Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B005606.45ON49249220560.0
TDEL0G042506.45ON51745710261e-134
ZYRO0C07194g6.45ON5584099791e-126
TPHA0F024806.45ON6054099671e-124
Suva_15.1596.45ON5504099091e-116
YOL013C (HRD1)6.45ON5514119051e-115
Kpol_1035.506.45ON6013869021e-114
Smik_15.1576.45ON5504108951e-114
Skud_15.1486.45ON5484048831e-112
SAKL0E01958g6.45ON5243858791e-112
KAFR0A052406.45ON5534288471e-107
NCAS0D020106.45ON5104187862e-98
CAGL0E02299g6.45ON5454047831e-97
KNAG0E027406.45ON5564347823e-97
KLTH0C10604g6.45ON5153817742e-96
NDAI0C027706.45ON6304527752e-95
Kwal_56.225226.45ON5133817435e-92
KLLA0C05874g6.45ON5534015023e-56
ACL019C6.45ON5753404385e-47
Ecym_30486.45ON6703864267e-45
NCAS0A047602.545ON7611361375e-08
Suva_11.1892.545ON7581381359e-08
TBLA0A096405.628ON3251101339e-08
Skud_11.1922.545ON758721286e-07
Smik_11.2132.545ON759721287e-07
TBLA0I014902.545ON750681278e-07
YKL034W (TUL1)2.545ON758721271e-06
KLTH0D07216g2.545ON747571261e-06
TDEL0B063402.545ON762581214e-06
AFR275W2.545ON753581205e-06
Ecym_72412.545ON758581198e-06
SAKL0A09812g2.545ON751571198e-06
Kwal_26.80992.545ON750681189e-06
KLLA0F25674g2.545ON757591189e-06
ZYRO0E05632g2.545ON765571181e-05
KAFR0B014602.545ON761571171e-05
TPHA0C042602.545ON757571162e-05
SAKL0G07370g5.628ON3211421132e-05
AGR034W3.279ON159811073e-05
KNAG0A070902.545ON762571116e-05
Ecym_13285.628ON320801097e-05
NDAI0H008405.628ON341621097e-05
Kpol_1002.72.545ON754681118e-05
NCAS0A087801.389ON1502511092e-04
CAGL0M08690g5.628ON328541062e-04
KLLA0E04071g8.317ON704341072e-04
TDEL0A049405.628ON326971052e-04
ZYRO0C11176g5.628ON368641053e-04
Skud_4.5285.628ON337681043e-04
Suva_2.4335.628ON337681043e-04
NCAS0A113503.405ON428551053e-04
KLTH0G12408g8.317ON603401053e-04
CAGL0L01947g2.545ON757571054e-04
Kpol_526.345.628ON328541034e-04
AER390W5.628ON316561026e-04
CAGL0K08052g3.405ON305581016e-04
Kwal_27.105463.279ON10482948e-04
TDEL0D034603.279ON14443968e-04
KLLA0F12166g1.389ON15281141029e-04
Ecym_42508.317ON657371010.001
TPHA0C003505.628ON27898990.001
NDAI0K018102.545ON762541000.001
CAGL0H10274g3.279ON17576950.002
KLTH0E02464g5.628ON32968980.002
NCAS0C033108.317ON57029980.002
Smik_4.5165.628ON33767970.003
YDR265W (PEX10)5.628ON33769960.003
KLTH0C05258g3.279ON15282920.003
SAKL0C01760gsingletonON1474122970.004
SAKL0C03586gsingletonON1474122970.004
NDAI0A074503.279ON17389920.004
Kwal_55.199995.628ON15288910.004
Skud_4.4028.317ON61232960.005
TPHA0A033403.405ON38459940.005
Suva_4.3023.279ON15076900.006
KAFR0H005605.628ON32766940.006
Suva_2.3048.317ON62432950.006
TBLA0C013301.389ON145295950.006
NCAS0A04680singletonON27478930.007
Kwal_56.239008.317ON58940940.007
CAGL0B05049g1.389ON147032940.008
Smik_4.3878.317ON63432940.008
ZYRO0D05830g8.317ON78060940.008
KAFR0B030708.317ON64329930.009
CAGL0I04576g3.190ON14997880.009
YDR143C (SAN1)8.317ON61032930.010
Ecym_26583.279ON15999880.011
CAGL0E01441g8.317ON71729920.013
ZYRO0E05192g1.389ON152060920.014
KNAG0G023908.317ON68829920.014
Skud_12.3281.389ON155772920.015
KAFR0F028406.332ON44568910.015
Kpol_1052.193.279ON10341840.015
Kpol_1048.731.389ON154950920.016
SAKL0A09526gna 1ON66232910.016
KLTH0F18502gsingletonON26765890.017
SAKL0H17116gsingletonON54440910.017
KLLA0E16677g5.628ON30529900.017
Kwal_26.8030na 1ON66032910.019
Ecym_54453.405ON32158890.019
TDEL0B061701.389ON147050910.022
KLLA0F18458g3.279ON14082850.023
CAGL0K02563g2.542ON58630890.029
KLTH0D06886gna 1ON66432890.029
TPHA0C008508.317ON78129890.029
SAKL0D03058g3.279ON15569840.031
KLTH0F11044g3.405ON29153870.034
KNAG0A074303.405ON10258810.034
NDAI0G052001.389ON158650890.034
Kpol_1036.668.317ON66829880.036
TDEL0A03090na 1ON58632880.036
Kwal_14.12871.389ON151851890.037
NCAS0C052905.628ON33029870.037
SAKL0D08272g1.389ON149161880.039
TBLA0I023606.332ON64468880.039
NDAI0G026308.317ON66151880.041
KLLA0E18503gna 1ON65032870.046
TDEL0F02870na 2ON26042860.047
Skud_2.1863.279ON17876840.048
KNAG0I013801.389ON149350870.053
TDEL0F044408.317ON55432870.053
KAFR0I020901.389ON1466111870.057
Smik_12.3201.389ON155350860.074
SAKL0H15686g8.317ON59940850.076
KLTH0G18150g1.389ON155451860.077
NDAI0E004408.808ON41632850.079
KNAG0J008503.279ON16239810.084
Ecym_7253na 1ON61732850.094
TPHA0I005608.808ON39439840.099
ABR104W3.405ON32831840.100
ZYRO0B02046gna 1ON44532840.11
SAKL0D02354g8.808ON33136830.13
Kwal_56.231123.190ON13527790.13
KAFR0A019902.542ON56030830.13
SAKL0C10516g3.190ON14466790.14
Smik_2.1963.279ON18534800.15
YOL054W (PSH1)8.808ON40691820.17
KNAG0J015605.628ON30929810.17
YBR062C3.279ON18034790.19
KNAG0A012803.28ON11426760.20
TBLA0B026708.808ON47865810.21
Kwal_27.104198.808ON30036800.25
TPHA0B036501.389ON157627820.25
AAR147W6.100ON158064810.27
TPHA0C042502.542ON55631810.27
KNAG0C056602.542ON50730810.27
KLTH0C04664g8.808ON30636790.31
CAGL0J04796g4.308ON59965800.31
TBLA0G023102.542ON67430800.32
ZYRO0C17424g3.405ON27355790.32
KLLA0C15697g3.405ON30454790.33
TPHA0A039903.279ON17528770.33
Smik_15.1138.808ON40665800.33
Suva_10.3441.389ON156050810.34
YLR247C (IRC20)1.389ON155650800.36
KNAG0I028806.332ON46158790.37
KAFR0H007103.405ON22855780.37
Kpol_1002.82.542ON55826800.38
Kpol_480.228.808ON42558790.38
Skud_15.1028.808ON40665790.38
Suva_15.1158.808ON41165790.40
Suva_8.422.542ON58526790.42
KAFR0C004603.279ON15769760.45
KLTH0D07150g2.542ON54065790.45
ZYRO0B02244g2.542ON56326790.45
YHL010C (ETP1)2.542ON58526790.46
NDAI0I004006.332ON48149780.50
Smik_8.322.542ON58526790.51
Skud_8.352.542ON58526780.53
NDAI0D02810na 2ON252105770.53
NCAS0A125502.542ON57226780.56
Kwal_55.21206singletonON27552770.56
TDEL0A031802.542ON56726780.57
Kpol_538.53.405ON33557770.60
SAKL0B08976g3.405ON32253770.60
AAL146W5.190ON190051780.63
TBLA0I019603.279ON18464750.63
AAL030C1.389ON153950780.65
Kwal_55.220543.28ON11126720.67
ZYRO0B16258g2.157ON579137770.70
YPR093C (ASR1)3.405ON28827760.74
ZYRO0E06996g3.279ON17275740.75
ZYRO0A04906g3.190ON16059740.78
SAKL0A09746g2.542ON54826770.79
AGL217W8.808ON41459770.80
TBLA0B087103.28ON12226720.82
KLLA0E06469g7.440ON96571770.90
TDEL0H033703.190ON15335730.93
KLLA0E17711g3.190ON16227730.93
TDEL0B008908.808ON54038760.97
SAKL0C13178g3.28ON13826720.98
AER016C3.190ON14727730.99
NCAS0B009908.808ON39259760.99
TDEL0E043905.190ON195767771.00
Ecym_53123.190ON14827731.00
KLTH0F19228g3.28ON11022711.0
Kwal_26.80902.542ON52065761.0
YOL138C (RTC1)3.22ON134126761.1
Kpol_1028.466.332ON44849761.1
NDAI0G038603.28ON12326711.2
NDAI0B018202.542ON62526751.2
KLLA0E07151g3.28ON11052701.2
CAGL0E01567g3.28ON10226701.2
KLLA0F25740g2.542ON51738751.3
NCAS0J018504.308ON647124751.3
Suva_15.223.22ON133626761.3
Kpol_1014.163.28ON10726701.3
NCAS0C044803.28ON10926701.4
CAGL0J03586g6.332ON41145741.4
TPHA0P014703.28ON11126701.4
ZYRO0C03058g3.28ON11626701.6
TDEL0A004703.28ON11826701.6
KAFR0C017803.28ON11826701.6
NCAS0A082803.279ON11831701.7
Skud_15.203.28ON12126701.7
Smik_15.203.28ON12126701.7
YOL133W (HRT1)3.28ON12126701.7
ZYRO0G13376g8.808ON44563741.7
Suva_15.263.28ON12226701.7
CAGL0B02013g8.288ON112029751.7
ZYRO0D08404g6.332ON40949741.8
KAFR0I028603.22ON136559741.8
KLLA0E07591g2.576ON33169731.8
SAKL0A01474g6.332ON46849741.9
TDEL0B052002.157ON524138741.9
KNAG0G032808.808ON35155731.9
Skud_15.163.22ON133226742.0
TDEL0A074706.332ON40830732.3
KAFR0D016708.808ON35765732.3
Kwal_56.235438.247ON96556732.6
KLTH0A06556g6.332ON46030722.6
AER113W4.308ON66552732.7
TPHA0C049108.869ON22380703.1
KNAG0H025905.190ON198085723.1
Ecym_26848.808ON38643723.1
NDAI0G038103.22ON139356723.4
Suva_7.4775.190ON195053723.7
TBLA0A039008.317ON69829713.9
Smik_16.3333.405ON29053704.0
Skud_3.1406.332ON48949714.4
KAFR0H020908.359ON907124714.6
TBLA0A002603.190ON18482684.6
Smik_15.163.22ON132626714.7
TBLA0F032803.405ON55526704.9
KLLA0C08756g6.332ON42726704.9
AGL191W8.317ON58231705.7
Suva_3.1046.332ON48549696.0
NCAS0D045406.332ON46949696.1
YCR066W (RAD18)6.332ON48749697.1
NDAI0D019205.190ON207763697.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B00560
         (492 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.4...   796   0.0  
TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {O...   399   e-134
ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {...   381   e-126
TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.4...   377   e-124
Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {...   354   e-116
YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON} ...   353   e-115
Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON} (1244...   352   e-114
Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {...   349   e-114
Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {...   344   e-112
SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} simila...   343   e-112
KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6...   330   e-107
NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {O...   307   2e-98
CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {...   306   1e-97
KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {O...   305   3e-97
KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {...   302   2e-96
NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.4...   303   2e-95
Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013...   290   5e-92
KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {...   197   3e-56
ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON} S...   173   5e-47
Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to ...   168   7e-45
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    57   5e-08
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    57   9e-08
TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [...    56   9e-08
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    54   6e-07
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    54   7e-07
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    54   8e-07
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    54   1e-06
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    53   1e-06
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    51   4e-06
AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-synteni...    51   5e-06
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    50   8e-06
SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {...    50   8e-06
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    50   9e-06
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    50   9e-06
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    50   1e-05
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    50   1e-05
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    49   2e-05
SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 a...    48   2e-05
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    46   3e-05
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    47   6e-05
Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp...    47   7e-05
NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {O...    47   7e-05
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    47   8e-05
NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_...    47   2e-04
CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {...    45   2e-04
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    46   2e-04
TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa...    45   2e-04
ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 ...    45   3e-04
Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W ...    45   3e-04
Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W ...    45   3e-04
NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa] ...    45   3e-04
KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weak...    45   3e-04
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    45   4e-04
Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON} (83624..84...    44   4e-04
AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa...    44   6e-04
CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {...    44   6e-04
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    41   8e-04
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    42   8e-04
KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa...    44   9e-04
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    44   0.001
TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON} ...    43   0.001
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    43   0.001
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    41   0.002
KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 a...    42   0.002
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     42   0.002
Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W ...    42   0.003
YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}  PEX10Perox...    42   0.003
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    40   0.003
SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] ...    42   0.004
SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakl...    42   0.004
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    40   0.004
Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W...    40   0.004
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    42   0.005
TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.4...    41   0.005
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    39   0.006
KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}...    41   0.006
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    41   0.006
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    41   0.006
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      40   0.007
Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {...    41   0.007
CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some ...    41   0.008
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    41   0.008
ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some s...    41   0.008
KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {O...    40   0.009
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...    39   0.009
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    40   0.010
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    39   0.011
CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some s...    40   0.013
ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} simil...    40   0.014
KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {O...    40   0.014
Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] ...    40   0.015
KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {O...    40   0.015
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    37   0.015
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    40   0.016
SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conser...    40   0.016
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    39   0.017
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    40   0.017
KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa] ...    39   0.017
Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig...    40   0.019
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    39   0.019
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    40   0.022
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    37   0.023
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    39   0.029
KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conser...    39   0.029
TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.3...    39   0.029
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    37   0.031
KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly ...    38   0.034
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    36   0.034
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    39   0.034
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    39   0.036
TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON}               39   0.036
Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247...    39   0.037
NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5....    38   0.037
SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] ...    39   0.039
TBLA0I02360 Chr9 (541190..543124) [1935 bp, 644 aa] {ON} Anc_6.3...    39   0.039
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     39   0.041
KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]...    38   0.046
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      38   0.047
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    37   0.048
KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1....    38   0.053
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    38   0.053
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    38   0.057
Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] ...    38   0.074
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    37   0.076
KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa...    38   0.077
NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808...    37   0.079
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    36   0.084
Ecym_7253 Chr7 complement(534000..535853) [1854 bp, 617 aa] {ON}...    37   0.094
TPHA0I00560 Chr9 (112560..113744) [1185 bp, 394 aa] {ON} Anc_8.8...    37   0.099
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    37   0.100
ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conser...    37   0.11 
SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly ...    37   0.13 
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...    35   0.13 
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    37   0.13 
SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar...    35   0.14 
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    35   0.15 
YOL054W Chr15 (228614..229834) [1221 bp, 406 aa] {ON}  PSH1E3 ub...    36   0.17 
KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.6...    36   0.17 
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    35   0.19 
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    34   0.20 
TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.8...    36   0.21 
Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W...    35   0.25 
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    36   0.25 
AAR147W Chr1 (608865..613607) [4743 bp, 1580 aa] {ON} Syntenic h...    36   0.27 
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    36   0.27 
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    36   0.27 
KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some si...    35   0.31 
CAGL0J04796g Chr10 (456300..458099) [1800 bp, 599 aa] {ON} simil...    35   0.31 
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    35   0.32 
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    35   0.32 
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    35   0.33 
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    34   0.33 
Smik_15.113 Chr15 (194228..195448) [1221 bp, 406 aa] {ON} YOL054...    35   0.33 
Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] ...    36   0.34 
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    35   0.36 
KNAG0I02880 Chr9 complement(562281..563666) [1386 bp, 461 aa] {O...    35   0.37 
KAFR0H00710 Chr8 (132097..132783) [687 bp, 228 aa] {ON} Anc_3.40...    35   0.37 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    35   0.38 
Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON} (52842..5...    35   0.38 
Skud_15.102 Chr15 (187319..188539) [1221 bp, 406 aa] {ON} YOL054...    35   0.38 
Suva_15.115 Chr15 (200851..202086) [1236 bp, 411 aa] {ON} YOL054...    35   0.40 
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    35   0.42 
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    34   0.45 
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    35   0.45 
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    35   0.45 
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    35   0.46 
NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}...    35   0.50 
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    35   0.51 
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    35   0.53 
NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON}      34   0.53 
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    35   0.56 
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    34   0.56 
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    35   0.57 
Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)...    34   0.60 
SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {O...    34   0.60 
AAL146W Chr1 (92509..98211) [5703 bp, 1900 aa] {ON} Syntenic hom...    35   0.63 
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    33   0.63 
AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON} ...    35   0.65 
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    32   0.67 
ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]...    34   0.70 
YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}  ...    34   0.74 
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    33   0.75 
ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {O...    33   0.78 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    34   0.79 
AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic ho...    34   0.80 
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    32   0.82 
KLLA0E06469g Chr5 complement(581935..584832) [2898 bp, 965 aa] {...    34   0.90 
TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON...    33   0.93 
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...    33   0.93 
TDEL0B00890 Chr2 (170522..172144) [1623 bp, 540 aa] {ON} Anc_8.8...    34   0.97 
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    32   0.98 
AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON} Sy...    33   0.99 
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    34   0.99 
TDEL0E04390 Chr5 (819719..825592) [5874 bp, 1957 aa] {ON} Anc_5....    34   1.00 
Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON} ...    33   1.00 
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    32   1.0  
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    34   1.0  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    34   1.1  
Kpol_1028.46 s1028 complement(110464..110775,110777..111811) [13...    34   1.1  
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    32   1.2  
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     33   1.2  
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    32   1.2  
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    32   1.2  
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    33   1.3  
NCAS0J01850 Chr10 (347959..349902) [1944 bp, 647 aa] {ON} Anc_4....    33   1.3  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    34   1.3  
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    32   1.3  
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       32   1.4  
CAGL0J03586g Chr10 complement(343893..345128) [1236 bp, 411 aa] ...    33   1.4  
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    32   1.4  
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    32   1.6  
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    32   1.6  
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    32   1.6  
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    32   1.7  
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    32   1.7  
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    32   1.7  
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    32   1.7  
ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]...    33   1.7  
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    32   1.7  
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    33   1.7  
ZYRO0D08404g Chr4 complement(728281..729510) [1230 bp, 409 aa] {...    33   1.8  
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    33   1.8  
KLLA0E07591g Chr5 (685564..686559) [996 bp, 331 aa] {ON} similar...    33   1.8  
SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {...    33   1.9  
TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.1...    33   1.9  
KNAG0G03280 Chr7 complement(703783..704838) [1056 bp, 351 aa] {O...    33   1.9  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    33   2.0  
TDEL0A07470 Chr1 (1302286..1303512) [1227 bp, 408 aa] {ON} Anc_6...    33   2.3  
KAFR0D01670 Chr4 complement(332442..333515) [1074 bp, 357 aa] {O...    33   2.3  
Kwal_56.23543 s56 complement(591514..594411) [2898 bp, 965 aa] {...    33   2.6  
KLTH0A06556g Chr1 (545636..547018) [1383 bp, 460 aa] {ON} simila...    32   2.6  
AER113W Chr5 (848584..850581) [1998 bp, 665 aa] {ON} Syntenic ho...    33   2.7  
TPHA0C04910 Chr3 complement(1062455..1063126) [672 bp, 223 aa] {...    32   3.1  
KNAG0H02590 Chr8 (476608..482550) [5943 bp, 1980 aa] {ON} Anc_5....    32   3.1  
Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {O...    32   3.1  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    32   3.4  
Suva_7.477 Chr7 complement(817323..823175) [5853 bp, 1950 aa] {O...    32   3.7  
TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {O...    32   3.9  
Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {O...    32   4.0  
Skud_3.140 Chr3 (216311..217780) [1470 bp, 489 aa] {ON} YCR066W ...    32   4.4  
KAFR0H02090 Chr8 complement(397562..400285) [2724 bp, 907 aa] {O...    32   4.6  
TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON} ...    31   4.6  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    32   4.7  
TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {O...    32   4.9  
KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {...    32   4.9  
AGL191W Chr7 (339295..341043) [1749 bp, 582 aa] {ON} Syntenic ho...    32   5.7  
Suva_3.104 Chr3 (148368..149825) [1458 bp, 485 aa] {ON} YCR066W ...    31   6.0  
NCAS0D04540 Chr4 (861304..862713) [1410 bp, 469 aa] {ON} Anc_6.3...    31   6.1  
YCR066W Chr3 (231500..232963) [1464 bp, 487 aa] {ON}  RAD18E3 ub...    31   7.1  
NDAI0D01920 Chr4 (451715..457948) [6234 bp, 2077 aa] {ON} Anc_5....    31   7.4  
Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W (...    30   7.7  
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    31   7.9  
Smik_3.167 Chr3 (231267..232730) [1464 bp, 487 aa] {ON} YCR066W ...    31   8.1  
SAKL0E06908g Chr5 complement(570437..573721) [3285 bp, 1094 aa] ...    31   8.4  
Skud_16.379 Chr16 complement(683736..684602) [867 bp, 288 aa] {O...    30   8.9  

