Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B022305.475ON79079035020.0
Kpol_543.95.475ON6427119981e-124
TDEL0A033905.475ON6227009871e-123
TPHA0J027805.475ON6317109791e-122
Suva_8.1905.475ON6665398701e-105
Skud_15.3025.475ON6785128421e-101
YOR138C (RUP1)5.475ON6715148331e-100
Smik_15.3185.475ON6725128292e-99
NCAS0H022705.475ON6965308154e-97
KAFR0E025405.475ON6595238047e-96
SAKL0G03564g5.475ON6055487441e-87
NDAI0C013905.475ON7095517309e-85
ZYRO0D11264g5.475ON5474917172e-84
TBLA0A025405.475ON6785466683e-76
KNAG0B040505.475ON6735116176e-69
KLTH0F15004g5.475ON5975346021e-67
Kwal_55.212675.475ON6045096012e-67
CAGL0I07205g5.475ON6035175994e-67
KLLA0E03169g5.475ON5445144409e-46
Kwal_56.230843.270ON76237870.088
TDEL0D035503.270ON78052810.55
AGL111W8.403ON471111800.59
Skud_5.2808.185ON42836781.1
YER143W (DDI1)8.185ON42836771.1
NDAI0A074103.270ON81039771.5
Suva_4.2953.270ON78252761.8
NCAS0I016203.270ON79551752.5
ZYRO0D04048g8.537ON60976752.8
KAFR0C004103.270ON76954752.8
Smik_5.3088.185ON42836734.3
Skud_2.1773.270ON78239725.1
SAKL0D03322g3.270ON76537726.5
Skud_5.3108.237ON77552726.5
KLLA0F27269g8.78ON1216128717.5
YBR058C (UBP14)3.270ON78152717.6
Smik_6.4806.8ON516104717.7
KLTH0C07326g3.270ON76237717.9
Smik_2.1893.270ON78252709.0
Suva_7.2774.118ON26552699.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B02230
         (790 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.4...  1353   0.0  
Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON} ...   389   e-124
TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {O...   384   e-123
TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {...   381   e-122
Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON...   339   e-105
Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {...   328   e-101
YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON} ...   325   e-100
Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {...   323   2e-99
NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {O...   318   4e-97
KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.4...   314   7e-96
SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {...   291   1e-87
NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.4...   285   9e-85
ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {...   280   2e-84
TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.4...   261   3e-76
KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.4...   242   6e-69
KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weak...   236   1e-67
Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138...   236   2e-67
CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} simila...   235   4e-67
KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {...   174   9e-46
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    38   0.088
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    36   0.55 
AGL111W Chr7 (498099..499514) [1416 bp, 471 aa] {ON} Syntenic ho...    35   0.59 
Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W ...    35   1.1  
YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA da...    34   1.1  
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    34   1.5  
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    34   1.8  
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    33   2.5  
ZYRO0D04048g Chr4 (330261..332090) [1830 bp, 609 aa] {ON} simila...    33   2.8  
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    33   2.8  
Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W ...    33   4.3  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    32   5.1  
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    32   6.5  
Skud_5.310 Chr5 (512188..514515) [2328 bp, 775 aa] {ON} YER171W ...    32   6.5  
KLLA0F27269g Chr6 (2520782..2524432) [3651 bp, 1216 aa] {ON} sim...    32   7.5  
YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}  ...    32   7.6  
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...    32   7.7  
KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly...    32   7.9  
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    32   9.0  
Suva_7.277 Chr7 complement(481312..482109) [798 bp, 265 aa] {ON}...    31   9.7  

>TBLA0B02230 Chr2 (521358..523730) [2373 bp, 790 aa] {ON} Anc_5.475
           YOR138C
          Length = 790

 Score = 1353 bits (3502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 683/790 (86%), Positives = 683/790 (86%)

Query: 1   MEDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELPPRIXXX 60
           MEDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELPPRI   
Sbjct: 1   MEDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELPPRIDEN 60

Query: 61  XXXXXXXXXXXXXXXXXIPISGSNGFQPGDLNKYLTDKNNAIVQDTDSTSHXXXXXXXXX 120
                            IPISGSNGFQPGDLNKYLTDKNNAIVQDTDSTSH         
Sbjct: 61  SDNNTNTNVYNDNTGNTIPISGSNGFQPGDLNKYLTDKNNAIVQDTDSTSHNATINTSFI 120

Query: 121 XXXXXXXXXXXXXXXXXXXYMSESDIDIDMMTSSTRELSTDIRSQSFKPQASYTSTHKLQ 180
                              YMSESDIDIDMMTSSTRELSTDIRSQSFKPQASYTSTHKLQ
Sbjct: 121 NNTTTTTSNSNSNSNPNTNYMSESDIDIDMMTSSTRELSTDIRSQSFKPQASYTSTHKLQ 180

Query: 181 ISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWYSISNNNENT 240
           ISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWYSISNNNENT
Sbjct: 181 ISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWYSISNNNENT 240

Query: 241 TTDSLFLQLQRVTSIINSRMSERAFISTKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESL 300
           TTDSLFLQLQRVTSIINSRMSERAFISTKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESL
Sbjct: 241 TTDSLFLQLQRVTSIINSRMSERAFISTKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESL 300

Query: 301 VTTVLPPIFKDILVTTAINKDSQTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYG 360
           VTTVLPPIFKDILVTTAINKDSQTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYG
Sbjct: 301 VTTVLPPIFKDILVTTAINKDSQTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYG 360

Query: 361 RNXXXXXXXXXXXXXXXXXXXXXXXXXXISPIFTILFXXXXXXXXXXTTLPEGVEIPLQF 420
           RN                          ISPIFTILF          TTLPEGVEIPLQF
Sbjct: 361 RNDDEQSDESLQTDDDDNDDANDSALEEISPIFTILFEEYDESDSSSTTLPEGVEIPLQF 420

Query: 421 YPQLYSKKVNDQLIKHIISKRKEAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEKD 480
           YPQLYSKKVNDQLIKHIISKRKEAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEKD
Sbjct: 421 YPQLYSKKVNDQLIKHIISKRKEAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEKD 480

Query: 481 SQRETKSANNLTNILTEMKNCKNLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLID 540
           SQRETKSANNLTNILTEMKNCKNLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLID
Sbjct: 481 SQRETKSANNLTNILTEMKNCKNLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLID 540

Query: 541 SPYNLSMVIFSPDLYLIKKANVDWYLIDCRSINQMQXXXXXXXXXXXXPDLFVLRKCNSE 600
           SPYNLSMVIFSPDLYLIKKANVDWYLIDCRSINQMQ            PDLFVLRKCNSE
Sbjct: 541 SPYNLSMVIFSPDLYLIKKANVDWYLIDCRSINQMQNKNRNNNNNNNNPDLFVLRKCNSE 600

Query: 601 IEIQDIIKQKTRNPSETPLMFIYCKESFLPNEDDVMKSFESNMACTKFLKEDQLTLNESN 660
           IEIQDIIKQKTRNPSETPLMFIYCKESFLPNEDDVMKSFESNMACTKFLKEDQLTLNESN
Sbjct: 601 IEIQDIIKQKTRNPSETPLMFIYCKESFLPNEDDVMKSFESNMACTKFLKEDQLTLNESN 660

Query: 661 MNSGESXXXXXXXXXXXFEEYGSQNSHYDASVSNNNNTSDMRNITDPYGEKNDHMTVNND 720
           MNSGES           FEEYGSQNSHYDASVSNNNNTSDMRNITDPYGEKNDHMTVNND
Sbjct: 661 MNSGESDIDMDQDDHQDFEEYGSQNSHYDASVSNNNNTSDMRNITDPYGEKNDHMTVNND 720

Query: 721 NEFDIMHEENVVINDVITEDTKNIDDIEQDESLDIKVETDSINGDEPQDLIVNDNDKSDE 780
           NEFDIMHEENVVINDVITEDTKNIDDIEQDESLDIKVETDSINGDEPQDLIVNDNDKSDE
Sbjct: 721 NEFDIMHEENVVINDVITEDTKNIDDIEQDESLDIKVETDSINGDEPQDLIVNDNDKSDE 780

Query: 781 NDMKVGAIHL 790
           NDMKVGAIHL
Sbjct: 781 NDMKVGAIHL 790

>Kpol_543.9 s543 complement(22643..24571) [1929 bp, 642 aa] {ON}
           complement(22643..24571) [1929 nt, 643 aa]
          Length = 642

 Score =  389 bits (998), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 248/711 (34%), Positives = 373/711 (52%), Gaps = 131/711 (18%)

Query: 7   IQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELPPRIXXXXXXXXX 66
           I +LI+MGIP D+A +AL  ANGN+EAAVN+IFSNELP +A                   
Sbjct: 9   INSLIEMGIPRDIAIDALSRANGNLEAAVNFIFSNELPAEAEN--------------SDI 54

Query: 67  XXXXXXXXXXXIPISGSNGFQPGDLNKYLTDKN----------NAIVQDTDSTSHXXXXX 116
                      + IS    FQPGDL + + ++           N   ++ DS        
Sbjct: 55  EIISYKEKANHVEISNKESFQPGDLTEVIANQQPLQPEFQNYVNDNSENIDSNC------ 108

Query: 117 XXXXXXXXXXXXXXXXXXXXXXXYMSESDID-IDMMTSSTRELSTDIRSQSFKP--QASY 173
                                  Y+S+  +D +D  +S +  ++  +      P  Q   
Sbjct: 109 -----------------------YVSDKIVDNMDYYSSDSDYITNSVTDNLLPPSYQIVK 145

Query: 174 TSTHKLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPL-QIFETQQFNDLMYNKKWYS 232
            S HK ++ DPTV+LPL  N ++ENY +L  YSLC+   L  I     F DL + + W+ 
Sbjct: 146 HSDHKSRLRDPTVILPLPPNSMIENYFAL--YSLCITNYLPHIIMRPDFKDLSFTEDWFK 203

Query: 233 ----------------------------ISNNNENTTTDSLFLQLQRVTSIINSRMSERA 264
                                       I + N++     L  QLQ+++SI+NS MSERA
Sbjct: 204 GSSFSKPKNVLKSVTDETTSKSTMKICPIEDMNQDDDQPELLWQLQKLSSIVNSTMSERA 263

Query: 265 FISTKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTVLP-PIFKD-----ILVTTAI 318
           ++  K+FS   ++     L+++DHLNE+   FI+ LV  +   P F++     + +++A 
Sbjct: 264 YVCAKIFSVILDQQSQIRLAEADHLNEVLPSFIKYLVVNLESCPGFEEDEIRKLFISSAF 323

Query: 319 NKDSQTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYGRNXXXXXXXXXXXXXXXX 378
              S       + +S+ +FLP+EY+SNLYKMFN L+YP+E   +                
Sbjct: 324 YTPSDDQAPITTLLSLFHFLPDEYDSNLYKMFNVLLYPDENDSDYESGDESEQGNSLGD- 382

Query: 379 XXXXXXXXXXISPIFTILFXXXXXXXXXXTTLPEGVEIPLQFYPQLYSKKVNDQLIKHII 438
                     ISPI +I+F           +LPEGVE+PL+F+PQ+Y+K   ++LIKHII
Sbjct: 383 ----------ISPILSIVFDEAEEGSSG-ISLPEGVEVPLEFFPQIYTKDCKNKLIKHII 431

