

Query: 320 SSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           S+ +ML +MG    +  I  A+   +   S  +T DL G +TT    E V+  +
Sbjct: 315 STALMLEFMGHPEAAQDIHKAVDANLRDNS-IKTPDLGGKSTTQQVVEDVLSRM 367

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  141 bits (356), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 107/358 (29%), Positives = 177/358 (49%), Gaps = 28/358 (7%)

Query: 37  STGRFTVPFIEGDGVGPEISKSVKDIFK--AAQVPVDWEYCDVSPLLINGLTT---IPEP 91
           +T   T+  I GDG+G E+  + K + +  +++  + + + D+       L T   +P+ 
Sbjct: 17  ATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDLEAGWQTFLDTGKALPDE 76

Query: 92  AVQQI-NKHKIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNV 148
            +  + N+ + AL G + +P  K  G+ S  + LRK  GL+ANVRP +S+   E   K +
Sbjct: 77  TIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYANVRPVKSVLSQE---KPI 133

Query: 149 DLVLIRENTEGEY-----SGIEHVVAPGVVQSIKLITRDASERVIRYAYEYA----RAIG 199
           D+V++RENTE  Y     + I+      V ++IK I+  A+  +   A E A    +  G
Sbjct: 134 DMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIANIALEIALQRQKVNG 193

Query: 200 RPRLVVVHKSTIQKLADGLFVNIAKEL----APEFPDIKLETELIDNTVLNVVRDPPSYT 255
              L V HKS +   +DGLF  I +++      +F  I    +++D+ V  + R+P  + 
Sbjct: 194 SATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIVDSMVYRLFREPECFD 253

Query: 256 DAVTVCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPT 315
             V V PNLYGDI                  AN+G +  + E  HGSAPDIAG+  +NP 
Sbjct: 254 --VIVAPNLYGDILSDGAAALVGSLGVVPS-ANVGFDFVVGEPCHGSAPDIAGKGISNPV 310

Query: 316 ALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           A + S+ +ML +MG    +  I  A+   +   +  +T DL G +TT    + V+  +
Sbjct: 311 ATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTV-KTPDLGGKSTTQQVVDDVLSRM 367

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  142 bits (357), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 114/393 (29%), Positives = 194/393 (49%), Gaps = 42/393 (10%)

Query: 1   MLRTIAAKQSARRLFSTSSTLRVSGQVGKYKGSPNPSTGRFTVPFIEGDGVGPEISKSVK 60
           MLR++  K +  R  ST                 N S    T+  I GDG+G E+  + K
Sbjct: 1   MLRSVVTKSATIRHLSTKGI--------------NKS---LTIGLIPGDGIGKEVIPAGK 43

Query: 61  DIFK--AAQVPVDWEYCDVSPLLINGLTT---IPEPAVQQINKH-KIALKGPLATPIGK- 113
            + +  +++  +++ + D+       L T   +P+  V+ + +  +  L G + +P  + 
Sbjct: 44  QVLQNLSSRHGLNFNFIDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRV 103

Query: 114 -GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVLIRENTEGEYSGIEHVVAPG- 171
             + S  + LRK   L+AN+RP +S+ G  +  K VD+V++RENTE  Y  IE       
Sbjct: 104 DNYSSPIVALRKELQLYANIRPVKSVAGAHSG-KPVDMVIVRENTEDLYIKIEKSYKDQN 162

Query: 172 ---VVQSIKLITRDASERVIRYAYEYA----RAIGRPRLVVVHKSTIQKLADGLFVNIAK 224
              V ++ K IT  A+ ++ + A + A    +  G+  L V HKS +   +DGLF  I K
Sbjct: 163 GMRVAEATKRITEVATRKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICK 222

Query: 225 EL----APEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXXX 280
           ++      ++  I    ++ID+ V  + R+P  Y D V V PNLYGDI            
Sbjct: 223 DVYQANKDKYAGINYNEQIIDSMVYRMFREP-EYFD-VIVAPNLYGDILSDGAAALVGSL 280

Query: 281 XXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNYMGLESYSNKIENA 340
                 AN+G ++ + E  HGSAPDIAG+  ANP A + S+ +ML ++G +  +  I  A
Sbjct: 281 GVVPS-ANVGPDIVMGEPCHGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKA 339

Query: 341 ILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           + + +   ++ +T DL G ++T +  + V++ L
Sbjct: 340 VESNMRE-NKIKTPDLGGNSSTQNVVDDVLEKL 371

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  140 bits (353), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 108/354 (30%), Positives = 174/354 (49%), Gaps = 27/354 (7%)

Query: 41  FTVPFIEGDGVGPEISKSVKDIFK--AAQVPVDWEYCDVSPLLINGLTT---IPEPAVQQ 95
            T+  I GDG+G E+  S + + +    +  + + + D+       L T   +P   V+ 
Sbjct: 24  LTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFIDLQAGWQTFLDTGKALPVETVKT 83

Query: 96  INKH-KIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152
           + ++   AL G + +P  K  G+ S  + LRK  GL+AN+RP +S+       K VD+V+
Sbjct: 84  LRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLYANIRPVKSVD--TPGNKKVDMVI 141

Query: 153 IRENTEGEYSGIEHV-----VAPGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRL 203
           +RENTE  Y  +E           V  + K I+  A+ R+ + A + A    +  G  +L
Sbjct: 142 VRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRRIAKIALDIALQRLKNNGNVQL 201