>TBLA0B00560 Chr2 (111412..112890) [1479 bp, 492 aa] {ON} Anc_6.45
           YOL013C
          Length = 492

 Score =  796 bits (2056), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/492 (82%), Positives = 406/492 (82%)

Query: 1   MPFYQSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXX 60
           MPFYQSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQG              
Sbjct: 1   MPFYQSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGFNIIIISIFSIINS 60

Query: 61  XXLWKFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMK 120
             LWKFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTII      YMK
Sbjct: 61  IILWKFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIILSLLLLYMK 120

Query: 121 VSNWILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXXXXXXXXX 180
           VSNWILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFC          
Sbjct: 121 VSNWILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCISNSLLSNSN 180

Query: 181 XXXXXXVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHLTSEDEEDDESGF 240
                 VYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHLTSEDEEDDESGF
Sbjct: 181 IGSSASVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHLTSEDEEDDESGF 240

Query: 241 NGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWKIW 300
           NGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWKIW
Sbjct: 241 NGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWKIW 300

Query: 301 VNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNC 360
           VNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNC
Sbjct: 301 VNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNC 360

Query: 361 LKNWMERSQTCPMCRLPVFNEKGEVLPTRRERAXXXXXXXXXXXXXXXXXXWVSFPIETI 420
           LKNWMERSQTCPMCRLPVFNEKGEVLPTRRERA                  WVSFPIETI
Sbjct: 361 LKNWMERSQTCPMCRLPVFNEKGEVLPTRRERATTPEPSTSTSSDSEENEEWVSFPIETI 420

Query: 421 DDSTITFNLANDDGRILKSRLLIXXXXXXXXXXXXILGXXXXXXXXXXXXXXXXXXMKPI 480
           DDSTITFNLANDDGRILKSRLLI            ILG                  MKPI
Sbjct: 421 DDSTITFNLANDDGRILKSRLLINSTTDTTQNSDDILGLKQKINQLQDQINQLNKNMKPI 480

Query: 481 DEKENILLSHTE 492
           DEKENILLSHTE
Sbjct: 481 DEKENILLSHTE 492

>TDEL0G04250 Chr7 complement(772180..773733) [1554 bp, 517 aa] {ON}
           Anc_6.45 YOL013C
          Length = 517

 Score =  399 bits (1026), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 210/457 (45%), Positives = 285/457 (62%), Gaps = 35/457 (7%)

Query: 1   MPFYQSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXX 60
           M   ++R  QF++F++F+Y LT  SVY A  +SISFLQ  ++LT+G              
Sbjct: 1   MAISETRKRQFIVFSIFVYALTIYSVYNATRTSISFLQTVLRLTEGFNIVIITVFFTLNS 60

Query: 61  XXLWKFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMK 120
             LWK S  LLFG LRLIEYEH+ ERLPFT+IN + MSSMF+EHD  T  I      +MK
Sbjct: 61  VLLWKLSTSLLFGSLRLIEYEHIFERLPFTIINTMLMSSMFSEHDFLTVAIYGLLLLFMK 120

Query: 121 VSNWILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXXXXXXXXX 180
           V +WILRDRLE+LLQT+ +STT+ +LIF T+F FNL+L ++ DY +++ C          
Sbjct: 121 VFHWILRDRLEALLQTIQESTTLSDLIF-TRFTFNLVLLAIADYQIISHCVSNSLDNSFG 179

Query: 181 XXXXXXVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTH--LTSEDEEDDES 238
                 V+L+MGMEF +LL+DL N   H+ L  YEFY+S      TH    + ++++D++
Sbjct: 180 ASAS--VHLMMGMEFALLLIDLLNTTLHAALCFYEFYQSQ-----THGRRNAVNDDEDDT 232

Query: 239 GFNGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWK 298
            F+GLEGKFIYE++ID  TRFLKT++H LLL+PF MP+ML KDV+ D +TL QN   +WK
Sbjct: 233 QFSGLEGKFIYERVIDISTRFLKTVLHALLLVPFRMPIMLIKDVLWDCLTLHQNAKGLWK 292