Query: 439 SKRKEAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEKDSQRETKSANNLTNILTEM 498
           +KRK+AQ KS+ +LN+INS+KSFQGKDI+K + S+++Y+E+D++     ++N+T  L ++
Sbjct: 432 AKRKDAQFKSKEILNDINSIKSFQGKDILKFINSSLEYLERDNK-----SDNITEELLKI 486

Query: 499 KN----CKNLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDL 554
           KN     K  KM++Y++L +KL +EWN+S+PE  I+ET ++L LI  PY L M + SP  
Sbjct: 487 KNDMAIVKTQKMNEYRDLAQKLQNEWNISNPETHIVETGRKLGLIGEPYLLVMAVLSPYS 546

Query: 555 YLIKKANVDWYLIDCRSINQMQXXXXXXXXXXXXPDLFVLRKCNSEIEIQDIIKQKTRNP 614
           Y I++    W L+ C +                    F +R+C+SE+E++D IKQ TR+ 
Sbjct: 547 YYIRERTGKWNLVQCSTTGGD----------------FDVRECSSELEVKDTIKQATRHA 590

Query: 615 SETPLMFIYCKESFLPNEDDVMKSFESNMACTKFLKEDQLTLNESNMNSGE 665
           SETPLMF+YC+   +P E ++ KSFESN  C  F KEDQL LN+ N NS E
Sbjct: 591 SETPLMFMYCRRDVIPEEYEIRKSFESNSGCLNFFKEDQLVLNKMN-NSDE 640

>TDEL0A03390 Chr1 complement(603062..604930) [1869 bp, 622 aa] {ON}
           Anc_5.475 YOR138C
          Length = 622

 Score =  384 bits (987), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 234/700 (33%), Positives = 355/700 (50%), Gaps = 140/700 (20%)

Query: 1   MEDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELPPRIXXX 60
           M D + +++L++MGI  DVA +ALR  NG+VEAA N+IF N+ P Q S+  E    I   
Sbjct: 1   MNDTDAVRSLVEMGISKDVAEDALRRTNGDVEAAGNFIFCNDAPAQISENVEQRAHIE-- 58

Query: 61  XXXXXXXXXXXXXXXXXIPISGSNGFQPGDLNKYLTDKNNAIVQDTDSTSHXXXXXXXXX 120
                            +P   ++GFQPGDLN+Y+++       DT+S            
Sbjct: 59  -----------------LPAGSASGFQPGDLNEYISN-----APDTESED---------- 86

Query: 121 XXXXXXXXXXXXXXXXXXXYMSESDIDIDMMTSSTRELSTDIRSQSFKPQASYTSTHKLQ 180
                                 E D++ D + +                 +   S  K Q
Sbjct: 87  --------------------FEEIDVEEDSVETGP---------------SLECSGRKGQ 111

Query: 181 ISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWYS-------- 232
           ISDPTV+LPL  N L E Y +LF   +    P  +     F DL Y+K WY         
Sbjct: 112 ISDPTVVLPLPPNFLFEGYFALFCLFVANYMP-HLLARPDFIDLNYDKNWYRGDSYTNAE 170

Query: 233 -----ISNNNEN-------------------TTTDSLFLQLQRVTSIINSRMSERAFIST 268
                +S N  +                   T    L  QLQ++ S+ NSRMS+RA++  
Sbjct: 171 YRLKYLSKNGSDDEQIEIVPKDELTQEDGDYTLQSELLWQLQKLASVANSRMSDRAYVRA 230

Query: 269 KMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV-LPPIFKD-----ILVTTAI---- 318
           KMF+ A    +   +++++HL+E+   FI+S+   + + P F+D       +++A     
Sbjct: 231 KMFAIAVEPQVQRNMAEAEHLHEVLPSFIKSVAVDLEMCPNFQDNEVRECFISSAFHTPS 290

Query: 319 NKDSQTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYGRNXXXXXXXXXXXXXXXX 378
           N   Q     ++ +S+ +FLPEEYE+NLY+MFN L++ ++                    
Sbjct: 291 NSAPQEESTMKTWLSLFHFLPEEYETNLYRMFNALLFADD----------SVESDQSDSP 340

Query: 379 XXXXXXXXXXISPIFTILFXXXXXXXXXXTTLPEGVEIPLQFYPQLYSKKVNDQLIKHII 438
                     I+P+FTI+F            L EGVE+PL+FYPQLY+K+  D+LIKHII
Sbjct: 341 DGEGENSLSEIAPVFTIVFDEMEETTEA-VPLAEGVEMPLEFYPQLYTKECKDKLIKHII 399

Query: 439 SKRKEAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEKDSQRETKSANNLTNILTEM 498
           +KR+++Q+ SR++L EI  LKSFQGKD+ K + S++DY++KD ++  +    L ++  ++
Sbjct: 400 AKRRQSQTDSRAILQEITDLKSFQGKDLSKFINSSLDYLQKD-EKSPELIKGLLDLKDQI 458

Query: 499 KNCKNLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDLYLIK 558
            N K  KM++YKE+  +L SEWNLS PE  I++TAK+L LID  Y L+M + SP +Y  +
Sbjct: 459 TNKKTKKMNEYKEIAHRLQSEWNLSLPEIQIVKTAKELGLIDDSYLLTMAVISPYMYYTR 518

Query: 559 KANVDWYLIDCRSINQMQXXXXXXXXXXXXPDLFVLRKCNSEIEIQDIIKQKTRNPSETP 618
             +  W+ +                        + +R C+S +EIQD IKQ TR PSE P
Sbjct: 519 NRDGQWFFVQSTPYEAS----------------YNVRACSSPLEIQDAIKQHTRRPSEAP 562

Query: 619 LMFIYCKESFLPNEDDVMKSFESNMACTKFLKEDQLTLNE 658
           LMFIYCK+ F+P++D V+K+ E+N  C +F K+DQL LN+
Sbjct: 563 LMFIYCKKGFIPDDDTVLKALENNQGCHRFAKDDQLQLNK 602

>TPHA0J02780 Chr10 complement(619045..620940) [1896 bp, 631 aa] {ON}
           Anc_5.475 YOR138C
          Length = 631

 Score =  381 bits (979), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 247/710 (34%), Positives = 369/710 (51%), Gaps = 129/710 (18%)

Query: 2   EDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELPPRIXXXX 61
           +++  +++++DMGIP DVA +AL   NG++EAAVN+IFSNELP   + M E         
Sbjct: 3   DNKNSVKSIVDMGIPEDVAIDALNRVNGDLEAAVNFIFSNELP--DNNMGE--------- 51

Query: 62  XXXXXXXXXXXXXXXXIPISGSNGFQPGDLNKYLTDKNNAIVQDTDSTSHXXXXXXXXXX 121
                           + IS  N FQ GDL++ +   N       ++ S           
Sbjct: 52  ----SVGNEKYTTSEHVNISNDNNFQAGDLSEVMNVSNYGYDNRFETDS----------- 96

Query: 122 XXXXXXXXXXXXXXXXXXYMSESDIDIDMMTSSTRELSTDIRSQSFKPQASYTSTHKLQ- 180
                                  D+  D +  S  E+  +  S + K  A     H+++ 
Sbjct: 97  ----------------------GDLSSDEV--SDPEIVENDISNNLKLPAYNIVKHEVEK 132

Query: 181 --ISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWY------- 231
             +SDPTV++PL  N ++E+Y  LF   + +  P  +     F DL Y+ +WY       
Sbjct: 133 TSLSDPTVVMPLPHNSIIESYFGLFSMFISIYLP-HLLLKPDFKDLNYDNEWYNGLKFVA 191

Query: 232 ---SISNNNENTTTD--------------------SLFLQLQRVTSIINSRMSERAFIST 268
               I  +NE +  D                     L  QLQ++++I+NS MSER+++S+
Sbjct: 192 PKFGIKVHNEESLKDDLHTSIEPLTCVDRDLDDQPKLLWQLQKLSTIMNSTMSERSYVSS 251

Query: 269 KMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV------LPPIFKDILVTTAINKDS 322
           K+FS   +++    L  ++HL E+   FI+ L + +       P   ++ L+++A    S
Sbjct: 252 KLFSLCLDRNAKMKLQDAEHLYEVLPSFIKYLTSNLEMCPDFRPDEIRNELISSAYYLPS 311

Query: 323 QTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYGRNXXXXXXXXXXXXXXXXXXXX 382
                 ++ +++ +FLP+EYESNLYKMFN L+Y ++   +                    
Sbjct: 312 DDEPPVKTLLTLFHFLPDEYESNLYKMFNILLYADDEDGDGAIDEGNSLNY--------- 362

Query: 383 XXXXXXISPIFTILFXXXXXXXXXXTTLPEGVEIPLQFYPQLYSKKVNDQLIKHIISKRK 442
                 ++P  TI+F          T LPEGV IPL+FYPQLY+K+  DQLIKHII KR+
Sbjct: 363 ------LAPNLTIIFDEIDELSSM-TPLPEGVSIPLEFYPQLYTKECKDQLIKHIIGKRQ 415

Query: 443 EAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEKDSQRE-------TKSANNLTNIL 495
           +AQ +SR  L ++NSLKSFQGKDI+K L ST+D++++D QR+        K    LT+I 
Sbjct: 416 DAQKESRQHLKDLNSLKSFQGKDILKFLNSTLDFLDRDGQRQNGLTEGNGKLMEGLTDIK 475

Query: 496 TEMKNCKNLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDLY 555
            ++   K  KM+ YK+LT+KL++ WNLS+PE SII TAK+L LID PY+LSM + SP+LY
Sbjct: 476 EQLTKKKTEKMNAYKDLTQKLNTSWNLSNPEVSIIATAKKLGLIDEPYHLSMAVMSPNLY 535

Query: 556 LIKKANVDWYLIDCRSINQMQXXXXXXXXXXXXPDLFVLRKCNSEIEIQDIIKQKTRNPS 615
            IKK +  WYL+                      D F +RKC+S +EIQD ++Q TR+ S
Sbjct: 536 YIKKRDGTWYLVQITE----------------NGDDFDIRKCSSGVEIQDCVRQYTRHGS 579

Query: 616 ETPLMFIYCKESFLPNEDDVMKSFESNMACTKFLKEDQLTLNESNMNSGE 665
           ETPLMF+Y KE  +P++D V K  E+N  C +FLK+DQ  LNE  MN  +
Sbjct: 580 ETPLMFVYTKEGSIPDDDSVQKILEANTGCLQFLKDDQKLLNEMVMNESD 629

>Suva_8.190 Chr8 complement(339480..341480) [2001 bp, 666 aa] {ON}
           YOR138C (REAL)
          Length = 666

 Score =  339 bits (870), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 198/539 (36%), Positives = 296/539 (54%), Gaps = 77/539 (14%)

Query: 164 SQSFKPQASYTSTH----KLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQ 219
           S++  P  SY+       K  + DPTV+LPL  N L+E+Y  LF     M  P  +F   
Sbjct: 119 SETSLPPPSYSIVQHNQFKSAVDDPTVVLPLPLNSLIESYFGLFALLASMYFP-HVFLKP 177

Query: 220 QFNDLMYNKKWYSISNNNE-------------NTTTD-------------SLFLQLQRVT 253
            F DL Y   W+  S+  E             +TT++              L  QLQ++ 
Sbjct: 178 DFQDLNYRPDWFKGSSFAEPRYRLAYRESSDGSTTSEIVVASGPSKDVQPHLLWQLQKLI 237

Query: 254 SIINSRMSERAFISTKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV-LPPIFKD- 311
           S++N++M ERAF+S K+F+ +    L   L+ S+HL E+   FI+SL   + + P  +D 
Sbjct: 238 SVVNTKMCERAFVSAKLFTLSLEPQLKAKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDR 297

Query: 312 ----ILVTTAINKDSQTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNE--------Y 359
               + +++A++   +      + +S+ +FLPEEY+SNLYKMFN L+YP E        Y
Sbjct: 298 ETRNLFISSALHTPDKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEEEGEVVY 357

Query: 360 GRNXXXXXXXXXXXXXXXXXXXXXXXXXXISPIFTILFXXXXXXXXXXTTLPEGVEIPLQ 419
           G +                          ++P+ TILF           TLP GV++PL+
Sbjct: 358 GGDGAHQEPENTLKE--------------VAPVLTILFNELETNTES-VTLPNGVDVPLE 402

Query: 420 FYPQLYSKKVNDQLIKHIISKRKEAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEK 479
           FYPQLY+K+  DQLI+HIISKRK+A+ KSRSLL EIN+LKS+QGK+I  IL+ST+ Y++ 
Sbjct: 403 FYPQLYTKRCKDQLIRHIISKRKQARVKSRSLLQEINNLKSYQGKNISTILESTLAYLQA 462

Query: 480 DSQ-RETKSANNLTNILTEMKNCKNLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNL 538
           D++  + +++  + ++   + + +  KM++YK+L  KLH EWNLSHPE  II TAKQL L
Sbjct: 463 DTKDADNEASKQIASLKDTLNSSRAAKMEEYKDLASKLHGEWNLSHPEIHIINTAKQLGL 522

Query: 539 IDSPYNLSMVIFSPDLYLIKKANVDWYLIDCRSINQMQXXXXXXXXXXXXPDLFVLRKCN 598
           I++PY LSM + SP  Y  +  + +W  I   ++                   F + KC+
Sbjct: 523 IENPYILSMAVLSPYSYFTRDRDGEWSWIQSNTLGTE----------------FKINKCS 566

Query: 599 SEIEIQDIIKQKTRNPSETPLMFIYCKESFLPNEDDVMKSFESNMACTKFLKEDQLTLN 657
           S   +Q+ I+  T+  SE PLMFIYC+E  +P +D+V K+ E+N  C KF K+DQ TLN
Sbjct: 567 SPSVVQEAIRHGTKYASEMPLMFIYCEEGRIPTDDEVSKALENNTGCVKFAKDDQSTLN 625

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%)

Query: 1  MEDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQAS 48
          M D + +++L++MGIP +VA +AL+   GN+EAAVN+IFSNELP Q +
Sbjct: 1  MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQVA 48

>Skud_15.302 Chr15 complement(538346..540382) [2037 bp, 678 aa] {ON}
           YOR138C (REAL)
          Length = 678

 Score =  328 bits (842), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 179/512 (34%), Positives = 285/512 (55%), Gaps = 52/512 (10%)

Query: 178 KLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWYS----- 232
           K  + DPTV+LPL  N L+E+Y  LF   + +  P  +F    F DL Y+  W+      
Sbjct: 147 KCAVDDPTVVLPLPLNSLIESYFGLFALLVSVYFP-HVFLKPDFQDLNYSPDWFKGSSFT 205

Query: 233 ---------------------ISNNNENTTTDSLFLQLQRVTSIINSRMSERAFISTKMF 271
                                +++ + +     L  QLQ++ S+IN+RM ERAF+S ++F
Sbjct: 206 GPKYRLAYREADDGSATSEIVLASGSSDDLQPRLLWQLQKLISVINTRMCERAFVSARLF 265

Query: 272 SFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV-LPPIFKD-----ILVTTAINKDSQTN 325
           + +    L   L+ S+HL E+   FI+SL   + + P  +D     + +++A++  ++  
Sbjct: 266 TLSLEPQLKSKLADSEHLYEVLPTFIKSLAVDLEMCPGIRDRETRNLFISSALHTPNKNE 325

Query: 326 EIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYGRNXXXXXXXXXXXXXXXXXXXXXXX 385
               + +S+ +FLPEEY+SNLYKMFN L+YP E   +                       
Sbjct: 326 PPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEE-NDEEDATRNGGGGQEDEEFAEPENT 384

Query: 386 XXXISPIFTILFXXXXXXXXXXTTLPEGVEIPLQFYPQLYSKKVNDQLIKHIISKRKEAQ 445
              ++P+ TILF          T LP GV+IPL+FYPQLY+K+  DQLI+H+ISKRK+A+
Sbjct: 385 LKEVAPVLTILFNELETNTESMT-LPNGVDIPLEFYPQLYTKRCKDQLIRHVISKRKQAR 443

Query: 446 SKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEKD-SQRETKSANNLTNILTEMKNCKNL 504
            +SR+LL EIN+LKS+QGK+I  +L+ST+ Y++   +    K+A  + ++   + + ++ 
Sbjct: 444 IRSRTLLQEINNLKSYQGKNISTVLESTLAYLQASPNDANNKAARQIASLKDTLNSTRSA 503

Query: 505 KMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDLYLIKKANVDW 564
           KM++YK+L  K+H EW+LSHPE  II+TAKQL LI++PY L++   SP  Y ++  N  W
Sbjct: 504 KMEEYKDLASKVHGEWDLSHPETHIIKTAKQLRLIENPYILTLAALSPYSYFLRNRNGVW 563

Query: 565 YLIDCRSINQMQXXXXXXXXXXXXPDLFVLRKCNSEIEIQDIIKQKTRNPSETPLMFIYC 624
             +   ++                   F ++ C S   +Q+ IK  T+  SETPLMFIYC
Sbjct: 564 SWVQSNALGTE----------------FKIKNCPSPSVVQEAIKHGTKYASETPLMFIYC 607

Query: 625 KESFLPNEDDVMKSFESNMACTKFLKEDQLTL 656
           +E  +P E++V K+ ++N  C+KF K+D+ +L
Sbjct: 608 EEGKIPTEEEVSKALQNNTGCSKFAKDDENSL 639

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 37/47 (78%)

Query: 1  MEDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQA 47
          M D + +++L++MGIP +VA +AL    GN+EAAVN+IFSNELP QA
Sbjct: 1  MMDNQAVKSLLEMGIPHEVAMDALHRTGGNLEAAVNFIFSNELPEQA 47

>YOR138C Chr15 complement(584309..586324) [2016 bp, 671 aa] {ON}
           RUP1Protein involved in regulation of Rsp5p, which is an
           essential HECT ubiquitin ligase; has a WW domain
           consensus motif of PPPSY (residues 131-135) that
           mediates binding of Rsp5p to Ubp2p; contains an UBA
           domain
          Length = 671

 Score =  325 bits (833), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/514 (36%), Positives = 281/514 (54%), Gaps = 58/514 (11%)

Query: 178 KLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWYSISNNN 237
           K  + DPTV+LPL  N L+E+Y  LF     +  P  +F    F DL Y   W+  S+  
Sbjct: 144 KSNVGDPTVVLPLPLNSLIESYFGLFALLTAVYFP-HVFLKPDFKDLNYRADWFKGSSFT 202

Query: 238 E-------------NTTTD-------------SLFLQLQRVTSIINSRMSERAFISTKMF 271
           E             +TT++              L  QLQ++ S++N+R  ERAF+S K+F
Sbjct: 203 EPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLWQLQKLISVVNTRKCERAFVSAKVF 262

Query: 272 SFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV-LPPIFKD-----ILVTTAINKDSQTN 325
           + +    L   L+ S+HL E+   FI+SL   + + P  +D     + +++A++  ++  
Sbjct: 263 TSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPGIRDRETRSLFISSALHTPNKNE 322

Query: 326 EIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYGRNXXXXXXXXXXXXXXXXXXXXXXX 385
               + +S+ +FLPEEY+SNLYKMFN L+YP                             
Sbjct: 323 PPMETFLSLFHFLPEEYDSNLYKMFNVLLYPE---EEEEEEDVIRGGEQEEARYVEPENT 379

Query: 386 XXXISPIFTILFXXXXXXXXXXTTLPEGVEIPLQFYPQLYSKKVNDQLIKHIISKRKEAQ 445
              ++P+ TILF           +LP GV+IPL+FYPQLY+K+  DQLI+HIISKRK+A+
Sbjct: 380 LKEVAPVLTILFNELETNTES-VSLPNGVDIPLEFYPQLYTKQCKDQLIRHIISKRKQAR 438

Query: 446 SKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEK---DSQRETKSANNLTNILTEMKNCK 502
           ++SR LL EIN LKS+QGK+I  IL+ST+ Y++    D+  E  +A  + ++   + + +
Sbjct: 439 TRSRCLLQEINELKSYQGKNISTILESTLAYLQTIPDDANNE--AAKQIASLKDTLNSAR 496

Query: 503 NLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDLYLIKKANV 562
             KM++YK+L  KLH EWNLSHPE  II TAKQL LI++PY L+M   SP  Y I+  N 
Sbjct: 497 AAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYILTMAALSPYSYFIRSRNG 556

Query: 563 DWYLIDCRSINQMQXXXXXXXXXXXXPDLFVLRKCNSEIEIQDIIKQKTRNPSETPLMFI 622
            W  I   ++                   F ++KC+S   +Q+ IK  T+  SETPLMFI
Sbjct: 557 AWSWIQSNTLGTE----------------FKVKKCSSPSVVQEAIKHGTKYASETPLMFI 600

Query: 623 YCKESFLPNEDDVMKSFESNMACTKFLKEDQLTL 656
           YC+E  +P E+ V ++ +SN  C KF ++DQ +L
Sbjct: 601 YCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSL 634

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 38/47 (80%)

Query: 1  MEDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQA 47
          M D + +++L++MGIP +VA +AL+   GN+EAAVN+IFSNELP QA
Sbjct: 1  MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQA 47

>Smik_15.318 Chr15 complement(545721..547739) [2019 bp, 672 aa] {ON}
           YOR138C (REAL)
          Length = 672

 Score =  323 bits (829), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 187/512 (36%), Positives = 282/512 (55%), Gaps = 52/512 (10%)

Query: 178 KLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWYSISNNN 237
           K  + DPTV+LPL  N L+E+Y  LF   + +  P  +F    F DL +   W+  ++  
Sbjct: 143 KSTMDDPTVVLPLPLNSLIESYFGLFALLVSVYFP-HVFLKPDFQDLNFRPDWFKGTSFT 201

Query: 238 E-------------NTTTD-------------SLFLQLQRVTSIINSRMSERAFISTKMF 271
           E             +TT+D              L  QLQ++ S++N+RM ERAF+S K+F
Sbjct: 202 EPKYRIAYREADDGSTTSDIVLASGPSDELQPHLLWQLQKLISVVNTRMCERAFVSAKLF 261

Query: 272 SFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV-LPPIFKD-----ILVTTAINKDSQTN 325
           + +    L   L+ S+HL E+   FI+SL   + + P  +D     + +++A++  ++  
Sbjct: 262 TLSLEPQLKSKLANSEHLYEVLPAFIKSLAVDLEMCPGIRDQETRNLFISSALHTPNKNE 321