Query: 204 VVVHKSTIQKLADGLFVNIAKELAPE----FPDIKLETELIDNTVLNVVRDPPSYTDAVT 259
            V HKS +   +DGLF  + KE+       + DI+   ++ID+ V  + R+P  +   V 
Sbjct: 202 TVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQIIDSMVYRLFREPECFD--VI 259

Query: 260 VCPNLYGDIXXXXXXXXXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLL 319
           V PNLYGDI                  AN+G  + I E  HGSAPDIAG+  +NP A + 
Sbjct: 260 VAPNLYGDILSDGAAALVGSLGVVPS-ANVGPGIVIGEPCHGSAPDIAGKGISNPIATIR 318

Query: 320 SSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           S+ +ML ++G    +  I+ A+ + +    + +T DL G  +TS     VI+ L
Sbjct: 319 STALMLEFLGHSQAAQDIQTAVDSNLRE-DKIKTPDLGGKNSTSDVVNDVIRRL 371

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score = 88.6 bits (218), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 90/349 (25%), Positives = 158/349 (45%), Gaps = 32/349 (9%)

Query: 48  GDGVGPEISKSVKDIFKAAQ-----VPVDWEYCDVSPLLINGL-TTIPEPAVQQINKHKI 101
           GD +G E+ +    +  A +     V  D++Y  V    I+   + +P+ A+    +   
Sbjct: 12  GDHIGREVVEEAVKVLGAVEQSLSDVHFDFQYHLVGGAAIDATGSALPDEALGAAKEADA 71

Query: 102 ALKGPLATPIGKG-----HRSLNLTLRKTFGLFANVRP----ARSIRGYE----TTYKNV 148
            L G +  P  +G      + L L LR+  G++AN+RP    A S+           ++ 
Sbjct: 72  VLLGAVGGPKWQGGAVRPEQGL-LKLRQELGVYANLRPCNFAADSLLELSPLRPEIARDT 130

Query: 149 DLVLIRENTEGEYSGIEHV-VAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVV-V 206
           D++++RE   G Y G  H     GV       T    +R+ R A   A     P  V  +
Sbjct: 131 DIMVVRELLGGSYFGERHEDEGDGVAWDTDKYTVKEVQRIARMAGFLALQHDPPLPVWSL 190

Query: 207 HKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYG 266
            K+ +   +      + +    EFP+++L+ +LID+  + +V++P ++ + V V  N++G
Sbjct: 191 DKANVLASSRLWRKTVEETFQSEFPNVQLQHQLIDSAAMILVKNPRAF-NGVVVTSNMFG 249

Query: 267 DIXXXXXXXX--XXXXXXXXXXANIGNEVSIF---EAVHGSAPDIAGQNKANPTALLLSS 321
           DI                    A++ +  S F   E  HGSAPD+    KANP   +LS+
Sbjct: 250 DIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGSAPDLPA-GKANPIGCILSA 308

Query: 322 CMMLNY-MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESV 369
            MML   + + +    +E A+   + SG   RTGDL G+++TS   +++
Sbjct: 309 AMMLKLSLNMVAAGEAVEQAVQEVLDSGV--RTGDLLGSSSTSEVGDAI 355

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 85.9 bits (211), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 94/356 (26%), Positives = 157/356 (44%), Gaps = 34/356 (9%)

Query: 46  IEGDGVGPEISKSVKDIFKA-----AQVPVDWEYCDVSPLLINGL-TTIPEPAVQQINKH 99
           + GD VG EI+     + KA     + V  D+E   +    I+     +P+ A++   K 
Sbjct: 10  LPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEASKKA 69

Query: 100 KIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAR-------SIRGYETTY-K 146
              L G +  P  G G     + L L +RK   L+AN+RP          +   +  + K
Sbjct: 70  DAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPIKPQFAK 128

Query: 147 NVDLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVV 205
             D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P L +
Sbjct: 129 GTDFVVVRELVGGIYFGERKEDDGDGVAWDCEQYTVPEVQRITRMAAFMALQ-HEPPLPI 187

Query: 206 VHKSTIQKLADG-LFVNIAKE-LAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPN 263
                   LA   L+    +E +  EFP +K++ +LID+  + +V++P ++ + + +  N
Sbjct: 188 WSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNP-THLNGIIITSN 246

Query: 264 LYGDIXXXXXXXXXXX-----XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALL 318
           ++GDI                        +      ++E  HGSAPD+  +NK NP A +
Sbjct: 247 MFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPVATI 305

Query: 319 LSSCMMLNY-MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           LS+ MML   + L      IE+A+   + +G   RTGDL G+ +T+   ++V K +
Sbjct: 306 LSAAMMLKLSLNLPEEGKAIEDAVKRVLDAGI--RTGDLGGSNSTTEVGDAVAKEV 359

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 121/270 (44%), Gaps = 20/270 (7%)

Query: 120 LTLRKTFGLFANVRP----ARSIRGYE----TTYKNVDLVLIRENTEGEYSG-IEHVVAP 170
           L +RK  GL+AN+RP    ++S+ G         +  D V++RE   G Y G  +     
Sbjct: 94  LAIRKELGLYANLRPCSFISKSLLGLSPLKPEIAQGTDFVILRELVGGIYFGERKEDDGD 153