Query: 299 IWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFE--KRKPKMLPCGHIL 356
           IW NN++LDD+LPT+++ QL ++ D +CIICMD+L     + +    K KPK LPCGH+L
Sbjct: 293 IWRNNKQLDDKLPTMSEDQLRNI-DNMCIICMDELIPEQDEGHTRNTKNKPKRLPCGHVL 351

Query: 357 HMNCLKNWMERSQTCPMCRLPVFNEKG-----------EVLPT-----------RRERAX 394
           H+ CLKNWMERSQTCP+CRL VF+E G           EV PT           R +   
Sbjct: 352 HLYCLKNWMERSQTCPICRLAVFDEMGNVVQSTVPTTAEVTPTDEINVPETVVERSQEQI 411

Query: 395 XXXXXXXXXXXXXXXXXWVSFPIETIDDSTITFNLAN 431
                            W SFP+E   ++ +TF++ N
Sbjct: 412 QDNQQQMGEGQVAVLDSWYSFPVEETSENLVTFSMKN 448

>ZYRO0C07194g Chr3 complement(542516..544192) [1677 bp, 558 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 558

 Score =  381 bits (979), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 195/409 (47%), Positives = 269/409 (65%), Gaps = 25/409 (6%)

Query: 1   MPFYQSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXX 60
           M    +R  Q   F L +Y LT  +VY +  +S+SFLQ TIKLT G              
Sbjct: 1   MATSDTRRRQVACFALSVYALTIYAVYNSARTSVSFLQATIKLTTGFNVVILTVFTILNS 60

Query: 61  XXLWKFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMK 120
             LWK S  +LFG L L+EYEH+ ERLPFT+IN VFMSSMF+E D FT  +      YMK
Sbjct: 61  AVLWKLSTAILFGNLSLLEYEHIFERLPFTIINTVFMSSMFHEQDFFTVTLFGLLLLYMK 120

Query: 121 VSNWILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXXXXXXXXX 180
           V +WIL+DRLE+LLQ++++STT+ +LI  T+F FNL+L +++DY +++ C          
Sbjct: 121 VFHWILKDRLEALLQSIHESTTLKSLI-CTRFSFNLVLLAILDYKIVSGC--ITNSLSNS 177

Query: 181 XXXXXXVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSS----LVSLDTHLTSEDEEDD 236
                 V+L++GMEF MLL+DL N+  H++LN YEFY++     L S+DT     DEE++
Sbjct: 178 FGASTSVHLMVGMEFAMLLIDLLNLAMHTVLNFYEFYRTQVDAHLSSVDTDTDGGDEENE 237

Query: 237 E-----SGFNGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQ 291
           +     S F GLEGKF+YE++ID FTRFLKT+IH ++LIPF M ++L KDV  D++TL Q
Sbjct: 238 DEDVNGSSFAGLEGKFMYERVIDVFTRFLKTLIHAIMLIPFRMSILLIKDVFWDVLTLCQ 297

Query: 292 NINTIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSIN-----------SIQK 340
            ++++W+IW NN++LDD+L T++  +L S  D ICI+CMD+L  +            + K
Sbjct: 298 IVSSLWRIWQNNKQLDDKLKTMSPVEL-SATDNICIVCMDELCADLEEVVQGPDREKVAK 356

Query: 341 NFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVLPTR 389
              K KPK LPCGH+LH+ CLKNWMERSQTCP+CRLPVF+E G V+ ++
Sbjct: 357 T-GKYKPKRLPCGHVLHLFCLKNWMERSQTCPICRLPVFDENGNVVQSQ 404

>TPHA0F02480 Chr6 (546818..548635) [1818 bp, 605 aa] {ON} Anc_6.45
           YOL013C
          Length = 605

 Score =  377 bits (967), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 199/409 (48%), Positives = 266/409 (65%), Gaps = 24/409 (5%)

Query: 6   SRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXXXXLWK 65
           +R  Q  L T  IY  T    Y AI SS S+LQVTIKLT+G                +WK
Sbjct: 7   TRKYQLALITFVIYTSTIFVTYLAIQSSSSYLQVTIKLTKGLNVIILVLFGLLNVAFIWK 66

Query: 66  FSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIX-XXXXXYMKVSNW 124
              YLLF  LRLIEYEH+LERLPFT+IN   +SSMFNE DI  +I        +MKV++W
Sbjct: 67  GLMYLLFSSLRLIEYEHILERLPFTIINFCLLSSMFNERDIIMSISSYGMILIFMKVAHW 126

Query: 125 ILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXXXXXXXXXXXXX 184
           +L+DRLESLLQ++ND+++I +LIFS +FF NL LF++IDY MM  C              
Sbjct: 127 VLKDRLESLLQSMNDNSSIRSLIFSNRFFLNLGLFAVIDYQMMMQCVTNSIKNSMGASTS 186

Query: 185 XXVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHLTSEDEE---DDESGFN 241
             ++LL+G+EFTMLLVDL N+  H+ LN+YEF+KS +   + ++  EDE+   DDE  FN
Sbjct: 187 --IHLLLGVEFTMLLVDLVNLFLHTCLNLYEFHKS-IEDRNLNIVGEDEDGLVDDEEEFN 243

Query: 242 GLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWKIWV 301
            LEGKF+YEK ID FTRFLKT++H+L+ IPF M ++L KDV+ D++TL Q+  ++WK W 
Sbjct: 244 ELEGKFMYEKAIDIFTRFLKTLLHLLMFIPFRMKIVLLKDVIWDVITLYQSTVSLWKTWR 303

Query: 302 NNRKLDDQLPTVTQHQLDSMEDKICIICMDDL---SINSIQKN--------------FEK 344
           N+++LD++LPTV+  +L S ++ +CI+CMD L     NS ++                 K
Sbjct: 304 NSKQLDEKLPTVSLEELKSSDNDMCIVCMDSLINIDFNSTEETENKEKEEQIYNAAIHSK 363

Query: 345 RKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVLPTRRERA 393
           +KPK LPC HILH+ CLKNWMERSQTCP+CRL VF+  G +LP    R+
Sbjct: 364 QKPKKLPCCHILHLGCLKNWMERSQTCPICRLSVFDSNGNILPFNNTRS 412

>Suva_15.159 Chr15 complement(274570..276222) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  354 bits (909), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/409 (49%), Positives = 262/409 (64%), Gaps = 26/409 (6%)

Query: 5   QSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXXXXLW 64
           ++R  Q V F +  Y+LTF  VY A  +S+SFLQVT+KL +G                LW
Sbjct: 4   ENRRKQLVAFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLW 63

Query: 65  KFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMKVSNW 124
           +    LLFGELRLIE+EH+ ERLPFT+IN +FMSSMF+E   FT         Y+KV +W
Sbjct: 64  QLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 125 ILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXXXXXXXXXXXXX 184
           I++DRLE+LLQ++NDSTT+  LIFS +F FNL L +L DY ++  C              
Sbjct: 124 IIKDRLEALLQSINDSTTLKTLIFS-RFSFNLALLALTDYQIITRCISSIYTNKNIDVVS 182

Query: 185 XXVYLLMGMEFTMLLVDLFNILCHSILNIYEFY--KSSLVSLDTHLTS---EDEEDDESG 239
             +YL+  MEFTMLL+DL N+   + LN +EFY  + S  + + H+     EDE + +SG
Sbjct: 183 TSLYLMQVMEFTMLLIDLLNLFLQTSLNFWEFYCSQQSQSNENNHIVQDEVEDENEVDSG 242

Query: 240 ----------------FNGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVV 283
                           F GLEGKF+YEK ID FTRFLKT +H+ +LIPF MP+ML KDVV
Sbjct: 243 EPHAELDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVV 302

Query: 284 IDLVTLSQNINTIWKIWVNNRKLDDQLPTVT--QHQLDSMEDKICIICMDDL--SINSIQ 339
            D++ L Q+  T+WKIW NN++LDD L TVT  Q Q  + ED ICIICMD+L  S N   
Sbjct: 303 WDVLALYQSATTLWKIWRNNKQLDDTLITVTIEQMQNSANEDNICIICMDELIHSANQQA 362

Query: 340 KNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVLPT 388
              + +KPK LPCGHILH++CLKNWMERSQTCP+CRLPVF+EKG V+ T
Sbjct: 363 WKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQT 411

>YOL013C Chr15 complement(301380..303035) [1656 bp, 551 aa] {ON}
           HRD1Ubiquitin-protein ligase; required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins; genetically linked to the unfolded protein
           response (UPR); regulated through association with
           Hrd3p; contains an H2 ring finger; likely plays a
           general role in targeting proteins that persistently
           associate with and potentially obstruct the ER-localized
           translocon
          Length = 551