Query: 326 EIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYGRNXXXXXXXXXXXXXXXXXXXXXXX 385
               + +S+ +FLPEEY+SNLYKMFN L+YP E                           
Sbjct: 322 PPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEE-EEEEEVIRRGGTGQEEERYVEPENT 380

Query: 386 XXXISPIFTILFXXXXXXXXXXTTLPEGVEIPLQFYPQLYSKKVNDQLIKHIISKRKEAQ 445
              ++P+ TILF           TLP GV++PL+FYPQLY+K+  DQLI+HIISKRK+A+
Sbjct: 381 LKEVAPVLTILFNELETNTES-VTLPNGVDMPLEFYPQLYTKRCKDQLIRHIISKRKQAR 439

Query: 446 SKSRSLLNEINSLKSFQGKDIMKILQSTIDYI-EKDSQRETKSANNLTNILTEMKNCKNL 504
            +SR LL EI++LKS+QGK+   IL+ST+ Y+ E       ++A+ + ++   + + ++ 
Sbjct: 440 VRSRYLLEEISALKSYQGKNTFTILESTLAYLQESPDDANNEAASQIASLKDTLNSMRSA 499

Query: 505 KMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDLYLIKKANVDW 564
           KM++YK+L  KLH EWNLSHPE  II TAKQL LI++PY L+M   SP  Y I+  N  W
Sbjct: 500 KMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYVLTMAAISPYSYFIRNRNGVW 559

Query: 565 YLIDCRSINQMQXXXXXXXXXXXXPDLFVLRKCNSEIEIQDIIKQKTRNPSETPLMFIYC 624
             I   ++                   F + KC+S   +Q+ I+  T+  SE PLMFIYC
Sbjct: 560 SWIQSNTLGTE----------------FKVNKCSSASVVQEAIRHGTKYASEMPLMFIYC 603

Query: 625 KESFLPNEDDVMKSFESNMACTKFLKEDQLTL 656
           +E  +P E+ V K+ +SN  C+KF K+DQ +L
Sbjct: 604 EEGKIPTEEVVEKALDSNNGCSKFAKDDQSSL 635

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 38/52 (73%)

Query: 1  MEDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPE 52
          M D + +++L++MGIP +VA  AL+   GN+EAAVN+IFSNELP Q S   E
Sbjct: 1  MMDNQAVKSLLEMGIPHEVAVEALQRTGGNLEAAVNFIFSNELPDQGSMSTE 52

>NCAS0H02270 Chr8 complement(445144..447234) [2091 bp, 696 aa] {ON}
           Anc_5.475 YOR138C
          Length = 696

 Score =  318 bits (815), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 193/530 (36%), Positives = 285/530 (53%), Gaps = 76/530 (14%)

Query: 178 KLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWYS----- 232
           K ++  PT++LPL  N ++ENYLSLF  +  +  P Q F    F DL YNK WY      
Sbjct: 176 KDELDQPTIILPLPLNSMIENYLSLFALNAVINIP-QFFLKTDFKDLNYNKNWYKGTSFE 234

Query: 233 -------ISNNNENTTTDS-----------------------------LFLQLQRVTSII 256
                    ++N+ TT +                              L  QLQ++ +I 
Sbjct: 235 MPKFILEFDSSNDTTTINENAERGDQYRKAVDIIPIGTSDKVEKQQPFLLWQLQKLAAIN 294

Query: 257 NSRMSERAFISTKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV-LPPI------F 309
           +  MSERA+ S ++FS  FN  +  +LS+SD+L ++   FI+S+ T + L P        
Sbjct: 295 SFSMSERAYASARIFSLVFNGQVRSVLSKSDNLIDVLPLFIKSITTDLQLCPSNSDDESP 354

Query: 310 KDILVTTAINKDSQTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYGRNXXXXXXX 369
           +D+ +T+A +   ++  +  + ++  +F+PEEY  NLYKMFN L+YP++   N       
Sbjct: 355 QDLFITSAFHLPEKSQSLVETKLAFFHFMPEEYNENLYKMFNVLLYPDDPSENNEDNGEQ 414

Query: 370 XXXXXXXXXXXXXXXXXXXISPIFTILFXXXXXXXXXXTTLPEGVEIPLQFYPQLYSKKV 429
                               + I T++F          T+   GVEIPL FYPQLY KK 
Sbjct: 415 EEVYNNSLNKA---------AHIITVIFNEADAYTPEMTS-NSGVEIPLTFYPQLYFKKC 464

Query: 430 NDQLIKHIISKRKEAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEKDSQRETKSAN 489
            DQLIKHI+ KR++A ++S+ LL+EI  LKSF+GKDI   L+S  +Y++K+     K+ +
Sbjct: 465 KDQLIKHILEKRRQALARSKQLLDEIRQLKSFEGKDISMTLESAKEYLQKEENPMGKNLH 524

Query: 490 -NLTNILTEMKNCKNLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMV 548
             +T I   +   KN KM++YK L+ +LH +WNLSHPE  IIETAK L LID PY L+ V
Sbjct: 525 ETITKIEMMIAEKKNSKMEEYKILSSQLHKDWNLSHPELQIIETAKTLGLIDEPYLLTTV 584

Query: 549 IFSPDLYLIKKANVDWYLIDCRSINQMQXXXXXXXXXXXXPDLFVLRKCNSEIEIQDIIK 608
           I SP LY I+K +  WY + C ++                   F + +  S   +Q+IIK
Sbjct: 585 IISPYLYYIRKKDGIWYSVQCNTLGTD----------------FQVSQLESGAAVQEIIK 628

Query: 609 QKTRNPSETPLMFIYCKESFLPNEDDVMKSFESNMACTKFLKEDQLTLNE 658
            +T  P+ETPLMF++C+ES +P+ED V K+ E N+ C +F K+DQL+L E
Sbjct: 629 AQTSRPNETPLMFLFCRESIIPDEDTVRKAMEENLGCLQFAKQDQLSLEE 678

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 38/54 (70%)

Query: 1  MEDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELP 54
          ME+ E ++TL++MGIP +VA +AL    GN+E AV +IFSNELP    + P +P
Sbjct: 1  MENNETVKTLLEMGIPREVAVDALMRTGGNLEDAVAFIFSNELPQTEQEQPYIP 54

>KAFR0E02540 Chr5 (519567..521546) [1980 bp, 659 aa] {ON} Anc_5.475
           YOR138C
          Length = 659

 Score =  314 bits (804), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 193/523 (36%), Positives = 286/523 (54%), Gaps = 69/523 (13%)

Query: 175 STHKLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWYSIS 234
           S  K  I+DPT++LPL  N L+ENYL+L+  S+     +  F    F DL Y K+WY  S
Sbjct: 163 SERKSDIADPTIVLPLPPNSLIENYLALYALSIANFFAID-FLKPDFKDLNYRKEWYRSS 221

Query: 235 NNNEN----------------------TTTD----SLFLQLQRVTSIINSRMSERAFIST 268
           + +E                       T TD     L  QLQ++ +++NS +SERA++S 
Sbjct: 222 SIDEPFYRVKFNKADETENEIVPAAELTETDHPQPKLLWQLQKLIAVVNSDLSERAYVSA 281

Query: 269 KMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTVLPPI------FKDILVTTAINKDS 322
           K+F+ + N+ L   L  ++HLNE+   FI++L   +           K + +++A  K S
Sbjct: 282 KIFNSSSNQQLQSKLGDAEHLNEVLPYFIKALAVDLESCYGDKSSDIKKLFISSAFYKPS 341

Query: 323 QTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYGRNXXXXXXXXXXXXXXXXXXXX 382
           Q   +  + +S  +FLPEEY++NLYKMFN L+ P+E                        
Sbjct: 342 QNEPLQETYLSFFHFLPEEYDTNLYKMFNVLLIPDE-----------DDEESGESDEDQP 390

Query: 383 XXXXXXISPIFTILFXXXXXXXXXXTTLP---EGVEIPLQFYPQLYSKKVNDQLIKHIIS 439
                 ISP  TI+F           T     +GV+IP +FYPQLY+KK  D+LIKHI+S
Sbjct: 391 DNSLNIISPFLTIVFNEMDESTDDNMTTSASFQGVDIPFEFYPQLYTKKCKDELIKHILS 450

Query: 440 KRKEAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEKDSQRET----KSANNLTNIL 495
           KRKE++SK + +L EIN+LKS+ GKDI+  L STID+++KDS  E+    + A  L ++ 
Sbjct: 451 KRKESKSKLKVILQEINALKSYHGKDILMFLNSTIDFLQKDSNAESTDHLEVAQELNDLR 510

Query: 496 TEMKNCKNLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDLY 555
            ++   K    D+YKEL++KLH+EWNLS+P+  II+TAK L LID+PY L+ V+ SP  Y
Sbjct: 511 AQINGRKAGLKDEYKELSQKLHNEWNLSYPDLHIIQTAKTLGLIDTPYLLTTVVISPYFY 570

Query: 556 LIK-KANVD-WYLIDCRSINQMQXXXXXXXXXXXXPDLFVLRKCNSEIEIQDIIKQKTRN 613
            ++ +  VD W L+    +                 D  +    + E  +   IKQ T+ 
Sbjct: 571 FMRDRKKVDQWCLVQSNGLGT---------------DFHITNFLDKE-NVSTTIKQYTKV 614

Query: 614 PSETPLMFIYCKESFLPNEDDVMKSFESNMACTKFLKEDQLTL 656
           P+E+PLMFIYCKE+++ ++DD+ K  E N  C+ F+K DQL L
Sbjct: 615 PNESPLMFIYCKENYIASQDDIWKLIEENEGCSSFIKADQLHL 657

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 37/52 (71%)

Query: 3  DQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELP 54
          ++  + +L++MGI  +VA +AL+  +GN+EAA+NYIFSN++  ++ Q    P
Sbjct: 4  EESSLNSLLEMGISKNVAIDALQKFDGNLEAAINYIFSNDMSMESIQTHPQP 55

>SAKL0G03564g Chr7 complement(294308..296125) [1818 bp, 605 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 605

 Score =  291 bits (744), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 189/548 (34%), Positives = 284/548 (51%), Gaps = 76/548 (13%)

Query: 149 DMMTSSTRELSTDIRSQSFKPQASYTSTHKL---QISDPTVLLPLSQNCLLENYLSLFLY 205
           ++ T  TRE+   I      P     ST +L    ++DPTV+LPL  N LLENY +LF  
Sbjct: 78  NVTTVETREVENTIPDDVLAPSGIMDSTTQLLKDSLNDPTVVLPLPPNALLENYFALFCL 137

Query: 206 SLCMLCPLQIFETQQFNDLMYNKKWYS------------ISNNN-------ENTTTDSLF 246
           S+ +  P   F    F DL YN+ W+              SNNN       + T  DSL 
Sbjct: 138 SVGISFPHH-FLKPDFQDLNYNRNWFKGYYSKPEYRLQFSSNNNVSIVPKAQLTIQDSLT 196

Query: 247 LQ------LQRVTSIINSRMSERAFISTKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESL 300
           LQ       Q+  +++NS +S+R F+S K+F       +   L   DHL E+   FI+SL
Sbjct: 197 LQPELLWQFQKFIAVLNSSISDRKFVSAKIFHKVLEPLVLDKLGSCDHLFEVLPSFIKSL 256

