Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B016003.160ON48648621970.0
Skud_4.2213.160ON5313432344e-20
Suva_4.2193.160ON5313432274e-19
NDAI0G028903.160ON5363582256e-19
TDEL0D046203.160ON5163492193e-18
KNAG0K011203.160ON5273412176e-18
ZYRO0B04950g3.160ON5063162176e-18
Ecym_35493.160ON5323762132e-17
Smik_4.2053.160ON5313262114e-17
Kpol_479.263.160ON5173692104e-17
KAFR0C010503.160ON5063402096e-17
KLTH0C08888g3.160ON5063362062e-16
NCAS0C035403.160ON5183551991e-15
TPHA0A009103.160ON5271851945e-15
SAKL0C08800g3.160ON6013521937e-15
YDL030W (PRP9)3.160ON5303231911e-14
Kwal_56.227993.160ON5313511865e-14
CAGL0K01573g3.160ON5163261411e-08
KLLA0F24662g3.160ON530531402e-08
AEL085W3.160ON5273101322e-07
ADL222W2.279ON51639761.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B01600
         (486 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.1...   850   0.0  
Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W ...    95   4e-20
Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W ...    92   4e-19
NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.1...    91   6e-19
TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {O...    89   3e-18
KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3....    88   6e-18
ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {...    88   6e-18
Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {O...    87   2e-17
Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W ...    86   4e-17
Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}...    86   4e-17
KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {O...    85   6e-17
KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} simila...    84   2e-16
NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.1...    81   1e-15
TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.1...    79   5e-15
SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} simila...    79   7e-15
YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subuni...    78   1e-14
Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {...    76   5e-14
CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} simil...    59   1e-08
KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]...    59   2e-08
AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic ho...    55   2e-07
ADL222W Chr4 (314279..315829) [1551 bp, 516 aa] {ON} Syntenic ho...    34   1.0  

>TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.160
           YDL030W
          Length = 486

 Score =  850 bits (2197), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/486 (86%), Positives = 420/486 (86%)

Query: 1   MSNSVDGRDPVALLLAMHEQVVQMSRTRHEISCEIKDVPGVIRGDRGDRMSNNKLVAIER 60
           MSNSVDGRDPVALLLAMHEQVVQMSRTRHEISCEIKDVPGVIRGDRGDRMSNNKLVAIER
Sbjct: 1   MSNSVDGRDPVALLLAMHEQVVQMSRTRHEISCEIKDVPGVIRGDRGDRMSNNKLVAIER 60

Query: 61  FRIGKQIEQHEKYRRCYEQLQRVPRNSVEEVSVASLFATRIKEIAPLPIPSIDINSVYRD 120
           FRIGKQIEQHEKYRRCYEQLQRVPRNSVEEVSVASLFATRIKEIAPLPIPSIDINSVYRD
Sbjct: 61  FRIGKQIEQHEKYRRCYEQLQRVPRNSVEEVSVASLFATRIKEIAPLPIPSIDINSVYRD 120

Query: 121 PEEEYGTSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQVTKQFLHDRWIDETAFPPSL 180
           PEEEYGTSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQVTKQFLHDRWIDETAFPPSL
Sbjct: 121 PEEEYGTSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQVTKQFLHDRWIDETAFPPSL 180

Query: 181 IAGMLEYLTGFQERVDIVKPQDSSAAITRRLRRHIALXXXXXXXXXXXXXXXXPWPLTCI 240
           IAGMLEYLTGFQERVDIVKPQDSSAAITRRLRRHIAL                PWPLTCI
Sbjct: 181 IAGMLEYLTGFQERVDIVKPQDSSAAITRRLRRHIALSSSSCSSSSSSASSPSPWPLTCI 240

Query: 241 VCGPKKFATEQVFHHHLNSNRHLKREASRLPIMIPIQSVREKLQTLAAELASGAARVERQ 300
           VCGPKKFATEQVFHHHLNSNRHLKREASRLPIMIPIQSVREKLQTLAAELASGAARVERQ
Sbjct: 241 VCGPKKFATEQVFHHHLNSNRHLKREASRLPIMIPIQSVREKLQTLAAELASGAARVERQ 300

Query: 301 LNMTPQERFAEHAAQQRIRTAVQGRGGGDXXXXXXXXXXXXXXXXXXXXXXXVEVDGRHV 360
           LNMTPQERFAEHAAQQRIRTAVQGRGGGD                       VEVDGRHV
Sbjct: 301 LNMTPQERFAEHAAQQRIRTAVQGRGGGDTTATPSATPSATPAATTPASASTVEVDGRHV 360

Query: 361 PRWLYRLQGLSSIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQFRGLG 420
           PRWLYRLQGLSSIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQFRGLG
Sbjct: 361 PRWLYRLQGLSSIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQFRGLG 420

Query: 421 KLDAVXXXXXXXXXXXXXQEPSRSTVGRXXXXXXXXXXXXXXDTALGNDTGLSQEWAALL 480
           KLDAV             QEPSRSTVGR              DTALGNDTGLSQEWAALL
Sbjct: 421 KLDAVLELRGEKLGRLEEQEPSRSTVGRAKAVGKAGGKAVGKDTALGNDTGLSQEWAALL 480

Query: 481 ERQGLA 486
           ERQGLA
Sbjct: 481 ERQGLA 486

>Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score = 94.7 bits (234), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 88/343 (25%), Positives = 138/343 (40%), Gaps = 63/343 (18%)

Query: 111 SIDINSVY-RDPEEEYGTSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQV-----TKQ 164
            +D+N ++ RD  E+YG  + LD+F+ LW+  + +     S  +L++F+  +      K+
Sbjct: 163 DLDLNKIFTRD--EQYGEYMELDQFHYLWLNVIRR-----SDCSLLQFFNILELFVDDKK 215

Query: 165 FL--------HDRWIDETAFPPSLIAGMLEYLTGF---------QERVDIVKPQDSSAAI 207
           FL        +DR++D        +  + +YL  F         +E V+     D   + 
Sbjct: 216 FLLTPPMDRKNDRYMD-------FLMRLSKYLETFFFKSYVLFDKEMVENSIESDFENSY 268