Query: 171 GVVQSIKLITRDASERVIRYAYEYARAIGRPR-LVVVHKSTIQKLADGLFVNIAKELAPE 229
           GV    +  T    ER+ R     A     P  L    K+ +   +      + + +  E
Sbjct: 154 GVAWDSEKYTVSEVERITRMGAFLALQHDPPLPLWSFDKANVLASSRLWRRTVNETIKRE 213

Query: 230 FPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXX-----XXXXX 284
           FP + ++ +LID+  + ++++P  + + + +  N++GDI                     
Sbjct: 214 FPQLSVQHQLIDSAAMIMIKNPRKF-NGIVITSNIFGDIISDAASVIPGSLGLLPSASLA 272

Query: 285 XXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNY-MGLESYSNKIENAILN 343
              +  N   ++E  HGSAPD+  + +ANP A +LS+ MML   + +      IENA+  
Sbjct: 273 SEPDKNNAFGLYEPCHGSAPDLE-KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVKQ 331

Query: 344 TIASGSENRTGDLAGTATTSSFTESVIKNL 373
            I SG   RTGDL G  TT+   ++V   L
Sbjct: 332 VIESGI--RTGDLGGNNTTTEVGDAVTHAL 359

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 96/357 (26%), Positives = 158/357 (44%), Gaps = 36/357 (10%)

Query: 46  IEGDGVGPEISKSVKDIFKA-AQVPVDWEYCDVSPLLINGLTT------IPEPAVQQINK 98
           + GD VG EI+     + KA ++V  D  + D    LI G         +P+ A++   K
Sbjct: 10  LPGDHVGQEITAEAIKVLKAISEVRSDVNF-DFENHLIGGAAIDATGVPLPDEALEASKK 68

Query: 99  HKIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAR-------SIRGYETTY- 145
               L G +  P  G G     + L L +RK   L+AN+RP          +   +  + 
Sbjct: 69  ADAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKPQFA 127

Query: 146 KNVDLVLIRENTEGEYSGI-EHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLV 204
           K  D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P L 
Sbjct: 128 KGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ-HEPPLP 186

Query: 205 VVHKSTIQKLADG-LFVNIAKE-LAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCP 262
           +        LA   L+    +E +  EFP +K++ +LID+  + +V++P ++ + + +  
Sbjct: 187 IWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNP-THLNGIIITS 245

Query: 263 NLYGDIXXXXXXXXXXX-----XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTAL 317
           N++GDI                        +      ++E  HGSAPD+  +NK NP A 
Sbjct: 246 NMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIAT 304

Query: 318 LLSSCMMLNY-MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           +LS+ MML   + L      IE+A+   + +G   RTGDL G+ +T+   ++V K +
Sbjct: 305 ILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAGI--RTGDLGGSNSTTEVGDAVAKEV 359

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score = 83.2 bits (204), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 93/352 (26%), Positives = 155/352 (44%), Gaps = 34/352 (9%)

Query: 46  IEGDGVGPEISKSVKDIFKA-----AQVPVDWEYCDVSPLLINGL-TTIPEPAVQQINKH 99
           + GD VG EI+     + KA     + V  D+E   +    I+     +P+ A++   K 
Sbjct: 10  LPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEASKKA 69

Query: 100 KIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAR-------SIRGYETTY-K 146
              L G +  P  G G     + L L +RK   L+AN+RP          +   +  + K
Sbjct: 70  DAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPIKPQFAK 128

Query: 147 NVDLVLIRENTEGEYSGI-EHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVV 205
             D V++RE   G Y G  +     GV    +  T    +R+ R A   A     P L +
Sbjct: 129 GTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ-HEPPLPI 187

Query: 206 VHKSTIQKLADG-LFVNIAKE-LAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPN 263
                   LA   L+    +E +  EFP +K++ +LID+  + +V++P ++ + + +  N
Sbjct: 188 WSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNP-THLNGIIITSN 246

Query: 264 LYGDIXXXXXXXXXXX-----XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALL 318
           ++GDI                        +      ++E  HGSAPD+  +NK NP A +
Sbjct: 247 MFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATI 305

Query: 319 LSSCMMLNY-MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESV 369
           LS+ MML   + L      IE+A+   + +G   RTGDL G+ +T+   ++V
Sbjct: 306 LSAAMMLKLSLNLPEEGKAIEDAVKKVLDAGI--RTGDLGGSNSTTEVGDAV 355

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 83.2 bits (204), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 89/353 (25%), Positives = 151/353 (42%), Gaps = 33/353 (9%)

Query: 48  GDGVGPEISKSVKDIFKAAQ-----VPVDWEYCDVSPLLINGLTT-IPEPAVQQINKHKI 101
           GD VG EI +    + K  +     V  +++Y  +    I+     +P+  ++   +   
Sbjct: 12  GDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDETLEAAKQSDA 71

Query: 102 ALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPARSIRGY--------ETTYKNV 148
            L G +  P  G G     + L L +RK  GL+ N+RP + I           E   K  
Sbjct: 72  VLLGAVGGPKWGTGKVRPEQGL-LKIRKELGLYGNLRPCKFISDKLIGLSPLKEEVCKGT 130

Query: 149 DLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVVH 207
           D V++RE   G Y G  +     GV    +  + +  +R+ + A  +      P L +  
Sbjct: 131 DFVVVRELVGGIYFGERQEDDGSGVAWDSEKYSIEEVKRITKMAA-FLSLQNDPPLPIWS 189