Query: 301 VTTVLPPIFKD-------ILVTTAINKDSQTNEIFRSPISMINFLPEEYESNLYKMFNNL 353
              V   + K+       + ++TA +K S+  +   + +S+++FLPEEY++NLY+MFN L
Sbjct: 257 ANDVEMCLLKEDARDIRGLFISTAYHKPSKDEKTIETLVSLLHFLPEEYDTNLYRMFNTL 316

Query: 354 VYPNEYGRNXXXXXXXXXXXXXXXXXXXXXXXXXXISPIFTILFXXXXXXXXXXTTLPEG 413
           +YP E                              ++P+ T++F           +L +G
Sbjct: 317 LYPEE-----------------DEDGEEVENSLGNLAPMLTVVFDEMDESTEN-VSLQQG 358

Query: 414 VEIPLQFYPQLYSKKVNDQLIKHIISKRKEAQSKSRSLLNEINSLKSFQGKDIMKILQST 473
           V++PL+FYPQ+Y+K   D LI H+I+KRKEAQS S ++L ++N LKSFQGK I   L ST
Sbjct: 359 VDVPLKFYPQIYTKSSKDSLINHVIAKRKEAQSASHAILQDLNGLKSFQGKHINSFLNST 418

Query: 474 IDYIEKD----SQRETKSA-NNLTNILTEMKNCKNLKMDQYKELTRKLHSEWNLSHPEGS 528
           +D+  KD    + ++T+    +L +I  ++   K  KM++YK ++  +H++WNLSHP+  
Sbjct: 419 VDFAAKDPLFQNDKDTEELLKSLVSIKEQITTKKTNKMEEYKNISHMIHNKWNLSHPDLY 478

Query: 529 IIETAKQLNLIDSPYNLSMVIFSPDLYLIKKANVDWYLIDCRSINQMQXXXXXXXXXXXX 588
           +++ AK++ LID PY L+  I SP  Y I+K +  WY    R I++              
Sbjct: 479 VVDAAKKMGLIDEPYLLTSAILSPYHYYIRKRDGIWY----RVISEANGSDLEASITEPH 534

Query: 589 PDLFVLRKCNSEIEIQDIIKQKTRNPSETPLMFIYCKESFLPNEDDVMKSFESNMACTKF 648
                        E+ + IK  TR+ SETPLMF YCKES + NE+ + KS E N   +KF
Sbjct: 535 -------------EVSESIKLATRHASETPLMFTYCKESKIGNENSIRKSLEDNQGVSKF 581

Query: 649 LKEDQLTL 656
           +K DQ  L
Sbjct: 582 VKMDQTEL 589

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/39 (58%), Positives = 30/39 (76%)

Query: 5  EKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNEL 43
          + IQ L+DMGI  +VA +AL   NG++EA+VNYIFS EL
Sbjct: 6  QSIQPLLDMGISHEVAVDALSRTNGDLEASVNYIFSGEL 44

>NDAI0C01390 Chr3 (290301..292430) [2130 bp, 709 aa] {ON} Anc_5.475
           YOR138C
          Length = 709

 Score =  285 bits (730), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 182/551 (33%), Positives = 271/551 (49%), Gaps = 98/551 (17%)

Query: 178 KLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWY-----S 232
           K +++DPT++LP+  N LLENYL+L + ++ +  P   F    F DL Y   WY     S
Sbjct: 166 KARVTDPTIILPVPMNSLLENYLALIMLAIAINIPTP-FLRPDFKDLNYENDWYKGNSLS 224

Query: 233 ISN-----------NNENTTTDS----------------------LFLQLQRVTSIINSR 259
           I N           ++E  +  S                      L  QLQ++ S++NS 
Sbjct: 225 IPNYGLKIQNDHDADDEGVSEPSDTNILDGEGEKNNQRNDDIQPKLLWQLQKLISVVNST 284

Query: 260 MSERAFISTKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV--LPPIF-------- 309
           +SER++ISTK+FS     D+ Y L+  ++L ++   F +SL T +     IF        
Sbjct: 285 LSERSYISTKVFSLGLTPDVRYTLANYENLADVLPVFYKSLATEMEKCVAIFGSDITEND 344

Query: 310 ----------------------KDILVTTAINKDSQTNEIFRSPISMINFLPEEYESNLY 347
                                 + + V+TA  +D+ T E  ++P++ ++F PEEYESNLY
Sbjct: 345 KVDNADNDNNNGNSEERMRGEMESLFVSTASYEDAATGERLKTPVTTLSFSPEEYESNLY 404

Query: 348 KMFNNLVYPNEYGRNXXXXXXXXXXXXXXXXXXXXXXXXXXISPIFTILFXXXXXXXXXX 407
           KMFN L++P                                I+PIFT++F          
Sbjct: 405 KMFNTLLFPE---------IDNPSKTAVSEGDVPGTGCLDYIAPIFTVVFHAMDSTTDE- 454

Query: 408 TTLPEGVEIPLQFYPQLYSKKVNDQLIKHIISKRKEAQSKSRSLLNEINSLKSFQGKDIM 467
             LP GV++P++FYPQLY+    D L++ +  +RKEA   S+ LL + N L+SFQGKDI 
Sbjct: 455 VDLPGGVDMPMEFYPQLYTSTCRDALVRDVFPRRKEAHRLSKELLQKFNQLRSFQGKDIT 514

Query: 468 KILQSTIDYIEKDSQRETKSANNLTNILTEMKNCKNLKMDQYKELTRKLHSEWNLSHPEG 527
             L+ST+DY+ KD   ETK+   +  + T + N KN  M+ YK L+  L    N+SHPE 
Sbjct: 515 MFLKSTMDYLTKDCGSETKALEEMKILETLINNAKNTIMEDYKALSADLQGPLNVSHPEV 574

Query: 528 SIIETAKQLNLI-DSPYNLSMVIFSPDLYLIKKANVDWYLIDCRSINQMQXXXXXXXXXX 586
           SII+ AK  NLI D PY L+M + SP  Y I+     WYL+    I+             
Sbjct: 575 SIIDQAKASNLIDDEPYLLTMAVISPLAYFIRNRQGKWYLVRFNMISTE----------- 623

Query: 587 XXPDLFVLRKCNSEIEIQDIIKQKTRNPSETPLMFIYCKESFLPNEDDVMKSFESNMACT 646
                F + +C S   +Q  IKQ T + +E PLMFIYC++S + ++  + K  E N  C 
Sbjct: 624 -----FQITECESIRNVQTAIKQCTIHANEEPLMFIYCRKSAILDDLIIQKYLEDNKGCL 678

Query: 647 KFLKEDQLTLN 657
           +F K+DQ+ L+
Sbjct: 679 QFSKDDQIALD 689

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (62%), Gaps = 14/70 (20%)

Query: 1  MEDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQ-------------A 47
          ME  + + +L++MGIP +VA NAL  ANGN+EAAV +IFSNE+PP+              
Sbjct: 1  MESNDSVSSLMEMGIPREVAVNALIRANGNLEAAVAFIFSNEIPPENNETSTVANDNDTG 60

Query: 48 SQMP-ELPPR 56
           Q P +LPPR
Sbjct: 61 QQEPSQLPPR 70

>ZYRO0D11264g Chr4 complement(948942..950585) [1644 bp, 547 aa] {ON}
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 547

 Score =  280 bits (717), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 167/491 (34%), Positives = 268/491 (54%), Gaps = 61/491 (12%)

Query: 175 STHKLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWYSIS 234
           S  K  ++DPTV++PL  + L ENY +LF  S+C   P  +    +  DLMYN KW   S
Sbjct: 110 SPKKSLVTDPTVVIPLPHS-LFENYFALFSLSMCQYLP-HLMAKPELGDLMYNPKWAQGS 167

Query: 235 NNNENTTTDSLFLQLQRVTSIINSRMSERAFISTKMFSFAFNKDLNYLLSQSDHLNEIFN 294
           ++     + S   QLQR+ S++N+  S+R ++S K+F+   +  L   L++++HL+E+  
Sbjct: 168 SD----PSTSFIQQLQRLCSVVNASFSDRCYVSAKLFAAVLDAPLKRKLAEAEHLHEVLP 223

Query: 295 PFIESLVTTV------LPPIFKDILVTTAINKDSQTNEIFRSPISMINFLPEEYESNLYK 348
            FI SL+  +           + + V++A++ +       +S +S++ F+PEEYES+LY 
Sbjct: 224 SFIRSLIHALEECGCYAEDQIRSLFVSSALSSEC------KSLLSVLQFMPEEYESSLYA 277

Query: 349 MFNNLVYPN-EYGRNXXXXXXXXXXXXXXXXXXXXXXXXXXISPIFTILFXXXXXXXXXX 407
           MFN L+YP  E G                            ++P+ TI+F          
Sbjct: 278 MFNALLYPELEEGEESGNSLLD-------------------LAPVLTIVFDEMDADTEVT 318

Query: 408 TTLPEGVEIPLQFYPQLYSKKVNDQLIKHIISKRKEAQSKSRSLLNEINSLKSFQGKDIM 467
           +    GV++PL+FYPQLY+K V D +++ +  +RK AQ +SR +L E+N LKS+QGKD +
Sbjct: 319 SN--RGVDVPLEFYPQLYTKSVKDAIVRPLQQQRKAAQERSRQVLAEMNGLKSYQGKDTL 376

Query: 468 KILQSTIDYIEKDSQRETKSANNLTNILTEMKNCKNLKMDQYKELTRKLHSEWNLSHPEG 527
           K + ST+DY+++D+Q + +  + L ++   + + K  + ++YKEL++KLH EWNLSHP  
Sbjct: 377 KFINSTLDYLQRDNQSK-EIIDKLESLKNSIADHKTQRKNEYKELSQKLHGEWNLSHPT- 434

Query: 528 SIIETAKQLNLIDSPYNLSMVIFSPDLYLIKKANVDWYLIDCRSINQMQXXXXXXXXXXX 587
            +I  A +  LID PY L+MV+ SP  YL +  +  W +I   S                
Sbjct: 435 YLINEAMERGLIDEPYLLAMVVLSPGHYLQRSRSGQWKMIRTDS---------------- 478

Query: 588 XPDLFVLRKCNSEIEIQDIIKQKTRNPSETPLMFIYCKESFLPNEDDVMKSFESNMACTK 647
             ++  +  C +  ++Q  I+Q T  PS+TPLM +Y K S +  +  V KS ESN   T 
Sbjct: 479 --NMIRISDC-APSQVQATIRQHTTFPSKTPLMLLYVKSSHVSVDTIVSKSLESNEGITN 535

Query: 648 FLKEDQLTLNE 658
           FL+ DQ  LN+
Sbjct: 536 FLRIDQEELNK 546

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 37/55 (67%), Gaps = 7/55 (12%)

Query: 8  QTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELP-------PQASQMPELPP 55
          Q+LI+MGI P+VA  AL+  +GN+EAAVNYIFS E+        PQ++ MP   P
Sbjct: 5  QSLIEMGITPEVAQRALQQTHGNLEAAVNYIFSGEVSDDQPVNQPQSAPMPGFAP 59

>TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.475
           YOR138C
          Length = 678

 Score =  261 bits (668), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 176/546 (32%), Positives = 271/546 (49%), Gaps = 67/546 (12%)

Query: 159 STDIRSQSFKPQASYTSTHKLQIS---DPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQI 215
           S D   Q F P      T+K+Q S   DPTVLL L  + LL NY  LF  SL +  P  +
Sbjct: 150 SNDNSQQIFVPPVYSKGTYKVQKSLPDDPTVLLSLEPSKLLSNYFGLFSMSLALFAP-DL 208