Query: 208 TRRLRRHIALXXXXXXXXXXXXXXXXPWPLTCIVCGPKKFATEQVFHHHLNSNRHLKREA 267
            + L R  A                    + C  C  K F T  VF +HL+   H K EA
Sbjct: 269 CKGLVRSEAKG------------------IYCPFCS-KWFKTFPVFENHLSGKNHKKNEA 309

Query: 268 SRLPIMIPIQSVREKLQTLAAELASGAARVERQLNMTPQERFAEHAAQQRIRTA-----V 322
            R   +     +   L+ L  E     + +ER+L  T  ER AE  +      A      
Sbjct: 310 KRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLTEKYEAPAYDHT 369

Query: 323 QGRGGGDXXXXXXXXXXXXXXXXXXXXXXXVEVDGRHVPRWLYRLQGLSSIFTCELCDGR 382
           +G G G                        +  DG  +P WLY+L GL   + CE+C  R
Sbjct: 370 EGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLHGLDREYPCEICANR 429

Query: 383 EFHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQFRGLGKLDAV 425
            ++GR  +ERHF    H   L CLG+  E    F+G+ K+  V
Sbjct: 430 VYNGRRTFERHFNEEAHLYHLRCLGI--EPSPAFKGITKIAEV 470

>Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score = 92.0 bits (227), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 86/343 (25%), Positives = 141/343 (41%), Gaps = 69/343 (20%)

Query: 111 SIDINSVY-RDPEEEYGTSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQVTKQFLHDR 169
            ID+N ++ RD  E+YG  + L++F++LW+  + +   S     L++F+  V      + 
Sbjct: 163 DIDLNRLFTRD--EQYGEYMELEQFHSLWLNVIKRGDCS-----LLQFFDTV------EL 209

Query: 170 WIDETAF---PP---------SLIAGMLEYLTGF---------QERVDIVKPQDSSAAIT 208
           ++D+  +   PP         S +  + EY+  F         +E V+ +   D   +  
Sbjct: 210 FVDDKKYLLAPPMDRKNDRYMSFLMKLSEYVESFFYKSYALFEKEVVEGLIKSDFDNSYC 269

Query: 209 RRLRRHIALXXXXXXXXXXXXXXXXPWPLTCIVCGPKKFATEQVFHHHLNSNRHLKREAS 268
           R + +                       + C +C  K F T+ VF +H+    H K EA 
Sbjct: 270 RGILK------------------SESKGIYCPLCY-KWFKTQAVFENHIPGKNHKKNEAK 310

Query: 269 RLPIMIPIQSVREKLQTLAAELASGAARVERQLNMTPQERFAEHAAQQRIRTAV------ 322
           R  I+     +   L+ L  EL    + VER+L  T  ER  E  +  +   A       
Sbjct: 311 RKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQKYEAPAYDATE 370

Query: 323 ---QGRGGGDXXXXXXXXXXXXXXXXXXXXXXXVEVDGRHVPRWLYRLQGLSSIFTCELC 379
               G+GGG+                       +  DG  +P WLY+L GL   + CE+C
Sbjct: 371 REDDGKGGGEQKDDKLQEKHLFGKSFDMP----LGPDGLPMPYWLYKLHGLDREYPCEIC 426

Query: 380 DGREFHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQFRGLGKL 422
             R ++GR  +ERHF    H   L CLG+  E    F+G+ K+
Sbjct: 427 ANRIYNGRRTFERHFNEETHLYHLRCLGI--EPSSVFKGITKI 467

>NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.160
           YDL030W
          Length = 536

 Score = 91.3 bits (225), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 90/358 (25%), Positives = 141/358 (39%), Gaps = 46/358 (12%)

Query: 89  EEVSVASLFATRIKEIAPLPIPS-----IDINSVYRDPEEEYGTSISLDRFYNLWIGHLT 143
           ++++  S+F+  + +  P  I S     +DINS++   EE+YG  ++L+ +Y  W+  + 
Sbjct: 148 DKINKYSMFSNSLNKSHPSTILSSRASDLDINSIF-SLEEQYGEYLALNPYYTEWLNVVK 206

Query: 144 KRKTSESPPTLVEFYGQVTKQFLHD-RWIDETAFPP---------SLIAGMLEYLTGFQE 193
           K        T ++F   + K F  D R+I +   PP           +     YL  F E
Sbjct: 207 KEDL-----TFLQFLNML-KIFQDDKRYIVQ---PPMDRKNEPYMKYLQRYCSYLESFFE 257

Query: 194 RVDIVKPQDSSAAITRRLRRHIALXXXXXXXXXXXXXXXXPWPLTCIVCGPKKFATEQVF 253
           R     P   S   +R L++                         C  C  K F T  VF
Sbjct: 258 RK---YPLIDSRYTSRELKKEFNKSIIKPLENEKKG-------FFCKTCC-KWFKTLTVF 306

Query: 254 HHHLNSNRHLKREASRLPIMIPIQSVREKLQTLAAELASGAARVERQLNMTPQERFAEHA 313
             HLN  +H+K    R+  +            L  E  S    VER++  T +ER  E  
Sbjct: 307 ESHLNGQKHIKSYNKRVQGLYAEYKTHRYSMLLKEEHQSTCEFVERKMAFTVEERITEMK 366

Query: 314 AQQRIRTA----VQGRGGGDXXXXXXXXXXXXXXXXXXXXXXXVEV----DGRHVPRWLY 365
               I  A    V  + G +                       + +    DG  +P WLY
Sbjct: 367 RLAEICKAPAYDVNEKEGDENNTELNVKDNLKNDGASAMLSGSINMPLGPDGLPMPFWLY 426

Query: 366 RLQGLSSIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQFRGLGKLD 423
           +LQGL   + CE+C  + F GR  +++HFT   H   L CLG+  E    F+G+ K++
Sbjct: 427 KLQGLDVSYPCEICSNQIFKGRRTFDKHFTEATHIYHLRCLGI--EPTPAFKGVTKIE 482

>TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {ON}
           Anc_3.160 YDL030W
          Length = 516

 Score = 89.0 bits (219), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 84/349 (24%), Positives = 141/349 (40%), Gaps = 42/349 (12%)

Query: 89  EEVSVASLFATRIKEIAPLPIPS-----IDINSVYRDPEEEYGTSISLDRFYNLWIGHLT 143
           EE+S  ++F+    +  P+ I S     + +N V+   EE+YG  + LDRF++ W+  + 
Sbjct: 141 EEISKHAMFSALTTDSKPVTILSRSAKNLRLNDVF-SREEQYGEYLDLDRFHSSWLNVI- 198

Query: 144 KRKTSESPPTLVEFYGQVTKQFLHDRWIDETAFPP---------SLIAGMLEYLTGFQER 194
             +++E   TL++FY  + ++FL DR       PP           +  +  YL  F ++
Sbjct: 199 --RSTEC--TLLQFYS-ILEKFLDDRQY--ILAPPMDRKNGRYAEFLVEISNYLEKFFQK 251

Query: 195 VDIVKPQDSSAAITRRLRRHIALXXXXXXXXXXXXXXXXPWPLTCIVCGPKKFATEQVFH 254
            +++    +   + RR++   +                      CI C  K F    VF 
Sbjct: 252 ANVLL---NHTKLERRIQSEFSRSLATPLHTGGKG-------FYCIACC-KWFKVPTVFD 300

Query: 255 HHLNSNRHLKREASRLPIMIPIQSVREKLQTLAAELASGAARVERQLNMTPQERFAEHAA 314
            HL    H    + R   +     +   L  L+ E        ER++  T +ER  E A 
Sbjct: 301 SHLTGKHHKNNLSKRSKHLQAEYKLHRYLTLLSEEFRRTREFTERKVAFTAEERMQEMAR 360

Query: 315 QQRIRTAVQGRGGGDXXXXXXXXXXXXXXXXXXXXXXXVEV----DGRHVPRWLYRLQGL 370
                 A     G D                        ++    DG  +P WLY+LQGL
Sbjct: 361 LNHDYHAPDY--GPDEKEQEDPDSNKAELDKNSALGGSFDLPLGADGLPIPYWLYKLQGL 418

Query: 371 SSIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQFRGL 419
              ++CE+C  + + GR  +E+HF    H   L CLG+  E  + F+G+
Sbjct: 419 DVEYSCEICTNQTYKGRRAFEKHFLEPTHTFHLKCLGI--EPSITFKGI 465

>KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score = 88.2 bits (217), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 85/341 (24%), Positives = 143/341 (41%), Gaps = 45/341 (13%)

Query: 95  SLFATRIKEIAPLPIPS-----IDINSVYRDPEEEYGTSISLDRFYNLWIGHLTKRKTSE 149
           ++F++ I E  P  I S     +DIN+++ + EE+YGT I L+ ++ +W+  +      E
Sbjct: 140 AMFSSSI-EKPPTNILSARALELDINAIF-NREEQYGTYIQLENYHPMWLELM-----KE 192

Query: 150 SPPTLVEFYGQVTKQFLHDRWIDETAF--PPSLIAGMLEYLTGFQERVDIVKPQDSSAAI 207
              T++++   + + FL+    D+T++   P +     +YL  F ER+ +         I
Sbjct: 193 PSVTVLQYLESLERMFLNAD--DKTSYLTSPPIDRDNKQYLR-FLERLGLY----LKTYI 245

Query: 208 TRR---LRRHIA---LXXXXXXXXXXXXXXXXPWPLTCIVCGPKKFATEQVFHHHLNSNR 261
            ++   + +H+    L                     C VC  K++   Q+F+ HL +  
Sbjct: 246 AKKFPLIDQHLVEDYLLDHFKNRYVNKPVSTDQNTQFCPVCD-KRYEGMQLFNDHLLNKF 304

Query: 262 HLKREASRLPIMIPIQSVREKLQTLAAELASGAARVERQLNMTPQERFAEHAAQQRIRTA 321
           H ++   RLP++     V   L  L+ E       +ER+L  T  ER  E    QR+ T 
Sbjct: 305 HAQQRGKRLPLLQAEFRVSVYLTALSKEFKDSKNFMERKLAFTYAERQEE---LQRLTTE 361

Query: 322 VQG--------------RGGGDXXXXXXXXXXXXXXXXXXXXXXXVEVDGRHVPRWLYRL 367
            +                   +                       +  DG  +P WLY+L
Sbjct: 362 YEAPNYNPALEHEDNPAETDKNKNGKTHSENKQTAELESMFTNMPLGPDGMPIPLWLYKL 421

Query: 368 QGLSSIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGV 408
           QGL   +TCE+C   EF GR  Y++HF    H  RL CLG+
Sbjct: 422 QGLDVKYTCEICGNAEFKGRRAYQKHFHEPLHEYRLKCLGI 462

>ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {ON}
           similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 506

 Score = 88.2 bits (217), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 74/316 (23%), Positives = 128/316 (40%), Gaps = 44/316 (13%)

Query: 112 IDINSVY-RDPEEEYGTSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQVTKQFLHDRW 170
           +D+N ++ RD  E+YG  + L++F++ W+  + +   S      ++F+  + K      +
Sbjct: 163 LDLNQIFTRD--EQYGDLLDLEKFHSQWLNVIKRADCS-----YLQFFDVLQK------F 209

Query: 171 IDETAF---PP---------SLIAGMLEYLTGFQERVDIVKPQDSSAAITRRLRRHIALX 218
           +D + +   PP           +  + +Y+  F  +V ++    +S  +++R+       
Sbjct: 210 LDPSEYLLSPPMDRKNERYGQFLIELFQYVEQFFAKVYVLV---NSTILSQRMESDFE-- 264