Query: 208 KSTIQKLADG-LFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYG 266
                 LA   L+     E   EFP++K++ +LID+  + +V++ P+  + + +  N++G
Sbjct: 190 LDKANVLASSRLWRAAVDETIAEFPNLKVQHQLIDSAAMMLVKN-PTQLNGIILTNNMFG 248

Query: 267 DIXXXXXXXXXXX-----XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSS 321
           DI                        +      ++E  HGSAPD+A + K NP A +LS+
Sbjct: 249 DIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAPDLA-RGKVNPVATILSA 307

Query: 322 CMMLNY-MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
            MML   + +      IE A+   +  G   RT DL G +TTS   ++V + L
Sbjct: 308 AMMLKLSLDMVQEGEAIERAVSVVLDRGI--RTADLGGNSTTSELGDAVAQEL 358

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score = 82.8 bits (203), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 94/355 (26%), Positives = 158/355 (44%), Gaps = 36/355 (10%)

Query: 48  GDGVGPEISKSVKDIFKA-----AQVPVDWEYCDVSPLLINGLTTIP--EPAVQQINKHK 100
           GD VG EI++    + KA       V  D+EY  +    I+  T +P  + A++   K  
Sbjct: 12  GDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDA-TGVPLTDEALEASKKAD 70

Query: 101 IALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAR-------SIRGYETTY-KN 147
             L G +  P  G G     + L L +RK   L+AN+RP          +   +  + + 
Sbjct: 71  AVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASESLLELSPIKPQFARG 129

Query: 148 VDLVLIRENTEGEYSGI-EHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVVV 206
            D V++RE   G Y G  +     GV    +  T    +R+ R A   A    +P L + 
Sbjct: 130 TDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ-HQPPLPIW 188

Query: 207 HKSTIQKLADG-LFVNIAKE-LAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNL 264
                  LA   L+    +E +  EFP +K++ +LID+  + +V++P +  + + +  N+
Sbjct: 189 SLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNP-TQLNGIIITSNM 247

Query: 265 YGDIXXXXXXXXXXX-----XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLL 319
           +GDI                        +      ++E  HGSAPD+  +NK NP A +L
Sbjct: 248 FGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KNKVNPIATIL 306

Query: 320 SSCMMLNY-MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           S+ MML   + + +    IE+A+   + +G   RTGDL G+ +T    ++V K +
Sbjct: 307 SAAMMLKLSLNMTAEGQAIEDAVKKVLDAGI--RTGDLGGSNSTIEVGDAVAKEV 359

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 89/362 (24%), Positives = 158/362 (43%), Gaps = 34/362 (9%)

Query: 37  STGRFTVPFIEGDGVGPEISKSVKDIFKAA-----QVPVDWEYCDVSPLLINGLTT-IPE 90
           ST +  V  + GD VG EI+     + KA       +  D++Y  +    I+     +P+
Sbjct: 2   STKKIVV--LPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPD 59

Query: 91  PAVQQINKHKIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----ARSIRGY 141
            A++        L G +  P  G G     + L L +RK  GL+AN+RP    + S+ G 
Sbjct: 60  EALEASKNSDAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASESLLGL 118

Query: 142 E----TTYKNVDLVLIRENTEGEYSGI-EHVVAPGVVQSIKLITRDASERVIRYAYEYAR 196
                   K  D +++RE   G Y G  +     GV    +  +    +R+ R A   A 
Sbjct: 119 SPLRPEIAKGTDFMVVRELVGGIYFGKRKEDEGDGVAWDSEQYSVPEVQRITRMAAFLAL 178

Query: 197 AIGRPR-LVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPPSYT 255
               P  +  + K+ +   +      + + +  EFP + ++ +LID+  + +V++P +  
Sbjct: 179 QHNPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLTVQNQLIDSAAMILVKNP-TQL 237

Query: 256 DAVTVCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGNEVSIFEAVHGSAPDIAGQN 310
           + + +  N++GDI                        +      ++E  HGSAPD+  + 
Sbjct: 238 NGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-KG 296

Query: 311 KANPTALLLSSCMMLNY-MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESV 369
           K NP A +LS+ MML   + L    + IE A+   + +G   RTGDL G+ +T+   +++
Sbjct: 297 KVNPIATILSAAMMLKLSLNLVKQGDAIEEAVKKVLDAGI--RTGDLGGSNSTTEVGDAI 354

Query: 370 IK 371
            K
Sbjct: 355 AK 356

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score = 81.6 bits (200), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 86/353 (24%), Positives = 154/353 (43%), Gaps = 32/353 (9%)

Query: 46  IEGDGVGPEISKSVKDIFKA-----AQVPVDWEYCDVSPLLINGL-TTIPEPAVQQINKH 99
           + GD VG E++     +  A      ++  ++++  +    I+   T +P+ A++   K 
Sbjct: 8   LPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEALEASKKA 67

Query: 100 KIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAR-------SIRGYETTY-K 146
              L G +  P  G G     + L L +RK  GL+AN+RP          +   +  Y K
Sbjct: 68  DAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASDSLLDLSPLKPEYAK 126

Query: 147 NVDLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPR-LV 204
             D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  + 
Sbjct: 127 GTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQQNPPLPIW 186