Query: 216 FETQQFNDLMYNKKW----------YSIS-----------------------NNNENTTT 242
           F    F +L +N  W          Y +                           E T  
Sbjct: 209 FMGPDFVNLNFNDNWNKGLQIDTPEYEVKYTHNLEPGLEDRIEIVNAINLSEKERELTYQ 268

Query: 243 DSLFLQLQRVTSIINSRMSERAFISTKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVT 302
             +  QLQ+V SI+NS++S RA+IS+ ++S   + +    L ++ HL +I   FI SL+ 
Sbjct: 269 PYILWQLQKVISIMNSQISSRAYISSGIYSLCLDDNTQKKLMETSHLYDILPTFIRSLMN 328

Query: 303 TV--LPPI----FKDILVTTAINKDSQTNEIFRSPISMINFLPEEYESNLYKMFNNLVYP 356
               +P +     K++ V+ A ++     E  +  + + +FLPEEY+SNLYKMFN+L+Y 
Sbjct: 329 DCKHVPDLDQNRMKNMFVSKAFHQIPIHKEPTKVSLFLFHFLPEEYDSNLYKMFNSLLYR 388

Query: 357 NE----YGRNXXXXXXXXXXXXXXXXXXXXXXXXXXISPIFTILFXXXXXXXXXXTTLPE 412
           +     Y R                           IS I T++F          T  P+
Sbjct: 389 SYDEPIYPRTNQNSADSSSSDDEISNEEESSLDE--ISTILTVIFDELDQDTELITQ-PD 445

Query: 413 GVEIPLQFYPQLYSKKVNDQLIKHIISKRKEAQSKSRSLLNEINSLKSFQGKDIMKILQS 472
           GVEIP +FYP+LY+KK  ++LI  I+  R + + K + +LN++NSLKSF+GKDI++ L S
Sbjct: 446 GVEIPFEFYPELYTKKCKEKLINGILHTRYQNKLKMKEVLNDLNSLKSFEGKDILRFLNS 505

Query: 473 TIDYIEKDSQRETKSANNLTNILTEMKNCKNLKMDQYKELTRKLHSEWNLSHPEGSIIET 532
           T++Y+++D  +E    N L+ +  ++   K  KM +YK ++R L +EWN+  PE SIIE 
Sbjct: 506 TLEYLQRDG-KEGPMVNKLSYVKEQLSRAKTEKMLEYKTISRSLQNEWNIDKPELSIIEQ 564

Query: 533 AKQLNLIDSPYNLSMVIFSPDLYLIKKANVDWYLIDCRSINQMQXXXXXXXXXXXXPDLF 592
           A+ L LI  P+ L M + SP LY  +     W+      +                   F
Sbjct: 565 AQDLGLIGDPHLLVMAVLSPYLYFFRDRRNRWFKFQSSIMGTD----------------F 608

Query: 593 VLRKCNSEIEIQDIIKQKTRNPSETPLMFIYCKESFLPNEDDVMKSFESNMACTKFLKED 652
            + K  S+  +QD IK  T++ SETP+MF+YCK+  +PN+  V++ F  N  C+ F + D
Sbjct: 609 EITKYESDKTVQDEIKLNTKSASETPIMFVYCKKDAIPNDSLVLQKFAKNQGCSAFAQAD 668

Query: 653 QLTLNE 658
           +++L +
Sbjct: 669 EMSLKK 674

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 13 MGIPPDVANNALRAANGNVEAAVNYIF 39
          MGI  DVA + L    GN+EAA+N+IF
Sbjct: 1  MGIAKDVATSTLNKVGGNLEAAINHIF 27

>KNAG0B04050 Chr2 (776430..778451) [2022 bp, 673 aa] {ON} Anc_5.475
           YOR138C
          Length = 673

 Score =  242 bits (617), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 152/511 (29%), Positives = 253/511 (49%), Gaps = 74/511 (14%)

Query: 198 NYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWYS----------ISNNN---------- 237
           NYL LF +++    PLQ F  Q F +L Y+ +WY+          +S+            
Sbjct: 176 NYLVLFAFAVATYAPLQ-FVQQDFKNLNYDAEWYAGDAIQQPLCIVSDVGADGGSRQIVP 234

Query: 238 -ENTTTDS-----LFLQLQRVTSIINSRMSERAFISTKMFSFAFNKDLNYLLSQSDHLNE 291
            E  T+D+     +  QLQRV S+ +S++SER+++S K+F+  F+ ++   +  SDHL E
Sbjct: 235 EEEVTSDTPVQPEMLWQLQRVISVCHSKLSERSYVSAKVFTKVFDTEVESCIRDSDHLYE 294

Query: 292 IFNPFIESLVTTV-LPPI------FKDILVTTAINKDSQTNEIFRSPISMINFLPEEYES 344
               FI+S++    + P        K + +++AI    Q  E   + + + +F PEEY +
Sbjct: 295 ALPSFIKSIIRDAEMCPAQHSNTDVKSMFLSSAIQDAEQGAEPEETFLFLFHFPPEEYNA 354

Query: 345 NLYKMFNNLVYPNEYGRNXXXXXXXXXXXXXXXXXXXXXXXXXXISPIFTILFXXXXXXX 404
           NLYKMFN L+YP     +                          ++P+ TI+F       
Sbjct: 355 NLYKMFNALLYP----EDDTIDDNSSDTDSSNDTDVQVEGSLKELAPLLTIIFNEADPGQ 410

Query: 405 XXXTTL------PEGVEIPLQFYPQLYSKKVNDQLIKHIISKRKEAQSKSRSLLNEINSL 458
                       P+GVE+P  FYPQLY+++V +Q++K I+ +RK A+++ R  L  +N L
Sbjct: 411 LSAGAQDTCINSPQGVEVPFSFYPQLYTREVKEQVVKPILRQRKAARAELRQCLARMNQL 470

Query: 459 KSFQGKDIMKILQSTIDYIEKD---SQRETKSANNLTNILTEMKNCK--------NLKMD 507
           KS++GK     L+   + +      S   +++ N +  ++ ++ + K         LK  
Sbjct: 471 KSYEGKGCCAFLEQYAEVLAGRPCVSAVRSRTKNEMKEVIQKVTSIKLQLNEERAKLK-K 529

Query: 508 QYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDLYLIK--KANVDWY 565
           QY +L+ KL +EWN+S+PE  +I  AK+L L+D P+ LSMV+ SP  YL++      DW 
Sbjct: 530 QYVDLSNKLQNEWNISNPERKVIGEAKRLGLLDKPHLLSMVVLSPYFYLMRDSSGGSDWT 589

Query: 566 LIDCRSINQMQXXXXXXXXXXXXPDLFVLRKCNSEIEIQDIIKQKTRNPSETPLMFIYCK 625
           L+   S                  D  + +    E ++Q  I+  T+  ++ PLMFIYC+
Sbjct: 590 LVQSNSYGT---------------DGLITKHVTEE-KVQQYIRDCTKTANDNPLMFIYCR 633

Query: 626 ESFLPNEDDVMKSFESNMACTKFLKEDQLTL 656
           E F  ++++   + E NM C++F K DQL L
Sbjct: 634 EDFFVSQEETWSAIEKNMGCSEFNKADQLYL 664

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/56 (58%), Positives = 43/56 (76%), Gaps = 3/56 (5%)

Query: 2  EDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELP-PR 56
          E+Q+ + +L +MGIP DVA +ALR ANGN+ AAVNYIFSN++P  A +  ELP PR
Sbjct: 3  EEQDAVASLGEMGIPEDVALDALRRANGNLSAAVNYIFSNDMP--AGEHVELPQPR 56

>KLTH0F15004g Chr6 (1228654..1230447) [1794 bp, 597 aa] {ON} weakly
           similar to uniprot|Q12242 Saccharomyces cerevisiae
           YOR138C RUP1
          Length = 597

 Score =  236 bits (602), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 164/534 (30%), Positives = 254/534 (47%), Gaps = 69/534 (12%)

Query: 159 STDIRSQSFKPQASYTSTHKLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFET 218
           +TD +  +  P+       K +  DP V+ P S N L ENY +LF  ++ +  P    E 
Sbjct: 85  ATDQQGVAVSPREQIACQLKNRPEDPLVVRPASGNALFENYFALFCLAVGLGFPHHFLEP 144

Query: 219 QQFNDLMYNKKWY-------------------SISNNNENTTTDSLFLQ------LQRVT 253
             F DL Y + WY                   SI      T+ D+L LQ       Q+  
Sbjct: 145 D-FQDLTYGQDWYKGQFLKPAYRVKFENNDDVSIVPQETLTSQDNLILQPELLWQFQKFL 203

Query: 254 SIINSRMSERAFISTKMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTV-LPPI---F 309
           ++ NS    R +++ +  +      +   L+ SDHL+E    FI+SL   V L P     
Sbjct: 204 AVQNSPQCRRKYVTARYLTKVLEPQVVEKLNNSDHLHEALPSFIKSLANDVELCPGAHSV 263

Query: 310 KDILVTTAINKDSQTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNEYGRNXXXXXXX 369
           K++ ++TA  K     E   + +S+++F+PEEY++N+YKMFN L+YP+            
Sbjct: 264 KELFISTAYYKPVSEPEPIETLVSLLHFMPEEYDTNIYKMFNALLYPD------------ 311

Query: 370 XXXXXXXXXXXXXXXXXXXISPIFTILFXXXXXXXXXXTTLPEGVEIPLQFYPQLYSKKV 429
                              ++P+ TI+F           TLP GV++PL+FYPQLY+++ 
Sbjct: 312 ---SNEDAEMDDIQNSLGNLAPMITIVFDEMDESTEQ-ATLPHGVDVPLEFYPQLYTEEA 367

Query: 430 NDQLIKHIISKRKEAQSKSRSLLNEINSLKSFQGKDIMKILQSTIDYIEKD--SQRETKS 487
            + LIK +     ++Q+++RS+L  +N LKSFQGK I   L S +D+I KD     E   
Sbjct: 368 KNLLIKEVTKLSADSQTQARSILRNLNDLKSFQGKQIHSFLNSALDFITKDMSGVSEQSG 427

Query: 488 ANNLTNILTEMK----NCKNLKMDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPY 543
              L + L E+K    + K  KM QYK ++ +L++E NLSHPE  II+ AK L LID PY
Sbjct: 428 VQELVDSLQEVKQQLGSKKTEKMAQYKAVSHRLNNELNLSHPELGIIQRAKDLGLIDEPY 487

Query: 544 NLSMVIFSPDLYLIKKANVDWYLIDCRSINQMQXXXXXXXXXXXXPDLFVLRKCNSEIEI 603
            L+  + S   Y I++ N  W+ +  RS ++                   + K ++   +
Sbjct: 488 LLTSAVISASNYFIRQNNGQWFHVVGRSNSEHMD----------------VTKTDAST-V 530

Query: 604 QDIIKQKTRNPSETPLMFIYCKESFLPNEDDVMKSFESNMACTKFLKEDQLTLN 657
              I+  TR  SE+PLMF Y K S +  E  V ++   N     F ++DQ  +N
Sbjct: 531 SSAIRFHTRCASESPLMFTYFKPSAIDTEAQVKEAVGHNKGAKLFAEQDQKHIN 584

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/41 (60%), Positives = 30/41 (73%)