Query: 219 XXXXXXXXXXXXXXXPWPLTCIVCGPKKFATEQVFHHHLNSNRHLKREASRLPIMIPIQS 278
                             L C+ CG K F T  VF  HL    H      R   +     
Sbjct: 265 -----EYLRMPIYKSNHGLYCVACG-KWFKTPTVFQSHLTGKHHRNNRDKRFTKLQAEYK 318

Query: 279 VREKLQTLAAELASGAARVERQLNMTPQERFAEHAAQQRIRTAVQGRGGGDXXXXXXXXX 338
           +   L+ L  +L      VER++  T +ER  E +   RI    +G              
Sbjct: 319 LHRYLKILQGQLERTRGFVERKMAFTTEERMEEMSRLARI---YEGPDYAPDEKEIEEKE 375

Query: 339 XXXXXXXXXXXXXXVEV----DGRHVPRWLYRLQGLSSIFTCELCDGREFHGRTRYERHF 394
                         +E+    DG  +P WLY+LQGL   ++CE+C  + + GR  +ERHF
Sbjct: 376 DSVDTPSEKKMNGGIELPLGLDGLPIPLWLYKLQGLDVTYSCEICGNQTYRGRRMFERHF 435

Query: 395 TSTQHRTRLVCLGVPA 410
           T   H   L CLG+ A
Sbjct: 436 TEPTHLFHLKCLGIEA 451

>Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AEL085W
          Length = 532

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 92/376 (24%), Positives = 143/376 (38%), Gaps = 57/376 (15%)

Query: 78  EQLQRVPRNSVEEVSV----ASLFATRI------------KEIAPLPIPSIDINSVYRDP 121
           +Q+QR+     EE +     ASL A +             K+I  L   SIDIN  +   
Sbjct: 119 DQIQRIKEKYAEESNSEAFDASLEARKYQYTMFSNSNHQKKDILSLEGQSIDINKKF-SW 177

Query: 122 EEEYGTSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQVTKQFLHDRWIDETAFPP--- 178
           EE YG  + LD+++  ++  +     S     L++F G +     H    +    PP   
Sbjct: 178 EEHYGEYLHLDQYHQEYLNIVKNANVS-----LLQFIGFLQTFCDHGHLKN----PPVDR 228

Query: 179 ------SLIAGMLEYLTGFQERVDIVKPQDSSAAITRRLRRHIALXXXXXXXXXXXXXXX 232
                   +  +L+Y+  F E      P  +     +R++                    
Sbjct: 229 NSKIYHGFLERLLKYVNSFFESA---FPLINHVQFQKRIKNSFV-------EYTSTPIED 278

Query: 233 XPWPLTCIVCGPKKFATEQVFHHHLNSNRHLKREASRLPIMIPIQSVREKLQTLAAELAS 292
                 C+ CG K F    V+  HL   +HL     R   ++   +++     L  EL S
Sbjct: 279 SSRGCLCVACG-KWFKAITVYTSHLQGRKHLNNLKCRRRSLMVEYTLQNLFTCLNKELVS 337

Query: 293 GAARVERQLNMTPQERFAEHAAQQRIRTAVQGRGGGDXXXXXXXXXXXXXXXXXXXXXXX 352
             + VER+   T +ER  E A   ++R A      GD                       
Sbjct: 338 TKSFVERKYAFTVEERIQELA---KLRDAYNANAYGDHEREDSQEDLSVSSSKETPPDDN 394

Query: 353 VEV------DGRHVPRWLYRLQGLSSIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCL 406
             +      DG  +P WLY+LQGL   +TCE+C    + GR  +ERHF   +H   L CL
Sbjct: 395 NPLNLPLGPDGYPIPYWLYKLQGLDIEYTCEICGNHLYKGRRVFERHFHEQRHTYGLRCL 454

Query: 407 GVPAEQHVQFRGLGKL 422
           G+  E    F+G+ K+
Sbjct: 455 GI--EPTSTFKGISKI 468

>Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score = 85.9 bits (211), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 80/326 (24%), Positives = 132/326 (40%), Gaps = 37/326 (11%)

Query: 112 IDINSVY-RDPEEEYGTSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQVTKQFLHDRW 170
           +D+N ++ RD  E+YG  + L++F++LW+    +     S  +L++F+  V + F+ D+ 
Sbjct: 164 LDLNKIFTRD--EQYGEYMELEQFHSLWLNVFKR-----SDCSLLQFFD-VVELFVDDKK 215

Query: 171 IDETAFPP---------SLIAGMLEYLTGFQERVDIVKPQDSSAAITRRLRRHIALXXXX 221
              T  PP         + +  + +YL  F  +         S A+  +     ++    
Sbjct: 216 YLLT--PPMDRKNDRYMAFLIKLCKYLETFFFK---------SYALFDKEVIESSIRFDF 264

Query: 222 XXXXXXXXXXXXPWPLTCIVCGPKKFATEQVFHHHLNSNRHLKREASRLPIMIPIQSVRE 281
                          + C  C  K F T  VF +HL    H K E  R   +     +  
Sbjct: 265 EQSYCKGSLRSEAKGIHCPFCY-KWFKTSPVFENHLTGKIHKKNEFKRKDTVYSEYKLHR 323

Query: 282 KLQTLAAELASGAARVERQLNMTPQERFAE-HAAQQRIRTAVQGRGGGDXXXXXXXXXXX 340
            L+ L  E +   + VER+L  T  ER AE  A  Q+           D           
Sbjct: 324 YLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQKYEAPAYDPTDKDGDQQKGSDQRD 383

Query: 341 XXXXXXXXXXXXVEV----DGRHVPRWLYRLQGLSSIFTCELCDGREFHGRTRYERHFTS 396
                        ++    DG  +P WLY+L GL   + CE+C  + ++GR  +ERHF  
Sbjct: 384 DQLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGLDREYHCEICANKVYNGRRTFERHFNE 443

Query: 397 TQHRTRLVCLGVPAEQHVQFRGLGKL 422
             H   L CLG+  E  + F+G+ K+
Sbjct: 444 GPHLYHLRCLGI--EPSLAFKGITKI 467

>Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}
           complement(50993..52546) [1554 nt, 518 aa]
          Length = 517

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 88/369 (23%), Positives = 138/369 (37%), Gaps = 48/369 (13%)

Query: 72  KYRRCYEQLQRVPRNSVEEVSVASLFATRIKEIAPLPIPS-----IDINSVYRDPEEEYG 126
           KY       Q++P N    +   S+F +   +  P  I S     ++IN  Y   +E+YG
Sbjct: 122 KYEDSVSDNQQLPINKT--IFQYSMFTSSNSKNKPNNILSDKCKYLEIND-YFTRDEQYG 178

Query: 127 TSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQVTKQFLHDRWIDETAF---PP----- 178
             + L+RFYN W+  +     S      +  Y  + ++FL     D   +   PP     
Sbjct: 179 EYLELERFYNNWLNVIKSANCS------ILQYMSIIEKFL-----DSAQYILQPPMDRKN 227

Query: 179 ----SLIAGMLEYLTGFQERVDIVKPQDSSAAITRRLRRHIALXXXXXXXXXXXXXXXXP 234
                 +  +  YLT F ++  ++   +  A +   L+    +                 
Sbjct: 228 ERYLKFLEIIETYLTSFIKKTYVLIDWEEEAEV---LKYDYEIECTKSLMKQGKGNF--- 281

Query: 235 WPLTCIVCGPKKFATEQVFHHHLNSNRHLKREASRLPIMIPIQSVREKLQTLAAELASGA 294
               C +CG K F TE VF +HL    H+K              +   L  L+ E     
Sbjct: 282 ----CRLCG-KWFKTESVFENHLPGKNHVKNYKKYYDEYFIEFKIHRILNWLSKEFEETK 336

Query: 295 ARVERQLNMTPQERFAE----HAAQQRIRTAVQGRGGGDXXXXXXXXXXXXXXXXXXXXX 350
             +ER+L  T  ER  E        +R   +V     G                      
Sbjct: 337 LFLERKLAFTSDERIKEIDRMTEVYERPAYSVGEPEEGKPNENSSKTSSNKNDIINGSFD 396

Query: 351 XXVEVDGRHVPRWLYRLQGLSSIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGVPA 410
             +  DG  +P WLY+LQGL   + CE+C    + GR  +E+HF+ T H   L CLG+  
Sbjct: 397 MPLGPDGLPMPYWLYKLQGLDMTYKCEICANTIYKGRRTFEKHFSETTHNYHLRCLGI-- 454

Query: 411 EQHVQFRGL 419
           E    F+G+
Sbjct: 455 EPSSAFKGI 463

>KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {ON}
           Anc_3.160 YDL030W
          Length = 506

 Score = 85.1 bits (209), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 81/340 (23%), Positives = 137/340 (40%), Gaps = 46/340 (13%)

Query: 89  EEVSVASLFA--TRIKEIAPLPIPSIDINSVY-RDPEEEYGTSISLDRFYNLWIGHLTKR 145
           +++   S+F+  T  K I       +DIN  + RD  E++G  + L+RF+N+W+  +   
Sbjct: 130 DKIDYYSMFSASTTQKSILSKRAADLDINQTFTRD--EQFGECMDLERFHNVWLSVV--- 184

Query: 146 KTSESPPTLVEFYGQV-----TKQFLHDRWIDETA-----FPPSLIAGMLEYLTGFQERV 195
              +   +L++F+  +     TK +L    +D        F  + I+G +E  + F ++ 
Sbjct: 185 --KDDSYSLLDFFRVIESFLDTKSYLKSPHMDRKNQRYQEFIKT-ISGYVE--SFFFKKF 239

Query: 196 DIVKPQDSSAAITRRLRRHIALXXXXXXXXXXXXXXXXPWPLTCIVCGPKKFATEQVFHH 255
            ++  +     +  RL++   L                     C+ C  K F T+ VF +
Sbjct: 240 CLIDKE----YVNARLQQDFILYLDNPLNNQN--------GFFCVACN-KSFKTKSVFDN 286

Query: 256 HLNSNRHLKREASRLPIMIPIQSVREKLQTLAAELASGAARVERQLNMTPQERFAEHAAQ 315
           HL   +H +    R   +I    +   L  L  E  +     ER+++ T  ER  E    
Sbjct: 287 HLPGKQHKRNVDKRRNSLISEYKLYRFLNLLRTEFNNTKEFTERKISFTANERREE---L 343

Query: 316 QRIRTAVQGRGGGDXXXXXXXXXXXXXXXXXXXXXXXVEV-------DGRHVPRWLYRLQ 368
           +R+         G                          +       DG  +P WLY+LQ
Sbjct: 344 ERLNNEYNAPVYGSEEQEEGDEEHDEYASKNGNRSILDGLFNMPLGPDGVPMPFWLYKLQ 403

Query: 369 GLSSIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGV 408
           GL   + CE+C  REF GR  +ERHF    H+  L CLG+
Sbjct: 404 GLDVSYYCEICSNREFKGRRAFERHFNEKTHQYHLRCLGI 443

>KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 506

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/336 (25%), Positives = 137/336 (40%), Gaps = 39/336 (11%)

Query: 102 KEIAPLPIPSIDINSVYRDPEEEYGTSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQV 161
           K I      ++DINS Y   +E+YG  + L+ F+  W+  +          TL++F  +V
Sbjct: 147 KNIISRKAQNLDINS-YFTRDEQYGEYLDLEPFHQKWLSVVKNGDV-----TLLQFLSEV 200

Query: 162 TKQFLHDRWIDETAFPPS------LIAGMLEYLTGFQERVDIVKPQDSSAAITRRLRRHI 215
            K F   R++ + A   +       +A +  YL+ +  R   +   D   A  + L    
Sbjct: 201 EK-FTDQRYLLQPAVNRNSSRYREFVASLHHYLSDYAARAYPLLSWDLIHAKAQEL---- 255