Query: 205 VVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNL 264
            + K+ +   +      + + +  EFP + ++ +LID+  + +V+ P +  + V +  N+
Sbjct: 187 SLDKANVLASSRLWRKTVEETIKTEFPQLTVQHQLIDSAAMILVKSP-TKLNGVVITNNM 245

Query: 265 YGDIXXXXXXXXXXX-----XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLL 319
           +GDI                        +      ++E  HGSAPD+   NK NP A +L
Sbjct: 246 FGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAPDLPA-NKVNPIATIL 304

Query: 320 SSCMMLNY-MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIK 371
           S+ MML   + L      +E A+ N + +G   RTGDL G+ +T+   +++ K
Sbjct: 305 SAAMMLKLSLDLVEEGRALEEAVRNVLDAGV--RTGDLGGSNSTTEVGDAIAK 355

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 90/354 (25%), Positives = 156/354 (44%), Gaps = 34/354 (9%)

Query: 48  GDGVGPEISKSVKDIFKA-----AQVPVDWEYCDVSPLLINGL-TTIPEPAVQQINKHKI 101
           GD VG EI++    + KA      +   +++Y  +    I+     +P+ +++   K   
Sbjct: 12  GDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDASLEAAKKSDA 71

Query: 102 ALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----ARSIRGYE----TTYKNV 148
            L G +  P  G G     + L L +RK   L+AN+RP    + S+           +  
Sbjct: 72  VLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKPECARGT 130

Query: 149 DLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVV-V 206
           D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  V  +
Sbjct: 131 DFVVVRELVGGIYFGERKEDTGDGVAWDSEQYSVPEVQRITRMAAFLALQHSPPLPVWSL 190

Query: 207 HKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYG 266
            K+ +   +      + + +  EFP + ++ +LID+  + +V++P +  + V +  N++G
Sbjct: 191 DKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNP-TQLNGVIITNNMFG 249

Query: 267 DIXXXXXXXXXXX-----XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSS 321
           DI                        +      ++E  HGSAPD+  + K NP A +LS+
Sbjct: 250 DIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP-KGKVNPIATILSA 308

Query: 322 CMMLNYMGLESYSN--KIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
            MML  + L+ +     +E A+   + SG   RT DL GT+TTS   E+V+K L
Sbjct: 309 AMMLK-LSLDMFEEGAAVEEAVRKVLDSGV--RTADLKGTSTTSEVGEAVVKAL 359

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 119/268 (44%), Gaps = 20/268 (7%)

Query: 120 LTLRKTFGLFANVRP----ARSIRGYE----TTYKNVDLVLIRENTEGEYSG-IEHVVAP 170
           L +RK   L+AN+RP    + S+           K  D V++RE   G Y G  +     
Sbjct: 92  LKIRKELQLYANLRPCNFASESLLDLSPLKPQHAKGTDFVVVRELVGGIYFGERKEDEGD 151

Query: 171 GVVQSIKLITRDASERVIRYAYEYARAIGRPR-LVVVHKSTIQKLADGLFVNIAKELAPE 229
           GV    +  T+   +R+ R A   A     P  +  + K+ +   +      + + +  E
Sbjct: 152 GVAWDSEKYTKPEVQRLTRMAAFLALQHNPPLPIWSLDKANVLASSRLWRKTVEETIKNE 211

Query: 230 FPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXX-----XXXXX 284
           FP +KL  +LID+  + +V+ P +  + + +  NL+GDI                     
Sbjct: 212 FPQLKLNHQLIDSAAMILVKSP-TQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLA 270

Query: 285 XXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNY-MGLESYSNKIENAILN 343
              +      ++E  HGSAPD+  + K NP A++LS+ MML   + L      +E A+  
Sbjct: 271 SLPDTNEAFGLYEPCHGSAPDLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVKQ 329

Query: 344 TIASGSENRTGDLAGTATTSSFTESVIK 371
            + SG   RTGDL G+ +TS   +++ K
Sbjct: 330 VLDSGV--RTGDLGGSNSTSEVGDAIAK 355

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 86/352 (24%), Positives = 153/352 (43%), Gaps = 33/352 (9%)

Query: 48  GDGVGPEISKSVKDIFKA------AQVPVDWEYCDVSPLLINGL-TTIPEPAVQQINKHK 100
           GD VG EI++    + KA      ++V  D++Y  +    I+     + + A++   K  
Sbjct: 12  GDHVGGEITEEAIKVLKAIEQVESSKVKFDFQYHLIGGAAIDAAGVPLTDEALEASKKAD 71

Query: 101 IALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRP----ARSIRGYE----TTYKN 147
             L G +  P  G G     + L L +RK  GL+AN+RP    +  + G         K 
Sbjct: 72  AVLLGAVGGPKWGTGAVRPEQGL-LKIRKELGLYANLRPCNFASEPLLGLSPLRPEIAKG 130

Query: 148 VDLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPR-LVV 205
            D +++RE   G Y G  +     GV    +  +    ER+ R A   A     P  +  
Sbjct: 131 TDFMVVRELVGGIYFGERKEDDGDGVAWDSEKYSVPEVERITRMAAFLALQHNPPLPIWS 190

Query: 206 VHKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLY 265
           + K+ +   +      +   +  EFP + ++ +LID+  + +V++P +  + + +  N++
Sbjct: 191 LDKANVLASSRLWRKTVEATIKNEFPTLTVQNQLIDSAAMILVKNP-TQLNGIIITSNMF 249