Query: 7  IQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQA 47
          IQ+L+DMGI  +VA  AL   NG+VE +VNYIFS ELP Q 
Sbjct: 6  IQSLLDMGITREVAIEALAKTNGDVENSVNYIFSGELPQQG 46

>Kwal_55.21267 s55 (757685..759499) [1815 bp, 604 aa] {ON} YOR138C -
           Hypothetical ORF [contig 130] FULL
          Length = 604

 Score =  236 bits (601), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 155/509 (30%), Positives = 244/509 (47%), Gaps = 68/509 (13%)

Query: 183 DPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWY----------- 231
           DP V+ P S N L ENY +LF  ++ +  P   F    F DL Y   W            
Sbjct: 115 DPLVVKPESSNALFENYFALFCLAVGLGFP-HYFLGPDFKDLNYGPDWARGQFLKPQFRI 173

Query: 232 --------------SISNNNENTTTDSLFLQLQRVTSIINSRMSERAFISTKMFSFAFNK 277
                         ++++ +  T    L  Q Q+  ++ +S  S R  +S +  + A   
Sbjct: 174 KFETNEDVTIVPRETLTSQDNLTLQPELLWQFQKFLAVQHSPSSYRKQVSARYLTKALEP 233

Query: 278 DLNYLLSQSDHLNEIFNPFIESLVTTV-LPP---IFKDILVTTAINKDSQTNEIFRSPIS 333
            +   L+ ++HL+++   FI SL   V L P     K++ ++TA  K +       + +S
Sbjct: 234 QVVEKLNNAEHLHDVLPSFIRSLANDVELCPGSQSIKELFISTAYYKPASEPVPIETLVS 293

Query: 334 MINFLPEEYESNLYKMFNNLVYPNEYGRNXXXXXXXXXXXXXXXXXXXXXXXXXXISPIF 393
           +++F+PEEY+SN+YKMFN L+YPN                               ++ + 
Sbjct: 294 LLHFMPEEYDSNIYKMFNALLYPN--------------DADDDDDVEETQNSLGNLASMI 339

Query: 394 TILFXXXXXXXXXXTTLPEGVEIPLQFYPQLYSKKVNDQLIKHIISKRKEAQSKSRSLLN 453
           TI+F            LP GVE+P++FYPQLY++     LIK +     E Q ++ S+L 
Sbjct: 340 TIVFDEMDESTDD-IRLPHGVEVPMKFYPQLYTEDAKQSLIKDVTKHAGEGQQRAHSILK 398

Query: 454 EINSLKSFQGKDIMKILQSTIDYIEKDSQRETKS------ANNLTNILTEMKNCKNLKMD 507
            +N LKSFQGK I   L ST+D+I +DS   T++       + L +I  ++   K   M 
Sbjct: 399 TLNELKSFQGKHIHSFLNSTLDFIARDSSAVTENPQINDLVDTLQHIKQDLSKKKTDGMA 458

Query: 508 QYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDLYLIKKANVDWYLI 567
           +YK ++ KL+++WNLSHPE  IIE  ++L LID PY L+  + SP  Y I+K +  WY +
Sbjct: 459 EYKAISHKLNNDWNLSHPELGIIEQGEKLGLIDEPYILTTAVISPFNYFIRKRDSQWYHV 518

Query: 568 DCRSINQMQXXXXXXXXXXXXPDLFVLRKCNSEIEIQDIIKQKTRNPSETPLMFIYCKES 627
             +  N                D   + K ++E  + + I+  TR  SETPLMF Y KES
Sbjct: 519 LGKQHN----------------DALNVAKTDAET-VTNTIRLNTRTASETPLMFTYFKES 561

Query: 628 FLPNEDDVMKSFESNMACTKFLKEDQLTL 656
            +   + + ++ E N   T F ++DQ +L
Sbjct: 562 AIDTNETLTEAIEKNTGVTSFAEQDQSSL 590

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 33/49 (67%)

Query: 7  IQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELPP 55
          I++L+DMGI  DVA  AL   NG+VE +VNYIFS ELP Q  +   L P
Sbjct: 6  IKSLLDMGITRDVAIEALSKTNGDVENSVNYIFSGELPQQGPESKPLQP 54

>CAGL0I07205g Chr9 (694434..696245) [1812 bp, 603 aa] {ON} similar
           to uniprot|Q12242 Saccharomyces cerevisiae YOR138c
          Length = 603

 Score =  235 bits (599), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 158/517 (30%), Positives = 263/517 (50%), Gaps = 54/517 (10%)

Query: 170 QASYTSTHKL-------QISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFN 222
           Q+ YTS   L        +  PTV++P         Y +LF   + +  P   F     +
Sbjct: 117 QSQYTSIDDLIPQQFKNTMDYPTVVIPAPAVPNHIYYCALFALFISIHLP-HYFVKADHD 175

Query: 223 D--LMYNKKWYS-ISNNNENTTTDSLFLQLQRVTSIINSR-MSERAFISTKMFSFAFNKD 278
           D  L+++  W++ I    E+     L  QL ++ ++ NS   S RAF+++KMF    + D
Sbjct: 176 DMPLLFSPDWFNDIDREPEDEPLLVLRDQLHKLIAVQNSNDHSARAFVTSKMF----DVD 231

Query: 279 LNYLLSQSD---------HLNEIFNPFIESLVTTVLPPIFKDILVTTAINKDSQTNEIFR 329
           L  ++  ++         HL +I   FI+++    L    K++ +++AI    + +    
Sbjct: 232 LQSVIQSNEPMLTNPNYFHLYQILPSFIKTIAN--LSYTEKNLFISSAIQGGEEASSSKE 289

Query: 330 SPISMINFLPEEYESNLYKMFNNLVYPNEYGRNXXXXXXXXXXXXXXXXXXXXXXXXXXI 389
           S +S+ +FLPEEYESNLYKMFN L+YP++                              +
Sbjct: 290 SLLSLFHFLPEEYESNLYKMFNVLLYPDD------------DHDIGEDEDEVSENSLKEL 337

Query: 390 SPIFTILFXXXXXXXXXXTTLPEGVEIPLQFYPQLYSKKVNDQLIKHIISKRKEAQSKSR 449
           +P+ TI+F            +  GVE+PL+FYPQLY+KK  DQLI H++SKRK+ + + +
Sbjct: 338 APVMTIIFNEAENIDEN-APVTNGVEVPLKFYPQLYTKKCKDQLISHVLSKRKDGRKELK 396

Query: 450 SLLNEINSLKSFQGKDIMKILQSTIDYIEKDSQRETKSANNLTNILTEMKNCKNLKMDQY 509
            +L +I +LKS+QGKDI+  + S++DY+ KD + ++  A  L  +  E+   K  KM+ Y
Sbjct: 397 QILKDIGNLKSYQGKDILSFINSSLDYLTKD-KDDSGIAEELHKLKDELTAKKTEKMNSY 455

Query: 510 KELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDLYLIKKANVDWYLIDC 569
           K+++ K+H+EWN+ +PE  I+ETA +L LID PY L++ + SP  Y ++    +WY +  
Sbjct: 456 KQISEKMHTEWNIQNPELKIVETATKLGLIDEPYFLNLAVVSPFFYFVRNRKDEWYEVRF 515

Query: 570 RSINQMQXXXXXXXXXXXXPDLFVLRKCNSEIEIQDIIKQKTRNPSETPLMFIYCKESFL 629
              N  +             D   + KC+   E+   +K  T  P+ TPLMF+Y K+S++
Sbjct: 516 NPFNTAE-------------DKISVGKCDGPGEVIQHVKNSTTVPNSTPLMFVYSKDSYM 562

Query: 630 PNEDDVMKSFESNMACTKFLKEDQLTLNESNMNSGES 666
            ++ ++ +    N     F K+DQ+ L       GE 
Sbjct: 563 ADDTEMQELLSQNKTLLDFFKQDQIYLQNFENARGEG 599

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (76%)

Query: 1  MEDQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIF 39
          M+ +  +Q+L++MGI  DVA  ALR  NG+VEAA+NYIF
Sbjct: 1  MDFEGNVQSLLEMGIARDVAEQALRECNGDVEAALNYIF 39

>KLLA0E03169g Chr5 complement(292918..294552) [1635 bp, 544 aa] {ON}
           weakly similar to uniprot|Q12242 Saccharomyces
           cerevisiae YOR138C RUP1
          Length = 544

 Score =  174 bits (440), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 138/514 (26%), Positives = 242/514 (47%), Gaps = 68/514 (13%)

Query: 183 DPTVL---LPLSQNCLLENYLSLFLYSLCMLCPLQIFETQQFNDLMYNKKWYS------- 232
           DP+ L   LP   + LLE+Y  LF   + +  P + F    F +L+YN  W+        
Sbjct: 50  DPSQLVGILPKGSSALLESYFPLFALCMAVNVPTK-FLNVDFKELVYNPHWFKGELVQSD 108

Query: 233 -----------ISNNNENTTTDSLFLQ------LQRVTSIINSRMSERAFISTKMFSFAF 275
                      + +  E T ++ L +Q      +Q +  I N   S R F+++++ +   
Sbjct: 109 YRLVHRNAGPLLIHKRELTGSEYLEMQPELIPRMQLLIGIANDPESMRRFVASELINKGT 168

Query: 276 NKDLNYLLSQSDHLNEIFNPFIESLVTTVLPPIFKD------ILVTTAINKDSQTNEIFR 329
           + +++  LS+ DHL+E+F  FI++L    +    KD      + ++ A+++ +       
Sbjct: 169 DFNVSRALSECDHLSEVFPQFIKNLHND-MDLCLKDDKSTSKLFLSKALHRPNVLEPFQP 227

Query: 330 SPISMINFLPEEYESNLYKMFNNLVYPNEYGRNXXXXXXXXXXXXXXXXXXXXXXXXXXI 389
           + +S++NF PE Y   LY+MFN ++ P + GR                           +
Sbjct: 228 TSLSVLNFSPENYAYTLYEMFNPMLLPEDSGRGYEIENAFDF-----------------L 270

Query: 390 SPIFTILFXXXXXXXXXXTTLPEGVEIPLQFYPQLYSKKVNDQLIKHIISKRKEAQSKSR 449
           +P+FTI+F            L  GV+IP++FYPQLY+K   ++++  ++ +    ++ ++
Sbjct: 271 APVFTIIFDDMDDTTEE-VNLSHGVQIPIEFYPQLYTKNALEKVVVPVLEETDALRNTNK 329

Query: 450 SLLNEINSLKSFQGKDIMKILQSTIDYIEK----DSQRETKSANNLTNILTEMKNCKNLK 505
             +++++SL+SFQGK I   L S+I+Y+E+    D  +  +  + L  I  ++ N K   
Sbjct: 330 LKVDQMSSLQSFQGKQISSFLNSSINYLEEIPLGDEDKSKELVDTLEKIKYQLSNKKREM 389

Query: 506 MDQYKELTRKLHSEWNLSHPEGSIIETAKQLNLIDSPYNLSMVIFSPDLYLIKKANVDWY 565
           M  Y E  R++    +   P   II+ AKQ+ +ID PY L +V+FSP+ Y+I +      
Sbjct: 390 MADYTETQRQI-DLLSFEGPSEKIIDLAKQVGIIDEPYLLRLVVFSPNDYIIARG----- 443