Query: 216 ALXXXXXXXXXXXXXXXXPWP-----LTCIVCGPKKFATEQVFHHHLNSNRHLKREASRL 270
                             P P     + CI C  K+F T+ V++ HL   RH+       
Sbjct: 256 -----------YHTNVAKPIPSGESGVFCIPCD-KRFKTDTVYNAHLPGKRHVGNLHKNS 303

Query: 271 PIMIPIQSVREKLQTLAAELASGAARVERQLNMTPQERFAEHAAQQRIRTA-VQGRGGGD 329
             +    S+    + L+ ELA     VER+L  T +ER  E      I  + V GR   +
Sbjct: 304 SFLTQEHSLHIFCRYLSRELARTREFVERKLAFTTEERTQELERLTDIYDSPVYGRQEQE 363

Query: 330 XXXXXXXXXXXXXXXXXXXXXXXVEV--DGRHVPRWLYRLQGLSSIFTCELCDGREFHGR 387
                                  + +  DG  +P WLY+LQGL   + CELC    ++GR
Sbjct: 364 DAQEDENKETEDKEDSVLDSSMNLPLGPDGFPIPYWLYKLQGLDIEYPCELCGNFVYNGR 423

Query: 388 TRYERHFTSTQHRTRLVCLGVPAEQHVQFRGLGKLD 423
            ++++HF   +H   L  LG+  E    F+G+ K+D
Sbjct: 424 RQFDKHFGEQRHVFGLRRLGI--EPSASFKGVTKID 457

>NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.160
           YDL030W
          Length = 518

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 87/355 (24%), Positives = 139/355 (39%), Gaps = 43/355 (12%)

Query: 89  EEVSVASLFATRIKEIAPLPIPS-----IDINSVYRDPEEEYGTSISLDRFYNLWIGHLT 143
           ++++  ++F+  I E  P  I S     +DIN  Y   EE+YG  +  + FY  W+  + 
Sbjct: 134 QKITRYAMFSASISESKPNNILSQRCAGLDINK-YFSREEQYGQYMDFENFYLEWLNVV- 191

Query: 144 KRKTSESPPTLVEFYGQVTKQFLHDRWIDETAF---PP-----SLIAGMLEYLTGFQERV 195
             KT +   TL++F        L   ++DE  +   PP     +     LE L  + E  
Sbjct: 192 --KTGDV--TLLQFLN------LLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSYVESF 241

Query: 196 DIVK-PQDSSAAITRRLRRHIALXXXXXXXXXXXXXXXXPWPLTCIVCGPKKFATEQVFH 254
              K    + +AIT ++                           C  C  K F TE VF 
Sbjct: 242 FFRKYALINKSAITSQIESQFTEYIKEPTEHSVKGQY-------CKACA-KWFKTESVFV 293

Query: 255 HHLNSNRHLKREASRLPIMIPIQSVREKLQTLAAELASGAARVERQLNMTPQERFAEHA- 313
           +H+    H+K E  R   ++    +      L  E       +E ++ +T  ER  E   
Sbjct: 294 NHIPGKNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKR 353

Query: 314 -AQQRIRTAVQG-RGGGDXXXXXXXXXXXXXXXXXXXXXXXVEV----DGRHVPRWLYRL 367
             +   + A       GD                        ++    DG  +P WLY+L
Sbjct: 354 LTENYEKPAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKL 413

Query: 368 QGLSSIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQFRGLGKL 422
           QGL   + CE+C  + F GR  +E+HFT+  H+  L CLG+  E    F+G+ K+
Sbjct: 414 QGLDVEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGI--EPSSMFKGITKI 466

>TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score = 79.3 bits (194), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 74/185 (40%), Gaps = 7/185 (3%)

Query: 239 CIVCGPKKFATEQVFHHHLNSNRHLKREASRLPIMIPIQSVREKLQTLAAELASGAARVE 298
           CI CG K F    V+  HL   +H K  ++R   +     +   +  L  E     A +E
Sbjct: 285 CISCG-KWFKNSNVYDGHLKGKQHEKHYSNRKMFLYNEYKLHRIINYLKYEFDESKAYME 343

Query: 299 RQLNMTPQERFAE-HAAQQRIRTAVQGRG---GGDXXXXXXXXXXXXXXXXXXXXXXXVE 354
           R+L  T  ER  E     ++       +      D                       + 
Sbjct: 344 RKLAFTNTERNNELKLLTKKYEEPAYNKDEPENTDKYEEDDNSMSNAAEDRNKSFNMPLG 403

Query: 355 VDGRHVPRWLYRLQGLSSIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGVPAEQHV 414
            DG  +P WLY+LQGL   + CE+C  +E+ GR  YE HF+   H + L  LG+   +  
Sbjct: 404 PDGMPIPLWLYKLQGLDIKYNCEICGNKEYQGRKAYENHFSELTHTSHLYFLGIQYSK-- 461

Query: 415 QFRGL 419
            F+G+
Sbjct: 462 AFKGI 466

>SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 601

 Score = 79.0 bits (193), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 87/352 (24%), Positives = 142/352 (40%), Gaps = 31/352 (8%)

Query: 80  LQRVPRNSVEEVSVASLFATRIKEIAPLPIPSIDINSVY-RDPEEEYGTSISLDRFYNLW 138
           L  V   SVE    +S  +T  K+I       +D+N ++ RD  E YG  + L+ F++ W
Sbjct: 208 LAGVDVESVEHSMFSSSTSTH-KDILSTRGRDLDMNRLFARD--EHYGEFLLLEPFHHEW 264

Query: 139 IGHLTKRKTSESPPTLVEFYGQVTKQFLHDRWIDETAFP------PSLIAGMLEYLTGFQ 192
           +         +   T ++F   V + F+ D ++   A           +  +L Y++ F 
Sbjct: 265 LN-----IVKDGSVTALQFMN-VVEMFVSDAYLVAPAVNRGSKKYQDFVGSLLGYMSEFF 318