 Score =  353 bits (905), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/411 (48%), Positives = 265/411 (64%), Gaps = 28/411 (6%)

Query: 5   QSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXXXXLW 64
           ++R  Q  +F +  Y+LTF  VY A  +S+SFLQVT+KL +G                LW
Sbjct: 4   ENRRKQLAIFVVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLW 63

Query: 65  KFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMKVSNW 124
           +    LLFGELRLIE+EH+ ERLPFT+IN +FMSS+F+E   FT         Y+KV +W
Sbjct: 64  QLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSLFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 125 ILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXXXXXXXXXXXXX 184
           IL+DRLE+LLQ++NDSTT+  LIFS +F FNL+L +++DY ++  C              
Sbjct: 124 ILKDRLEALLQSINDSTTMKTLIFS-RFSFNLVLLAVVDYQIITRCISSIYTNQKSDIES 182

Query: 185 XXVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKS--SLVSLDTHLTSEDEEDDES---- 238
             +YL+  MEFTMLL+DL N+   + LN +EFY+S  SL + + H+   D  D+ +    
Sbjct: 183 TSLYLIQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVESD 242

Query: 239 -----------------GFNGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKD 281
                             F GLEGKF+YEK ID FTRFLKT +H+ +LIPF MP+ML KD
Sbjct: 243 QSQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKD 302

Query: 282 VVIDLVTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLD--SMEDKICIICMDDLSINSIQ 339
           VV D++ L Q+  ++WKIW NN++LDD L TVT  QL   + +D ICIICMD+L  +  Q
Sbjct: 303 VVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHSPNQ 362

Query: 340 KNF--EKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVLPT 388
           + +  + +KPK LPCGHILH++CLKNWMERSQTCP+CRLPVF+EKG V+ T
Sbjct: 363 QTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEKGNVVQT 413

>Kpol_1035.50 s1035 (124427..126232) [1806 bp, 601 aa] {ON}
           (124427..126232) [1806 nt, 602 aa]
          Length = 601

 Score =  352 bits (902), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 191/386 (49%), Positives = 264/386 (68%), Gaps = 21/386 (5%)

Query: 22  TFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXXXXLWKFSNYLLFGELRLIEYE 81
           TF S+YFA+ SS S+LQVTIKL+QG                +W+F  +L FG LRLIEYE
Sbjct: 24  TFLSIYFAVLSSTSYLQVTIKLSQGFNAIVLVLFAILNGTYVWRFFIWLAFGNLRLIEYE 83

Query: 82  HVLERLPFTVINMVFMSSMFNEHDI-FTTIIXXXXXXYMKVSNWILRDRLESLLQTVNDS 140
           HV+ERLPFT++NMV   SMFN+  I FT  I      +MKV +WILRDRL++++Q+ NDS
Sbjct: 84  HVMERLPFTILNMVITYSMFNDKSIAFTGSIFGFFLIFMKVLHWILRDRLDAIVQSFNDS 143

Query: 141 TTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXXXXXXXXXXXXXXXVYLLMGMEFTMLLV 200
           +T+ ++I S  FF NLI+F+++DY M+++C                V+LL+GMEFTMLL+
Sbjct: 144 STLTSIILSNNFFLNLIIFTIVDYKMVSYCVSNSLSNSMGASTT--VHLLLGMEFTMLLI 201

Query: 201 DLFNILCHSILNIYEFYKSSLVSLDTHLTSEDEEDDES---GFNGLEGKFIYEKIIDTFT 257
           DL N+  H+ LN+YEF+ ++L      +  + E+D+E     FN LEGKF+YEK ID FT
Sbjct: 202 DLLNLFLHTCLNLYEFHLTTLERSSNIIQEDGEDDEEDDELQFNSLEGKFMYEKTIDVFT 261

Query: 258 RFLKTIIHILLLIPFAMPV-MLSKDVVIDLVTLSQNINTIWKIWVNNRKLDDQLPTVTQH 316
           RFLKT IHIL+LIP  M   +L KDV+ ++++L ++  ++WK W NN++LDD+LPT +  
Sbjct: 262 RFLKTFIHILMLIPLRMKFFLLLKDVIWNVISLYKHTGSLWKTWKNNKQLDDKLPTASIE 321

Query: 317 QLDSMEDKICIICMDDL--SINSIQKNFE------------KRKPKMLPCGHILHMNCLK 362
           +L + ++ ICI+CMDDL   INS + + +            K+KPK LPCGHILH+NCLK
Sbjct: 322 ELKNTDNNICIVCMDDLLPRINSEKYDSQREKELYDHIMKSKQKPKKLPCGHILHLNCLK 381

Query: 363 NWMERSQTCPMCRLPVFNEKGEVLPT 388
           NWMERSQTCP+CRLPVF++KG V+P+
Sbjct: 382 NWMERSQTCPICRLPVFDDKGNVMPS 407

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 2/34 (5%)

Query: 412 WVSFPIETIDDSTITFNL--ANDDGRILKSRLLI 443
           W SFPI+T  DS+ITF++  A+D  ++  ++L +
Sbjct: 509 WYSFPIKTSSDSSITFDISDAHDPAKVYPAKLSV 542

>Smik_15.157 Chr15 complement(268666..270318) [1653 bp, 550 aa] {ON}
           YOL013C (REAL)
          Length = 550

 Score =  349 bits (895), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 199/410 (48%), Positives = 261/410 (63%), Gaps = 27/410 (6%)

Query: 5   QSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXXXXLW 64
           ++R  Q V+F +  Y+LTF  VY A  +S+SFLQVT+KL +G                LW
Sbjct: 4   ENRRKQLVVFIVITYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFVLLNSTLLW 63

Query: 65  KFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMKVSNW 124
                LLFGELRLIE+EH+ ERLPFT+IN +FMSSMF+E   FT         Y+KV +W
Sbjct: 64  HLLTRLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 125 ILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXXXXXXXXXXXXX 184
           IL+DRLE+LLQ++NDSTT+  LIFS +F  NL+L + +DY ++  C              
Sbjct: 124 ILKDRLEALLQSINDSTTMKTLIFS-RFSLNLVLLAALDYQIIVHCISSIYTNQKIDIVS 182

Query: 185 XXVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLD--THLTSEDEED----DES 238
             +YL+  MEFTMLL+DL N+   + LN +EFY+S     D   H+  +D  D    D  
Sbjct: 183 TSLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSDDGNHIVHDDLSDGNRVDFD 242

Query: 239 G----------------FNGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDV 282
           G                F GLEGKF+YEK ID FTRFLKT +H+ +LIPF MP+ML KDV
Sbjct: 243 GSQHALNDDGDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDV 302

Query: 283 VIDLVTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLD--SMEDKICIICMDDLSINSIQK 340
           + D++ L Q+   +WKIW NN++LDD L TVT  QL   + ED ICIICMD+L  ++ Q+
Sbjct: 303 IWDILALYQSATGLWKIWRNNKQLDDSLLTVTVEQLQNSANEDNICIICMDELIHSTNQQ 362

Query: 341 NF--EKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVLPT 388
            +  + +KPK LPCGHILH++CLKNWMERSQTCP+CRLPVF++KG V+ T
Sbjct: 363 TWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDDKGNVVQT 412

>Skud_15.148 Chr15 complement(260982..262628) [1647 bp, 548 aa] {ON}
           YOL013C (REAL)
          Length = 548

 Score =  344 bits (883), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 194/404 (48%), Positives = 261/404 (64%), Gaps = 23/404 (5%)

Query: 5   QSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXXXXLW 64
           ++R  Q ++F +  Y+LTF  VY A  +S+SFLQVT+KL +G                LW
Sbjct: 4   ENRRKQLIVFIVVTYLLTFYCVYSATKTSVSFLQVTLKLNEGFNLMVLSIFILLNSTLLW 63

Query: 65  KFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMKVSNW 124
           +    LLFGELRLIE+EH+ ERLPFT+IN +FMSSMF+E   FT         Y+KV +W
Sbjct: 64  QLLTKLLFGELRLIEHEHIFERLPFTIINTLFMSSMFHERYFFTVAFFGLLLLYLKVFHW 123

Query: 125 ILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXXXXXXXXXXXXX 184
           IL+DRLE+LLQ++NDSTT+ NLI S +F FNL+L +++D+ ++  C              
Sbjct: 124 ILKDRLEALLQSINDSTTMKNLILS-RFSFNLVLLAVVDFQILIRCISSIYTNQNIDIIS 182

Query: 185 XXVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKS--SLVSLDTHLTSEDEEDD------ 236
             +YL+  MEFTMLL+DL N+   + LN +EFY+S  S  +   H+  +D  +       
Sbjct: 183 TSLYLMQVMEFTMLLIDLLNLFLQTCLNFWEFYRSQQSQSNESNHIVHDDTPNGVGFEEA 242