Query: 566 LIDCRSIN-QMQXXXXXXXXXXXXPDLFVLRKCNSEI---EIQDIIKQKTRNPSETPLMF 621
            I     N  M+             +         E+   E QDI K  TR+ SETP++F
Sbjct: 444 -ISADDGNTGMETGNNNLQYIRNIIEFGSSSLTQEELTAQETQDITKSHTRHASETPILF 502

Query: 622 IYCKESFLPNEDDVMKSFESNMACTKFLKEDQLT 655
           +Y K+  +    D++ S   N   T FLKE+  T
Sbjct: 503 VYIKKDHIDAPQDILASISENETLTNFLKEEHTT 536

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
           YBR058C (UBP14) - Ubiquitin-specific protease [contig
           183] FULL
          Length = 762

 Score = 38.1 bits (87), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 26/37 (70%)

Query: 5   EKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSN 41
           + +++++ MG+ PD+ + AL    GNV A+V ++F+N
Sbjct: 632 QALESMVSMGLNPDLCHKALVLHKGNVSASVEWVFNN 668

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 35.8 bits (81), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 5/52 (9%)

Query: 3   DQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSN-----ELPPQASQ 49
           DQE I ++  MG+   +   AL   NG+V ++V+++F+N     ELP + +Q
Sbjct: 649 DQEAISSMTAMGLDAKLCKKALILNNGDVTSSVDWVFNNMDDDGELPQKDTQ 700

>AGL111W Chr7 (498099..499514) [1416 bp, 471 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR195W (REF2)
          Length = 471

 Score = 35.4 bits (80), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 49/111 (44%), Gaps = 10/111 (9%)

Query: 258 SRMSERA---FISTKMFSFAFNKDL--NYLLSQSDHLNEIFNPFIESLVTTVLPPIFKD- 311
           S+  +RA   F+        F  DL  + +++  D L +I NP++E      L   +K+ 
Sbjct: 295 SKAKKRAVIRFVDDSKLVTVFGDDLPESGVVTSPDRLKKILNPYVEGEPREFLLAAWKNQ 354

Query: 312 ----ILVTTAINKDSQTNEIFRSPISMINFLPEEYESNLYKMFNNLVYPNE 358
               +++   + +DS   E    P+SM   +P  +  N  K  + L  P++
Sbjct: 355 KVHKLIIDMGVIEDSDITESKNGPVSMSTKVPLAFRINFSKFSDELAGPHK 405

>Skud_5.280 Chr5 (446952..448238) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 4   QEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIF 39
           ++ I+ L+D+G P D    AL+  NGN E A + +F
Sbjct: 392 EQTIKQLMDLGFPRDAVVTALKQTNGNAEFAASLLF 427

>YER143W Chr5 (456319..457605) [1287 bp, 428 aa] {ON}  DDI1DNA
           damage-inducible v-SNARE binding protein with a role in
           suppression of protein secretion; may play a role in
           S-phase checkpoint control; has ubiquitin-associated
           (UBA), ubiquitin-like (UBL), and retroviral-like
           proteinase (RVP) domains
          Length = 428

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 22/36 (61%)

Query: 4   QEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIF 39
           ++ I+ L+D+G P D    AL+  NGN E A + +F
Sbjct: 392 EQTIKQLMDLGFPRDAVVKALKQTNGNAEFAASLLF 427

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 25/39 (64%)

Query: 3   DQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSN 41
           DQ  +QT++ MG+   ++  AL   +G+V A+  ++F+N
Sbjct: 677 DQSSLQTMLAMGLDAKLSRKALTIYSGDVAASTEWVFNN 715

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 3   DQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSN-----ELPPQASQ 49
           D++ + +++ MG+ P +   AL   NG+V  +V ++F+N     ELP    Q
Sbjct: 651 DEDSLASMLSMGLSPKLCRKALIINNGDVNRSVEWVFNNMDDNGELPDPEGQ 702

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 5/51 (9%)

Query: 3   DQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSN-----ELPPQAS 48
           DQE +  +IDMG+   ++  AL    G++ A++ ++F+N     ELP + +
Sbjct: 666 DQESLSNMIDMGLNEKLSIKALVLNKGDINASIEWVFNNPDDNGELPSETT 716

>ZYRO0D04048g Chr4 (330261..332090) [1830 bp, 609 aa] {ON} similar
           to uniprot|Q02866 Saccharomyces cerevisiae YPL070W MUK1
           Protein of unknown function localized to the cytoplasm
           computational analysis of large-scale protein- protein
           interaction data suggests a possible role in
           transcriptional regulation
          Length = 609

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 5/76 (6%)

Query: 154 STRELSTDIRSQSFKPQASYTSTHKLQISDPTVLLPLSQNCLLENYLSLFLYSLCMLCPL 213
             +EL T++ S +  P        K+  S     +  SQ    +++LS+ +Y +  +CP 
Sbjct: 346 GAKELLTNLVSHTIAPCEKIAVILKIHES-----MMFSQEMCNDDFLSMLVYYIIKVCPK 400

Query: 214 QIFETQQFNDLMYNKK 229
            IF   QF  L  NKK
Sbjct: 401 NIFLNAQFIKLFRNKK 416

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 34/54 (62%), Gaps = 7/54 (12%)

Query: 3   DQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSN-----ELPPQ--ASQ 49
           ++E + ++I MG+  +++  AL   NG++ A++ ++F+N     ELP +  ASQ
Sbjct: 641 NEESLNSMISMGLAQNLSRKALILNNGDINASIEWVFNNMDDNGELPEENTASQ 694

>Smik_5.308 Chr5 (461464..462750) [1287 bp, 428 aa] {ON} YER143W
           (REAL)
          Length = 428

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 4   QEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIF 39
           ++ I+ L+D+G P D    AL+   GN E A + +F
Sbjct: 392 EQTIKQLMDLGFPRDTVVKALKQTGGNAEFAASLLF 427

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 25/39 (64%)

Query: 3   DQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSN 41
           D+  + +++ MG+ P++   AL   NG+V  +V +IF+N
Sbjct: 651 DETSLTSILSMGLNPNLCRKALILNNGDVNRSVEWIFNN 689

>SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 765

 Score = 32.3 bits (72), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 11/37 (29%), Positives = 23/37 (62%)

Query: 5   EKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSN 41
           E ++ ++ MG+ P +   AL   NG++  +V ++F+N
Sbjct: 635 ESLENMVSMGLDPKLCCKALLLNNGDINTSVEWVFNN 671

>Skud_5.310 Chr5 (512188..514515) [2328 bp, 775 aa] {ON} YER171W
           (REAL)
          Length = 775

 Score = 32.3 bits (72), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 482 QRETKSANNLTNILTEMKNCKNLKM-DQYKELTRKLHSEWNLSHPEGSIIET 532
           +R T+ AN L   +TE++   + K+ D+Y++L + LHS   L+  E   +ET
Sbjct: 258 RRATRGANALDERITEVRKVDSQKLQDEYEKLVQGLHSADILTDQEEPFVET 309

>KLLA0F27269g Chr6 (2520782..2524432) [3651 bp, 1216 aa] {ON}
           similar to uniprot|Q7LH12 Saccharomyces cerevisiae
           YPL012W RRP12 Protein required for normal pre-rRNA
           Processing member of a group of seven genes whose
           expression is repressed during growth on glucose before
           and during the diauxic shift
          Length = 1216

 Score = 32.0 bits (71), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 61/128 (47%), Gaps = 15/128 (11%)

Query: 238 ENTTTDSLFLQLQRVTSIINSRMSERAFISTK---MFSFAFNKDLNYLLSQSDHLNEIFN 294
           +N+TTDSL LQ   + S  NS      ++STK   M +  FN       +   ++ E  +
Sbjct: 618 KNSTTDSLLLQHFSIESATNS----LEYLSTKSSNMLAVLFNVYTQTAPNARGYILETID 673

Query: 295 PFIESLVTTVLPPIFKDI--LVTTAINKDSQTN------EIFRSPISMINFLPEEYESNL 346
            +++      L   F ++  L+ TA+ ++++ N       +    I+M+ ++P      L
Sbjct: 674 SYLQITKKEDLAQTFNNVCGLLNTALQEEAKKNNNEMSATLLDLVIAMVKYVPPSSYGAL 733

Query: 347 YKMFNNLV 354
           + +FN++V
Sbjct: 734 FAIFNSIV 741

>YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}
           UBP14Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains; involved in
           fructose-1,6-bisphosphatase (Fbp1p) degradation; similar
           to human isopeptidase T
          Length = 781

 Score = 32.0 bits (71), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 29/52 (55%)

Query: 3   DQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELP 54
           D+  + +++ MG+ P++   AL   NG+V  +V ++F+N         PE+P
Sbjct: 651 DEVSLTSMLSMGLNPNLCRKALILNNGDVNRSVEWVFNNMDDDGTFPEPEVP 702

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score = 32.0 bits (71), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 44/104 (42%), Gaps = 8/104 (7%)

Query: 214 QIFETQQ---FNDLMYN--KKWYSISNNNENTTTDSLFLQLQRVTSIINSRMSERAFIST 268
           QIF  Q    F  + YN  K+ +    N  + ++ +   QL++   I+N+  S      T
Sbjct: 226 QIFHKQTQSFFKSIFYNTLKRPFGYLTNQTSISSPASATQLKKYNDILNAHSS---LCGT 282

Query: 269 KMFSFAFNKDLNYLLSQSDHLNEIFNPFIESLVTTVLPPIFKDI 312
            +F    N+  NYL S  +  +     FI  +    L P+ KD 
Sbjct: 283 TVFGIVSNQRFNYLKSIVNQEHICLRSFICGIAMICLKPLVKDF 326

>KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly
           similar to uniprot|P38237 YBR058C Saccharomyces
           cerevisiae UBP14 Ubiquitin-specific protease that
           specifically disassembles unanchored ubiquitin chains
          Length = 762

 Score = 32.0 bits (71), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 23/37 (62%)

Query: 5   EKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSN 41
           + ++ +  MG+ P++   AL    GNV A+V ++F+N
Sbjct: 632 QALENMAAMGLNPELCRKALIINQGNVSASVEWVFNN 668

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%)

Query: 3   DQEKIQTLIDMGIPPDVANNALRAANGNVEAAVNYIFSNELPPQASQMPELP 54
           D+  + ++  MG+ P++   AL   NG+V  +V ++F+N         PE+P
Sbjct: 651 DEASLASMQSMGLNPNLCRKALIINNGDVSRSVEWVFNNMDDDGKLSEPEVP 702

>Suva_7.277 Chr7 complement(481312..482109) [798 bp, 265 aa] {ON}
           YGL005C (REAL)
          Length = 265

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 5/52 (9%)

Query: 305 LPPIFKDILVTTAINKDS-QTNEIFRSPISMINFLPEEYESNLYKMFNNLVY 355
           +P  F DIL+T A+N+D  QT  I  S ++ ++F    Y  NL K   N ++
Sbjct: 8   VPHAFVDILLTNALNEDEIQTQSISSSLLTRLDF----YTKNLTKELENTIW 55

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 80,161,161
Number of extensions: 3594368
Number of successful extensions: 20840
Number of sequences better than 10.0: 417
Number of HSP's gapped: 21193
Number of HSP's successfully gapped: 510
Length of query: 790
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 672
Effective length of database: 39,950,811
Effective search space: 26846944992
Effective search space used: 26846944992
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)