Query: 266 GDIXXXXXXXXXXX-----XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLS 320
           GDI                        +      ++E  HGSAPD+  +NK NP A +LS
Sbjct: 250 GDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP-KNKVNPVATILS 308

Query: 321 SCMMLNY-MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIK 371
           + MML   + +      +E A+   + +G   RTGDL G+ +T    +++ K
Sbjct: 309 AAMMLKLSLNMVKEGEAVEEAVRRVLDAGV--RTGDLGGSNSTQEVGDAIAK 358

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 118/270 (43%), Gaps = 24/270 (8%)

Query: 120 LTLRKTFGLFANVRPARSIRGYETTY----------KNVDLVLIRENTEGEYSGIEHVVA 169
           L +RK  G++AN+RP + +   ET            +  D V++RE   G Y G      
Sbjct: 94  LKIRKELGVYANLRPCQFVS--ETLLDLSPLKREIVQGTDFVIVRELVGGIYFGERQEAG 151

Query: 170 P-GVVQSIKLITRDASERVIRYAYEYARAIGRPRLVV-VHKSTIQKLADGLFVNIAKELA 227
             GV    +  +    +R+ R A   A     P  V  + K+ +   +      + + + 
Sbjct: 152 DDGVAWDKESYSVPEIQRITRMAAFLALQHNPPLPVWSLDKANVLATSRLWRKTVEETIK 211

Query: 228 PEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXX-----XXX 282
            EFP + +   LID+  + +V++P +  + V +  N++GDI                   
Sbjct: 212 NEFPTLTINHHLIDSAAMTLVQNP-TKLNGVVITTNMFGDIISDEASVIPGSLGLLPSAS 270

Query: 283 XXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNY-MGLESYSNKIENAI 341
                +  + + ++E  HGSAPD+   + ANP A +LS+ MM    + L    N IE A+
Sbjct: 271 LASLPDKNDALGLYEPCHGSAPDLPA-DHANPIATILSAAMMCKLSLNLTKEGNAIEEAV 329

Query: 342 LNTIASGSENRTGDLAGTATTSSFTESVIK 371
             TI +G   +TGDL G  TT+    +V K
Sbjct: 330 KRTIDAGI--KTGDLGGKNTTTEVGNAVAK 357

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score = 77.0 bits (188), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 88/351 (25%), Positives = 147/351 (41%), Gaps = 32/351 (9%)

Query: 48  GDGVGPEISKSVKDIFKAAQVPVDWEYCDVSPLLINGLTT------IPEPAVQQINKHKI 101
           GD VG EI++    + KA          +    LI G         +P+ A++   K   
Sbjct: 10  GDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEALEASKKADA 69

Query: 102 ALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAR-------SIRGYETTY-KNV 148
            L G +  P  G G     + L L +RK   L+AN+RP          +   +  Y +  
Sbjct: 70  VLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLELSPLKAQYAQGT 128

Query: 149 DLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPR-LVVV 206
           D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  +  +
Sbjct: 129 DFVVVRELVGGIYFGERKEDEGDGVAWDSEQYSVPEVQRITRMAAFLALQHNPPLPIWSL 188

Query: 207 HKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYG 266
            K+ +   +      + K +  EFP + +  +LID+  + +V++P +  + + +  N++G
Sbjct: 189 DKANVLASSRLWRKTVEKTIKEEFPTLSVNHQLIDSAAMILVKNP-TQLNGIIITSNMFG 247

Query: 267 DIXXXXXXXXXXX-----XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSS 321
           DI                        +      ++E  HGSAPD+A + K NP A +LS+
Sbjct: 248 DIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLA-KGKVNPVATILSA 306

Query: 322 CMMLNY-MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIK 371
            MML   + +      IE A+   +  G   RTGDL G+ +TS   ++V K
Sbjct: 307 AMMLKLSLNMVEEGVAIEKAVKKVLDDGI--RTGDLGGSNSTSEVGDAVAK 355

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 87/352 (24%), Positives = 148/352 (42%), Gaps = 30/352 (8%)

Query: 46  IEGDGVGPEISKSVKDIFKA-----AQVPVDWEYCDVSPLLINGL-TTIPEPAVQQINKH 99
           + GD VG EI+     +  A       V  D++Y  +    I+     +P+ A+    K 
Sbjct: 10  LPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLPDEALDAAKKA 69

Query: 100 KIALKGPLATP-IGKGHRSLN---LTLRKTFGLFANVRPAR-------SIRGYETTY-KN 147
              L G +  P  G G        L +RK   L+AN+RP          +   +  Y K 
Sbjct: 70  DAVLLGAVGGPKWGTGQVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKPEYAKG 129

Query: 148 VDLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPR-LVV 205
            D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  +  
Sbjct: 130 TDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQQNPPLPIWS 189

Query: 206 VHKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLY 265
           + K+ +   +      + + +  EFP + ++ +LID+  + +V+ P +  + + +  N++
Sbjct: 190 LDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKSP-TKLNGIVITSNMF 248

Query: 266 GDIXXXXXXXX-----XXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLS 320
           GDI                        +      ++E  HGSAPD+  +NK NP A +LS
Sbjct: 249 GDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPDLP-KNKVNPIATILS 307