Query: 237 ----------ESGFNGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDL 286
                     +  F GLEGKF+YEK ID FTRFLKT +H+ +LIPF MP+ML KDVV D+
Sbjct: 243 HAVLNDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPLMLLKDVVWDV 302

Query: 287 VTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLD--SMEDKICIICMDDLSINSIQKNF-- 342
           + L Q+  ++WKIW NN++LDD L TVT  QL   + ED ICIICMD+L  +   + +  
Sbjct: 303 LALYQSGTSLWKIWRNNKQLDDALITVTAEQLQNSANEDNICIICMDELMHSQADQTWKN 362

Query: 343 EKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVL 386
           + +KPK LPCGHILH++CLKNWMERSQTCP+CRL VF+EKG V+
Sbjct: 363 KNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLSVFDEKGNVV 406

>SAKL0E01958g Chr5 (149087..150661) [1575 bp, 524 aa] {ON} similar
           to uniprot|Q08109 Saccharomyces cerevisiae YOL013C HRD1
           Ubiquitin-protein ligase required for endoplasmic
           reticulum-associated degradation (ERAD) of misfolded
           proteins genetically linked to the unfolded protein
           response (UPR) regulated through association with Hrd3p
           contains an H2 ring finger
          Length = 524

 Score =  343 bits (879), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 178/385 (46%), Positives = 249/385 (64%), Gaps = 15/385 (3%)

Query: 1   MPFYQSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXX 60
           MP  Q+R  QF+++++F Y     SVY ++SSS++FLQ TIKL +G              
Sbjct: 1   MPVSQNRRGQFIVYSVFTYSAAIWSVYDSLSSSVTFLQTTIKLCEGVNLIILGNFCLLNG 60

Query: 61  XXLWKFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMK 120
             LWK    LLFGELRLIEYEHV ERL FT++N +F+SSMF E D  T ++      ++K
Sbjct: 61  VLLWKLLTRLLFGELRLIEYEHVFERLSFTIVNSIFVSSMFKEQDFLTVLVFTAVLIFLK 120

Query: 121 VSNWILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXXXXXXXXX 180
           V +WIL+DRLE + Q  N++T +  ++FS +F FNL+  + +DY M+ +C          
Sbjct: 121 VFHWILKDRLEFVFQNANENTNLKKMLFS-RFNFNLLFLASVDYQMVRYC--LSNSISND 177

Query: 181 XXXXXXVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHLTSEDEEDDESGF 240
                 VYL+ G++F MLLVD  +I  H ++N  E Y+     L +H +  DEE     F
Sbjct: 178 QWTSSSVYLMFGIDFAMLLVDTLSIGLHGVVNFVEVYR-----LQSHNSHYDEE-----F 227

Query: 241 NGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWKIW 300
            GLEGKF+YEK+ID   R LK ++HI LLIPF MP+M+ KD++ D ++L Q   ++WK W
Sbjct: 228 LGLEGKFMYEKLIDMGARLLKMLLHIALLIPFRMPIMIIKDIIWDAISLYQTATSLWKTW 287

Query: 301 VNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNC 360
            N +KLD++LP VT+ +L+   + +CI+CMDD+  NS  +N    KPK LPCGHILH++C
Sbjct: 288 KNAKKLDEKLPDVTEEELNQ-GNNMCIVCMDDMLPNSETRN-ANLKPKKLPCGHILHLSC 345

Query: 361 LKNWMERSQTCPMCRLPVFNEKGEV 385
           LK+WMERSQTCP+CRLPVF+E+G V
Sbjct: 346 LKSWMERSQTCPICRLPVFDERGNV 370

>KAFR0A05240 Chr1 (1036153..1037814) [1662 bp, 553 aa] {ON} Anc_6.45
           YOL013C
          Length = 553

 Score =  330 bits (847), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 184/428 (42%), Positives = 266/428 (62%), Gaps = 49/428 (11%)

Query: 5   QSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXXXXLW 64
           QSR  Q V+F++ IY+LT  +++ +  SS +FLQ TIKLTQG                LW
Sbjct: 4   QSRKQQLVIFSMIIYLLTIITIFTSYKSSKTFLQCTIKLTQGINVLILAIFTALNLFLLW 63

Query: 65  KFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMKVSNW 124
           +F  ++LFGELRLIE+EH+ ERLPFT+IN++FM S+FNE+  F  ++       +KV +W
Sbjct: 64  EFLRWILFGELRLIEHEHIFERLPFTIINVLFMISIFNEYQFFNALVFALILSVLKVFHW 123

Query: 125 ILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXX----------- 173
           IL+DRLESLLQ++ND+T + NLIFS ++  NL +FS++D+ + +                
Sbjct: 124 ILKDRLESLLQSINDATDLKNLIFS-RYMLNLAIFSVLDFWICSNTYRAFRGYDNNNSTN 182

Query: 174 ----------XXXXXXXXXXXXXVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVS 223
                                  ++LL GMEF +L +DL N+  H++LN YEFY S   +
Sbjct: 183 NNQNADSSNLMNKNNLTPTNKKALFLLFGMEFFVLFLDLINLAMHTVLNFYEFYCSQRAT 242

Query: 224 LDTHLTSEDEEDDE---------SGFNGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAM 274
              ++ +  +E+ E         + FNGLEGKF+YEK+ID  T+F KTI+HI +LI   +
Sbjct: 243 AHHNVNAGTDEESEEEADGDDDDANFNGLEGKFMYEKLIDVSTKFFKTIVHIFVLIQTKL 302

Query: 275 PVMLSKDVVIDLVTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDL- 333
            +M+ KDVV D +TL Q+  ++WKI+ NN++LDD+LPT++ + +++  D ICI+CMDDL 
Sbjct: 303 QIMVLKDVVWDCLTLYQDSISLWKIYKNNKQLDDKLPTLSVNDVENDNDNICIVCMDDLV 362

Query: 334 --------------SINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVF 379
                          I+SI K+   ++PK LPCGH+LH++CLKNWMERSQTCP+CRLPVF
Sbjct: 363 PSLHGKEAVEMTQADIDSISKS---KRPKKLPCGHMLHLSCLKNWMERSQTCPICRLPVF 419

Query: 380 NEKGEVLP 387
           +E G V P
Sbjct: 420 DENGNVKP 427

>NCAS0D02010 Chr4 complement(371205..372737) [1533 bp, 510 aa] {ON}
           Anc_6.45 YOL013C
          Length = 510

 Score =  307 bits (786), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 175/418 (41%), Positives = 248/418 (59%), Gaps = 39/418 (9%)

Query: 5   QSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXXXXLW 64
           Q+R +Q + FT  IYVLT + +  +   S SFL +++KL QG                LW
Sbjct: 3   QTRRSQLIAFTAIIYVLTISCIINSAIKSTSFLHLSLKLNQGFNVMIITIFILLNALLLW 62

Query: 65  KFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMKVSNW 124
           KF N+LLF ELRLIE EH++ERLPFT+IN +F+S+MFNE    T         YMK+  W
Sbjct: 63  KFLNFLLFKELRLIEQEHIMERLPFTIINFIFISTMFNEKFFITMAFYGFILLYMKIFYW 122

Query: 125 ILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLID------------------YL- 165
           IL+DRLE L+Q+ N + ++   IFS +F+ NLI+ S I+                  YL 
Sbjct: 123 ILKDRLEFLIQS-NTNYSVSRFIFS-KFYLNLIILSTINLQLIKTCIPLNYEFLKKLYLN 180

Query: 166 -------MMNFCXXXXXXXXXXXXXXXXVYLLMGMEFTMLLVDLFNILCHSILNIYEFYK 218
                  ++N+                 +YL++ MEF +LL++  N+  HSIL++YE YK
Sbjct: 181 STSILQSLINYSSPSSTHASNFNLGVNPIYLMLAMEFAILLINFINLFLHSILSLYEIYK 240

Query: 219 SS------LVSLDTHLTSEDEEDDESGFNGLEGKFIYEKIIDTFTRFLKTIIHILLLIPF 272
           S+       +  D    ++D++D  + FNGLE KFIYEKIID FTR L T+IHI L +P 
Sbjct: 241 SNQYDQLNAIIEDIEDENDDDDDTPADFNGLENKFIYEKIIDLFTRSLMTMIHISLALPL 300

Query: 273 AMPVMLSKDVVIDLVTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDD 332
            +P+++ KD++ DL++L QN   +++I  NN+ LD +LP +    L    D +CI+CMDD
Sbjct: 301 NLPMIVLKDIIWDLISLYQNCKILFQILKNNKNLDSKLPDMIPEDLQD-SDNVCIVCMDD 359