Query: 193 ERVDIVKPQDSSAAITRRLRRHIALXXXXXXXXXXXXXXXXPWPLTCIVCGPKKFATEQV 252
            +     P  + + + RRL    AL                   L CI CG + F  E V
Sbjct: 319 RKT---YPLVNHSTLGRRL---AALFDEYLRAPVADETKG----LFCIPCG-RWFKLETV 367

Query: 253 FHHHLNSNRHLKREASRLPIMIPIQSVREKLQTLAAELASGAARVERQLNMTPQERFAE- 311
           +  HL+  +H K  A     ++    + +    L   +A+  A VER   +T  ER  E 
Sbjct: 368 YKSHLSGKKHSKNLAKGDGHLLAEYKLHKYCGLLVQTIANTRAFVERNRALTADERAQEL 427

Query: 312 -HAAQQRIRTAVQGRGGGDXXXXXXXXXXXXXXXXXXXXXXXVEVDGRHVPRWLYRLQGL 370
              A++    A       D                       +  DG  +P WLY+LQGL
Sbjct: 428 ERLAKEYEAPAYSQHETEDAAREKQQKREPETDEGGNPFNLPLGPDGYPIPYWLYKLQGL 487

Query: 371 SSIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQFRGLGKL 422
              ++CE+C    + GR  +E+HF+  +H   L CLG+  E    F+G+ K+
Sbjct: 488 DIEYSCEICSNHTYKGRRYFEKHFSEARHIFGLRCLGI--EPSATFKGITKI 537

>YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subunit
           of the SF3a splicing factor complex, required for
           spliceosome assembly; acts after the formation of the U1
           snRNP-pre-mRNA complex
          Length = 530

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/323 (24%), Positives = 128/323 (39%), Gaps = 31/323 (9%)

Query: 112 IDINSVY-RDPEEEYGTSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQVTKQFLHDRW 170
           +D+N ++ RD  E+YG  + L++F++LW+  + +   S     L++F   + + FL D  
Sbjct: 164 LDLNEIFTRD--EQYGEYMELEQFHSLWLNVIKRGDCS-----LLQFLD-ILELFLDDEK 215

Query: 171 IDETAFPPS------LIAGMLEYLTGFQERVDIVKPQDSSAAITRRLRRHIALXXXXXXX 224
              T  PP        +A +L+ L+ + E           AA    L     +       
Sbjct: 216 YLLT--PPMDRKNDRYMAFLLK-LSKYVETFFFKSYALLDAAAVENL-----IKSDFEHS 267

Query: 225 XXXXXXXXXPWPLTCIVCGPKKFATEQVFHHHLNSNRHLKREASRLPIMIPIQSVREKLQ 284
                       + C  C  + F T  VF  HL    H K E+ R   +     +   L+
Sbjct: 268 YCRGSLRSEAKGIYCPFCS-RWFKTSSVFESHLVGKIHKKNESKRRNFVYSEYKLHRYLK 326

Query: 285 TLAAELASGAARVERQLNMTPQERFAE-----HAAQQRIRTAVQGRGGGDXXXXXXXXXX 339
            L  E +   + VER+L  T  ER AE        +     + +  G             
Sbjct: 327 YLNDEFSRTRSFVERKLAFTANERMAEMDILTQKYEAPAYDSTEKEGAEQVDGEQRDGQL 386

Query: 340 XXXXXXXXXXXXXVEVDGRHVPRWLYRLQGLSSIFTCELCDGREFHGRTRYERHFTSTQH 399
                        +  DG  +P WLY+L GL   + CE+C  + ++GR  +ERHF   +H
Sbjct: 387 QEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDREYRCEICSNKVYNGRRTFERHFNEERH 446

Query: 400 RTRLVCLGVPAEQHVQFRGLGKL 422
              L CLG+  E    F+G+ K+
Sbjct: 447 IYHLRCLGI--EPSSVFKGITKI 467

>Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {ON}
           YDL030W (PRP9) - RNA splicing factor [contig 184] FULL
          Length = 531

 Score = 76.3 bits (186), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 81/351 (23%), Positives = 140/351 (39%), Gaps = 33/351 (9%)

Query: 86  NSVEEVSVASLFATRIKEIAPLPIPSIDINSVYRDPEEEYGTSISLDRFYNLWIGHLTKR 145
           +S+E  ++ S      ++I      ++DIN+ +   EE+YG  + L+ F+  W+  +   
Sbjct: 156 DSMENYTMFSNSTAARRDILSKKARALDINAKFT-REEQYGEFLDLEPFHQQWLSVV--- 211

Query: 146 KTSESPPTLVEFYGQV----TKQFLHDRWIDE-TAFPPSLIAGMLEYLTGFQERVDIVKP 200
              +   +L++F G++    TK+FL    ++  +A     +  +L YL  +  R   ++ 
Sbjct: 212 --KDGSVSLLQFLGEIEKFTTKRFLLTPAVNRGSARYQDFVKALLCYLQDYLMRAYPLQD 269

Query: 201 QDSSAAITRRLRRHIALXXXXXXXXXXXXXXXXPWPLTCIVCGPKKFATEQVFHHHLNSN 260
            D         + H  +                   L CI C  K F  E V+  HL   
Sbjct: 270 WD---------KIHAEIQATYCDYKSHPEEAGDS-GLFCIPCD-KTFKAETVYLAHLTGK 318

Query: 261 RHLKREASRLPIMIPIQSVREKLQTLAAELASGAARVERQLNMTPQERFAEHAAQQRIRT 320
           +H+     +   +     +      L  EL      VER+L  TP+ER  E    +R+ T
Sbjct: 319 KHINNMNKKDEFLAQEYKLHMLCCYLVQELVRTREFVERKLAFTPEERRQE---MERLTT 375

Query: 321 AVQGRGGGDXXXXXXXXXXXXXXXXXXXXXXXVEV------DGRHVPRWLYRLQGLSSIF 374
             +    G+                                DG  +P WLY+LQGL   +
Sbjct: 376 VYESPVYGEQEQEDIAEADQKPTTNQEDSTPEPSFDLPLGPDGFPIPYWLYKLQGLDIEY 435