Query: 321 SCMMLNY-MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIK 371
           + MML   + L    N +E A+   + +G   RT DL G  +TS   ++V+K
Sbjct: 308 AAMMLKLSLNLVEEGNAVEEAVRRVLDAGI--RTADLRGENSTSEVGDAVVK 357

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 86/358 (24%), Positives = 151/358 (42%), Gaps = 33/358 (9%)

Query: 42  TVPFIEGDGVGPEISKSVKDIFKAAQ------VPVDWEYCDVSPLLINGL-TTIPEPAVQ 94
           T+  + GD VG EI++    +  A Q      V   +++  +    I+     +P+ A++
Sbjct: 6   TIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEALE 65

Query: 95  QINKHKIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPARSIRG--------Y 141
              K    L G +  P  G G     + L L +RK   L+AN+RP               
Sbjct: 66  ASKKADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLK 124

Query: 142 ETTYKNVDLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGR 200
               +  D V++RE   G Y G  +     GV    +  +    +R+ R A   A     
Sbjct: 125 PEIARGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFMALQHNP 184

Query: 201 PR-LVVVHKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVT 259
           P  +  + K+ +   +      + + +  EFP + ++ +LID+  + +V++P ++ + + 
Sbjct: 185 PLPIWSLDKANVLASSRLWRKTVEETIKNEFPQLTVQHQLIDSAAMILVKNP-THLNGII 243

Query: 260 VCPNLYGDIXXXXXXXXXXX-----XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANP 314
           +  N++GDI                        +      ++E  HGSAPD+  + K NP
Sbjct: 244 ITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLP-KGKVNP 302

Query: 315 TALLLSSCMMLNY-MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIK 371
            A +LS+ MML   + L      IE A+   + SG   RT DL GT +T+   ++V K
Sbjct: 303 VATILSAAMMLKLSLDLFEEGEIIEQAVKKVLDSGI--RTADLKGTNSTTEVGDAVAK 358

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 87/354 (24%), Positives = 150/354 (42%), Gaps = 38/354 (10%)

Query: 48  GDGVGPEISKSVKDIFKA---AQVPVDWEYCDVSPLLINGLTT------IPEPAVQQINK 98
           GD VG EI+     + KA    +  V +E+      LI G         +P+ +++   K
Sbjct: 12  GDHVGQEITDEAIKVLKAISEVRSSVKFEF---QQHLIGGAAIDATGEPLPDASLEAAKK 68

Query: 99  HKIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPAR-------SIRGYETTY- 145
               L G +  P  G G     + L L +RK   L+AN+RP          +   +  + 
Sbjct: 69  ADAVLLGAVGGPKWGTGAVRPEQGL-LKIRKELQLYANLRPCNFASESLLDLSPLKAEHA 127

Query: 146 KNVDLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLV 204
           +  D V++RE   G Y G  +     GV    +  +    +R+ R A   A     P  V
Sbjct: 128 RGTDFVVVRELVGGIYFGERKEDEGDGVAWDSEKYSVPEVQRITRMAAFLALQHNPPLPV 187

Query: 205 V-VHKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPN 263
             + K+ +   +      + + +  EFP + ++ +LID+  + +V++P +  + V +  N
Sbjct: 188 WSLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMIMVKNP-TQLNGVIITNN 246

Query: 264 LYGDIXXXXXXXXXXX-----XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALL 318
           ++GDI                        +      ++E  HGSAPD+  + K NP A +
Sbjct: 247 MFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLE-KGKVNPIATI 305

Query: 319 LSSCMMLNY-MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIK 371
           LS+ MML   + +      +E A+   + SG   RTGDL G+ +T    ++V K
Sbjct: 306 LSAAMMLELSLDMFEEGTAVEEAVRRVLDSGI--RTGDLRGSNSTQEVGDAVAK 357

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 69/268 (25%), Positives = 116/268 (43%), Gaps = 20/268 (7%)

Query: 120 LTLRKTFGLFANVRPAR----SIRGY----ETTYKNVDLVLIRENTEGEYSGI-EHVVAP 170
           L +RK   L+AN+RP      S+ G     E   K  D  ++RE   G Y G  +     
Sbjct: 94  LKIRKELQLYANLRPCNFVSDSLLGLSPLKEEIAKGTDFTVVRELVGGIYFGDRKEDDGD 153

Query: 171 GVVQSIKLITRDASERVIRYAYEYARAIGRPR-LVVVHKSTIQKLADGLFVNIAKELAPE 229
           G     +  T    +R+ R A   A     P  +  + K+ +   +      + + +  E
Sbjct: 154 GSAWDCEKYTIPEVQRITRMAAFLALQHDPPLPIWSLDKANVLASSRLWRKTVEETIKNE 213

Query: 230 FPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLYGDIXXXXXXXXXXX-----XXXXX 284
           FP++K++ +LID+  + +V+  P   + + +  N++GDI                     
Sbjct: 214 FPNLKVQHQLIDSAAMILVKS-PRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLA 272

Query: 285 XXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLSSCMMLNY-MGLESYSNKIENAILN 343
              +      ++E  HGSAPD+  + K NP A +LS+ MML   + L      IE A+  
Sbjct: 273 SLPDTNTAFGLYEPCHGSAPDLP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAVKQ 331

Query: 344 TIASGSENRTGDLAGTATTSSFTESVIK 371
            + +G   RT DL G+ +TS   ++V K
Sbjct: 332 VLDAGI--RTADLKGSNSTSEVGDAVAK 357