Query: 333 LSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVLPTRR 390
           L    + +  +K+K K LPCGH LH++CLKNWMERSQTCP+CRLPVF+E G V  + R
Sbjct: 360 L----LSEEHKKKKAKRLPCGHFLHLSCLKNWMERSQTCPICRLPVFDESGNVKESER 413

>CAGL0E02299g Chr5 complement(219246..220883) [1638 bp, 545 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013c HRD1
          Length = 545

 Score =  306 bits (783), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 171/404 (42%), Positives = 246/404 (60%), Gaps = 28/404 (6%)

Query: 10  QFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXXXXLWKFSNY 69
           +F++FT   YVLT   V  A  SS+SFLQ+ +KL++G                LW+F   
Sbjct: 9   EFLIFTAITYVLTIYCVISACQSSVSFLQIALKLSEGFNILIITVFTLLNSTLLWQFLTS 68

Query: 70  LLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMKVSNWILRDR 129
           +LFGELR+IE+EH+ ERLPF VIN +FM S FNE   FT         YMKV +WILRDR
Sbjct: 69  MLFGELRIIEHEHIFERLPFAVINTIFMFSTFNEKYFFTLATCALVLLYMKVFHWILRDR 128

Query: 130 LESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXXXXXXXXX--------- 180
           L+ LLQ +N+ T   +L+ + ++  NL+L  +ID  +++FC                   
Sbjct: 129 LDLLLQGINEDTRWKDLLVN-RYICNLLLLVVIDSYVISFCVSTAYNIASSIFTAGTNSI 187

Query: 181 -------XXXXXXVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLD----THLT 229
                        +Y++  MEFT L++DL N++ ++ L  YEF+ S   S +      ++
Sbjct: 188 VLGGGSPLTQRALIYIMQAMEFTNLMIDLVNLILNTGLQFYEFHLSRKFSQNNPTFNSIS 247

Query: 230 SED----EEDDESGFNGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVID 285
           +ED     ED +S FNGLEGKF+YEK+ID  TRFL+T++H+++ +   +P+ML KD+ +D
Sbjct: 248 AEDADTESEDGDSQFNGLEGKFMYEKLIDVVTRFLQTLVHVVMAMVLNLPLMLVKDIFVD 307

Query: 286 LVTLSQNINTIWKIWVNNRKLDDQLPTVTQHQL--DSMEDKICIICMDDL-SINSIQKNF 342
           +  L  N  ++  IW N+++LD +LPT+T   L  D   D +CI+CMD+L S N      
Sbjct: 308 VWVLYMNSKSLLAIWKNSKQLDTKLPTMTSDDLNNDPNFDNVCIVCMDELVSENPHHHQS 367

Query: 343 EKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVL 386
           + +KPK LPCGH+LH++CLKNWMERSQTCP+CRLPVF+E GE+L
Sbjct: 368 DGKKPKKLPCGHVLHLSCLKNWMERSQTCPICRLPVFDENGEIL 411

>KNAG0E02740 Chr5 complement(544981..546651) [1671 bp, 556 aa] {ON}
           Anc_6.45 YOL013C
          Length = 556

 Score =  305 bits (782), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 177/434 (40%), Positives = 247/434 (56%), Gaps = 54/434 (12%)

Query: 5   QSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXXXXLW 64
           +SR  QF L  + IY+LT  +V  A  +S +FL+ T  LTQG                LW
Sbjct: 7   RSRKQQFALLVVVIYLLTAFTVINAFGNSHTFLEWTTGLTQGVNYVIIAAFSLLNIVLLW 66

Query: 65  KFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMKVSNW 124
           K   Y++FG+LRLIE EH+ ER+P TVIN++ +SS+ ++  +F  ++       +KVS+W
Sbjct: 67  KGFTYMVFGDLRLIEEEHIFERIPLTVINLIMISSLLSDKYMFDIVLLGGLLLVLKVSHW 126

Query: 125 ILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXXXXXXXXXXXXX 184
           ILRDRLE  LQ +ND+TT+ +L+FS +F  NL++F ++DY +   C              
Sbjct: 127 ILRDRLEGFLQRINDTTTLTSLLFS-KFSRNLLIFGILDYFVTKICFFNHFGNFYHHGDF 185

Query: 185 XXVYLLM-GMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHLT------SEDEEDDE 237
             +  +M G+E+ ++ +DL NILCH++LN Y F+++ L S   +L       SEDE D  
Sbjct: 186 SNITQIMFGLEYAVVFIDLINILCHTVLNFYAFHRTQLQSARFNLEMMNDDFSEDEND-- 243

Query: 238 SGFN---GLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNIN 294
           SG N   GLEGKFIYEK+ID     L+T +H  +LIP     ML KD V DL  L  N N
Sbjct: 244 SGVNADGGLEGKFIYEKLIDFVAGVLRTGLHFTMLIPLRFQSMLVKDFVWDLFNLVNNGN 303

Query: 295 TIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSI--------NSIQ------K 340
           ++WKI+ NNR+L+ +LP +    L    D +CI+CMDDL +         S+Q      K
Sbjct: 304 SLWKIYKNNRQLNKKLPNIAIEDLLD-HDNMCIVCMDDLVLVHHPTKRRQSVQEECDDEK 362

Query: 341 NFEK--------------------------RKPKMLPCGHILHMNCLKNWMERSQTCPMC 374
           N EK                          +KPK LPCGH+LH +CLKNWMERSQTCP+C
Sbjct: 363 NTEKDKPSTTEEDLSEVEPTQGDIDRMADSKKPKKLPCGHMLHFSCLKNWMERSQTCPIC 422

Query: 375 RLPVFNEKGEVLPT 388
           R+PVF++ G V P+
Sbjct: 423 RVPVFDKDGNVRPS 436

>KLTH0C10604g Chr3 complement(878953..880500) [1548 bp, 515 aa] {ON}
           similar to uniprot|Q08109 Saccharomyces cerevisiae
           YOL013C HRD1 Ubiquitin-protein ligase required for
           endoplasmic reticulum-associated degradation (ERAD) of
           misfolded proteins genetically linked to the unfolded
           protein response (UPR) regulated through association
           with Hrd3p contains an H2 ring finger
          Length = 515

 Score =  302 bits (774), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 151/381 (39%), Positives = 227/381 (59%), Gaps = 13/381 (3%)

Query: 10  QFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXXXXLWKFSNY 69
           QFV +T+F Y     SV   +  S+SFL   +KL +G                LWK    
Sbjct: 9   QFVGYTVFTYTAAAWSVLDCLQPSLSFLDACLKLCEGLNLVVLCNFAIVNSILLWKGLTR 68

Query: 70  LLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMKVSNWILRDR 129
           LLFGELRL+EYEH+ ERL FT++N  FMSS F E+   T +I      +++V +W+L+DR
Sbjct: 69  LLFGELRLLEYEHIFERLSFTIVNCFFMSSAFPEYQFLTVMILFALLTFIRVFHWVLKDR 128

Query: 130 LESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXXXXXXXXXXXXXXXVYL 189
           LE + Q  ++ T I  L+ S +FF N+I+F+++DY M+ FC                VY+
Sbjct: 129 LEYVFQHTDERTNIARLLCS-RFFLNVIIFAVVDYQMVRFCLRNSLTNKHDPSPSAPVYI 187

Query: 190 LMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHLTSEDEEDDESGFNGLEGKFIY 249
           L  ++F+MLLVD+  +   S++N+ E  +               E D   F GL+GKF+Y
Sbjct: 188 LFCVDFSMLLVDVAEVAMKSVINLIELIQCKRAF----------ERDGDDFVGLDGKFMY 237

Query: 250 EKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWKIWVNNRKLDDQ 309
           EK++    + LK  + +  L PF+MP+M++KD++ D + L     ++W+ W +NR++D++
Sbjct: 238 EKLVQLVCQVLKLGLRVASLAPFSMPLMIAKDIIWDGIALFHTGKSVWRTWKSNRQIDEK 297

Query: 310 LPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQ 369
           LP VT+ QL++ EDK+CI+CM+D+ +   +    K KPK LPC H LH+ CLK+WMERSQ
Sbjct: 298 LPDVTEAQLNASEDKMCIVCMEDM-LPPSEATSAKHKPKKLPCNHCLHLGCLKSWMERSQ 356

Query: 370 TCPMCRLPVFNEKGEV-LPTR 389
           TCP+CR+ VF+ KG V LP +
Sbjct: 357 TCPICRVSVFDSKGNVALPNQ 377

>NDAI0C02770 Chr3 (640635..642527) [1893 bp, 630 aa] {ON} Anc_6.45
           YOL013C
          Length = 630