Query: 375 TCELCDGREFHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQFRGLGKLDAV 425
            CE+C    + GR ++++HFT  +H   L  LGV  +    F+G+  +D V
Sbjct: 436 PCEVCGNLIYKGRRQFDKHFTEQRHIFGLKRLGV--DPSPSFKGVTSIDDV 484

>CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030w
           Pre-mRNA splicing factor PRP9
          Length = 516

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/326 (19%), Positives = 123/326 (37%), Gaps = 38/326 (11%)

Query: 112 IDINSVYRDPEEEYGTSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQVT-KQFLHDRW 170
           +DIN++++  E++ G  I  +  Y  W+ ++ K  T   P  +      +  K++L D  
Sbjct: 170 LDINTIFQKDEQD-GFIIDFEPLYRRWL-NIVKDGTLTYPKFISNLEKFIDDKKYLLDPV 227

Query: 171 ID-ETAFPPSLIAGMLEYL-TGFQERVDIVKPQDSSAAITRRLRRHIALXXXXXXXXXXX 228
           +D +T      +    +++ T + +R  ++  +     + R    H+             
Sbjct: 228 MDRKTKGYCEFVVEACDFVETQYFKRNILLNEEQIKGKLHRDFENHVT-----------K 276

Query: 229 XXXXXPWPLTCIVCGPKKFATEQVFHHHLNSNRHLKREAS-------RLPIMIPIQSVRE 281
                     C+ C  K F +  ++  H     H K  ++          + + +  +RE
Sbjct: 277 AIITESGIYYCLYC-DKMFNSAHIYDSHRTGKAHSKSVSNYHDSFRAEFKLHVYVSCMRE 335

Query: 282 KLQTLAAELASGAARVERQLNMTPQERFAE-----HAAQQRIRTAVQGRGGGDXXXXXXX 336
                  E  +    V+R++  T +ER  E         + +    +  G  +       
Sbjct: 336 -------EFENTKEYVDRKMAFTNKERLEEMEKLTQEYHRPVYDPTEKEGDVEEDNSKSK 388

Query: 337 XXXXXXXXXXXXXXXXVEVDGRHVPRWLYRLQGLSSIFTCELCDGREFHGRTRYERHFTS 396
                           +  DG  +P WLY+LQGL     CE+C  + + G   +++HF+ 
Sbjct: 389 TKDELKEMLGLGEDMPLGPDGLPIPYWLYKLQGLDVGQECEICGNQVYKGHKNFDKHFSG 448

Query: 397 TQHRTRLVCLGVPAEQHVQFRGLGKL 422
             H   L CLG+  E    F+G+ K+
Sbjct: 449 PTHTYHLKCLGI--EPSSAFQGITKI 472

>KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]
           {ON} similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 530

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%)

Query: 356 DGRHVPRWLYRLQGLSSIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGV 408
           DG  +PRWL ++QGL   + CE+C  + +HGR  +E+HF   +H   L  LG+
Sbjct: 407 DGFPIPRWLIKVQGLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGI 459

>AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL030W (PRP9)
          Length = 527

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 116/310 (37%), Gaps = 38/310 (12%)

Query: 112 IDINSVYRDPEEEYGTSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQVTKQFLHDRWI 171
           ID+N ++   EE YG  + L+R +  W+  +      +   TL++F     + F    ++
Sbjct: 169 IDVNKLFM-WEEHYGEYLFLERLHQDWLNVV-----KDGSVTLLQFIA-FLESFAGTGYL 221

Query: 172 DETAFPPS--------LIAGMLEYLTG-FQERVDIVKPQDSSAAITRRLRRHIALXXXXX 222
             TA P           I  ++ YL G F+    ++  +     I++    +IA      
Sbjct: 222 --TAPPVDRNSKRYQVFIQKLVTYLEGAFRNTYPLLNHRLLENRISQSFESYIA------ 273

Query: 223 XXXXXXXXXXXPWPLTCIVCGPKKFATEQVFHHHLNSNRHLKREASRLPIMIPIQSVREK 282
                      P  L CI CG K F    VF  HL   +H +   +++  +    ++   
Sbjct: 274 -----NPVEDPPRGLLCIACG-KHFKVGTVFAGHLLGKKHAQSVTTKVATLRAEHTLHYL 327

Query: 283 LQTLAAELASGAARVERQLNMTPQERFAEHAAQQRIRTAVQG----RGGGDXXXXXXXXX 338
           +  LA  + +  A VER+   T  ER  E A    IR A        G  +         
Sbjct: 328 VIYLATSIENTRALVERKYAFTSGERNREMAT---IRDAYDAPAYSSGEPEDVIETPQQQ 384

Query: 339 XXXXXXXXXXXXXXVEVDGRHVPRWLYRLQGLSSIFTCELCDGREFHGRTRYERHFTSTQ 398
                         +   G  +P WLY+LQGL   + CE+C    + GR R       T 
Sbjct: 385 QNAHPDDVNPLNLPLGPMGYPIPYWLYKLQGLDIEYACEICANHVYKGR-RISNAIFRTA 443

Query: 399 HRTRLVCLGV 408
               L CLG+
Sbjct: 444 PCYGLRCLGI 453

>ADL222W Chr4 (314279..315829) [1551 bp, 516 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL097W (FYV10)
          Length = 516

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%)

Query: 170 WIDETAFPPSLIAGMLEYLTGFQERVDIVKPQDSSAAIT 208
           WI E A      + MLE+   FQE ++ VK +D S AIT
Sbjct: 226 WIKENATYLKHTSSMLEFEARFQEYIEYVKVEDYSKAIT 264

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,867,769
Number of extensions: 1468230
Number of successful extensions: 3648
Number of sequences better than 10.0: 22
Number of HSP's gapped: 3713
Number of HSP's successfully gapped: 37
Length of query: 486
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 372
Effective length of database: 40,409,475
Effective search space: 15032324700
Effective search space used: 15032324700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)