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 84/353 (23%), Positives = 148/353 (41%), Gaps = 32/353 (9%)

Query: 46  IEGDGVGPEISKSVKDIFKA-----AQVPVDWEYCDVSPLLINGL-TTIPEPAVQQINKH 99
           + GD VG EI++    +  A       V  D+++  +    I+     +P+ A++   K 
Sbjct: 93  LPGDHVGQEITEEAIKVLNAISSVRPNVNFDFQHHLIGGAAIDATGVPLPDEALEASKKA 152

Query: 100 KIALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPARSIRG--------YETTYK 146
              L G +  P  G G     + L L +RK   L+AN+RP                   K
Sbjct: 153 DAVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLKPEIVK 211

Query: 147 NVDLVLIRENTEGEYSG-IEHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPRLVV 205
             D+ ++RE   G Y G  +     GV    +  +    +R+ R A   A     P  V 
Sbjct: 212 GTDICIVRELVGGIYFGERKEDEGDGVAWDSEKYSVSEVQRITRMAGFLALQHNPPLPVW 271

Query: 206 -VHKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNL 264
            + K+ +   +      + + +  EFP + ++ +LID+  + +V++P ++ + V +  N+
Sbjct: 272 SLDKANVLASSRLWRKTVEETIKNEFPTLTVQHQLIDSAAMILVKNP-THLNGVVIANNM 330

Query: 265 YGDIXXXXXXXXXXX-----XXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLL 319
           +GDI                        +      ++E  HGSAPD+  + K NP A +L
Sbjct: 331 FGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPDLP-KGKVNPVATIL 389

Query: 320 SSCMMLNY-MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIK 371
           S  MML   + +      +E A+   + SG   RT DL G+ +TS   +++ K
Sbjct: 390 SVAMMLKLSLNMTEEGIAVEKAVKQVLDSGV--RTADLRGSNSTSEVGDAIAK 440

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 83/352 (23%), Positives = 148/352 (42%), Gaps = 33/352 (9%)

Query: 48  GDGVGPEISKSVKDIFKAAQ------VPVDWEYCDVSPLLINGL-TTIPEPAVQQINKHK 100
           GD VG E+++    I KA +      V  ++EY  +    I+     +P+ +++   +  
Sbjct: 12  GDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDESLEASKRAD 71

Query: 101 IALKGPLATP-IGKG----HRSLNLTLRKTFGLFANVRPARSIRG--------YETTYKN 147
             L G +  P  G G     + L L +RK   L+AN+RP               E   K 
Sbjct: 72  AVLLGAVGGPKWGTGSVRPEQGL-LKIRKELQLYANLRPCNFASDSLLDLSPLKEKYAKG 130

Query: 148 VDLVLIRENTEGEYSGI-EHVVAPGVVQSIKLITRDASERVIRYAYEYARAIGRPR-LVV 205
            D  ++RE   G Y G  +     GV    +  +    +R+ R A   A     P  +  
Sbjct: 131 TDFTVVRELVGGIYFGKRKEDDGDGVAWDSEQYSVPEVQRITRMAAFLAMQHNPPLPIWS 190

Query: 206 VHKSTIQKLADGLFVNIAKELAPEFPDIKLETELIDNTVLNVVRDPPSYTDAVTVCPNLY 265
           + K+ +   +      + + +  EFP +K+  +LID+  + +V++ P+  + + +  N++
Sbjct: 191 LDKANVLASSRLWRKTVEETIQNEFPSLKVSHQLIDSAAMILVKN-PTQLNGIIITNNMF 249

Query: 266 GDIXXXXXXX-----XXXXXXXXXXXANIGNEVSIFEAVHGSAPDIAGQNKANPTALLLS 320
           GDI                        +  +   ++E  HGSAPD+  + K NP   +LS
Sbjct: 250 GDIISDEASVIPGSLGLLPSASLSSLPDTNSAFGLYEPCHGSAPDLP-KGKVNPIGTILS 308

Query: 321 SCMMLNY-MGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIK 371
             MML   + L+     +E A+   + +    RT DL G+ +TS   ++V K
Sbjct: 309 VAMMLKLSLNLKEEGIAVEEAVRRVLDNNI--RTADLGGSNSTSDIGDAVAK 358

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 39.3 bits (90), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 323 MMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373
           +MLN++GL   + +I  A+  TIA G ++ T D+ G+++T+ FT  +I  L
Sbjct: 1   LMLNHLGLNESATRISKAVHETIAEG-KHTTRDIGGSSSTTDFTNEIINKL 50

>ADR028W Chr4 (753946..756444) [2499 bp, 832 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR089W
          Length = 832

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%)

Query: 316 ALLLSSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESV 369
           AL L    ML   G   +   +EN  ++ +AS   N  G+L   ATT S T +V
Sbjct: 121 ALELFMAWMLQRFGRHHFKVPVENLAMSIVASSLVNDRGELLSYATTCSVTYAV 174

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,506,121
Number of extensions: 1363651
Number of successful extensions: 4096
Number of sequences better than 10.0: 85
Number of HSP's gapped: 3908
Number of HSP's successfully gapped: 85
Length of query: 373
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 262
Effective length of database: 40,753,473
Effective search space: 10677409926
Effective search space used: 10677409926
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)