 Score =  303 bits (775), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 180/452 (39%), Positives = 251/452 (55%), Gaps = 73/452 (16%)

Query: 5   QSRTAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXXXXLW 64
            S+  QFV+F++ +Y++TF ++  A +SS SFL + +KL +G                 W
Sbjct: 9   NSKKFQFVIFSISVYLITFFTIINAANSSTSFLHLCLKLNEGFNIMIITIFILLNSLLSW 68

Query: 65  KFSNYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMKVSNW 124
           K   + LF +LRLIE EH++ERLPFTVIN + M++MFNE   FT  I       ++V +W
Sbjct: 69  KLITWFLFNDLRLIEQEHIMERLPFTVINFIVMATMFNERFFFTLTIYGLLLISLRVYHW 128

Query: 125 ILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXX------------ 172
           IL+DRLE ++QT+NDST++  +IFS +F FNLI  SLI+  ++  C              
Sbjct: 129 ILKDRLEFIIQTINDSTSMTKIIFS-KFSFNLISLSLINLKLIQNCLTWDDINFWKNNQN 187

Query: 173 --------------XXXXXXXXXXXXXXVYLLMGMEFTMLLVDLFNILCHSILNIYEFYK 218
                                       VYL++GMEF++LL++ FN+L HS+L+++EFYK
Sbjct: 188 LFNSIMNYLINPISSTTISNGINNHSNPVYLMLGMEFSILLLEYFNVLFHSLLSLFEFYK 247

Query: 219 SSLVSLD------------THLTSEDEEDDESG---------------FNGLEGKFIYEK 251
           S   S+                T  DE +   G               FNGLEGKFIYEK
Sbjct: 248 SKQFSIQQQQIRQNNLINRAQTTQNDENEINIGLDIDIDDDEEDDDETFNGLEGKFIYEK 307

Query: 252 IIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWKIWVNNRKLDDQLP 311
           IID FTRFL TIIH+ LL+P  +P++L KD++ D  +L +N  +++KIW NN+KL+  LP
Sbjct: 308 IIDLFTRFLMTIIHVSLLLPLNIPMILVKDILWDFFSLYRNAMSLYKIWKNNQKLESALP 367

Query: 312 TVTQHQLDSMEDKICIICMDDL--SINSIQK--NFEKRKPK--------------MLPCG 353
            +T   L    D +CIICMDDL  S+ +++   N     P                LPCG
Sbjct: 368 NMTPDDLQH-SDNVCIICMDDLLPSLETLEHATNVSSTTPSSNHYLNIKKKKKPKKLPCG 426

Query: 354 HILHMNCLKNWMERSQTCPMCRLPVFNEKGEV 385
           H LH +CLKNWMERSQTCP+CRL VF++ G V
Sbjct: 427 HFLHFSCLKNWMERSQTCPICRLDVFDKNGNV 458

>Kwal_56.22522 s56 (166498..168039) [1542 bp, 513 aa] {ON} YOL013C
           (HRD1) - required to degrade misfolded ER lumenal and
           integral membrane proteins [contig 185] FULL
          Length = 513

 Score =  290 bits (743), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 145/381 (38%), Positives = 224/381 (58%), Gaps = 14/381 (3%)

Query: 10  QFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXXXXLWKFSNY 69
           QF  +    Y     ++   +  S+SFL+++ +L +G                LWK   +
Sbjct: 9   QFAAYVFASYAAAAWAIIGTVQESLSFLELSARLCEGLNLILLCNFAAVNGVLLWKALTH 68

Query: 70  LLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMKVSNWILRDR 129
           LLFGELRL+EYEH+ ERL FT++N  FMSS F+E +  + +       ++KV +W+LRDR
Sbjct: 69  LLFGELRLLEYEHIFERLSFTIVNCFFMSSAFSESEFMSVMAFSAALIFVKVFHWVLRDR 128

Query: 130 LESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXXXX--XXXXXXXXXXXV 187
           LE + Q  ++ T    L+ S +FFFN+ L   +D+ M  FC                  V
Sbjct: 129 LEHVFQHTDEHTNFARLLLS-RFFFNIFLLGFLDFQMTKFCIQGTRFFSRSGFYSSSLSV 187

Query: 188 YLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHLTSEDEEDDESGFNGLEGKF 247
           +L+  +EF MLLVD+  +   SI+N+ E Y+           + D ED    + GLEGKF
Sbjct: 188 HLMFAVEFAMLLVDVTEVAMKSIINLVEVYQCK------RSFARDGED----YTGLEGKF 237

Query: 248 IYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWKIWVNNRKLD 307
           +YEK++    +  +  +HI+L++PF+MP+M++KD++ D   +     ++   W +NR++D
Sbjct: 238 MYEKVVQLICQLTRMGLHIMLMMPFSMPLMIAKDILWDAFAVFHTAKSLLLTWKSNRQID 297

Query: 308 DQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMER 367
           ++LP V++ QL + +DK+CI+CMDD+   S   N  K+KPK LPC H LH+ CLK+WMER
Sbjct: 298 EKLPDVSEAQLAASDDKMCIVCMDDMLAPSECTN-AKQKPKRLPCNHCLHLGCLKSWMER 356

Query: 368 SQTCPMCRLPVFNEKGEVLPT 388
           SQTCP+CR+PVF++KG V+ T
Sbjct: 357 SQTCPICRVPVFDKKGNVVVT 377

>KLLA0C05874g Chr3 complement(520079..521740) [1662 bp, 553 aa] {ON}
           weakly similar to uniprot|Q08109 Saccharomyces
           cerevisiae YOL013C HRD1 Ubiquitin-protein ligase
           required for endoplasmic reticulum-associated
           degradation (ERAD) of misfolded proteins genetically
           linked to the unfolded protein response (UPR) regulated
           through association with Hrd3p contains an H2 ring
           finger
          Length = 553

 Score =  197 bits (502), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 124/401 (30%), Positives = 203/401 (50%), Gaps = 31/401 (7%)

Query: 8   TAQFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXXXXLWKFS 67
           T +F+ ++L  Y     S+++ +++S S+L    K+T+G                + K  
Sbjct: 23  TQKFIAYSLMSYTAAAWSLHYCVTTSFSYLHAMTKITEGIHAMIWGNLFLLNSVLILKGV 82

Query: 68  NYLLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMKVSNWILR 127
            ++LFG+LRLIEYEH+LER+ +TVI ++   S  N   I    I        +  +WIL+
Sbjct: 83  IHMLFGQLRLIEYEHILERISYTVITLLLSCSSMNGL-ISVMQIHCVLFVCCRTLHWILK 141

Query: 128 DRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXXXXXXXXXXXXXXXV 187
           DR+E   Q  ND       I  ++F FNL++ + +D +++ +                  
Sbjct: 142 DRMEVTFQ-ANDMRLTLKDILLSRFMFNLLVLTAVDGIIVAY---YVNKILYKSNIDVTY 197

Query: 188 YLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHLTSEDEEDDESGFN------ 241
            L +  ++ +L  DL  ++  + LN++E   S++ +      + D   DE   N      
Sbjct: 198 TLFIISQYAILGTDLLQVILRTGLNLFEL--STIQNRARIRRNADHHVDEPVINHEERPN 255

Query: 242 ---------------GLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDL 286
                          GLEGKFIYEK+ID F   +K II       F+   ++   V+ + 
Sbjct: 256 AVAIEEDEDEDEENAGLEGKFIYEKLIDVFISTVKVIIK--FASSFSTGRVMMVTVLWEA 313

Query: 287 VTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRK 346
           +T  ++   +WK W +++ LD  L   T  Q++S E  ICI+CM+D  + S Q+  + +K
Sbjct: 314 ITTFKSARGLWKNWKSSKSLDASLMDATDIQIESGEIDICIVCMEDF-LPSHQRKSDGKK 372

Query: 347 PKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVLP 387
            K+LPC H LH++CLKNW+ RS TCP+CRLP+F+E G V+P
Sbjct: 373 VKILPCTHALHLSCLKNWIARSPTCPICRLPIFDENGNVMP 413

>ACL019C Chr3 complement(328044..329771) [1728 bp, 575 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL013C
           (HRD1)
          Length = 575

 Score =  173 bits (438), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 104/340 (30%), Positives = 181/340 (53%), Gaps = 40/340 (11%)

Query: 70  LLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMK--------- 120
           +LFG+L  IEY+H+ ERL   ++ +              +I+      YM          
Sbjct: 69  VLFGQLTAIEYDHIFERLHVVLVTLA-------------SIVITMRKTYMAGHMTILFYT 115

Query: 121 ---VSNWILRDRLESLLQTVNDSTTIFNLIFSTQFFFNLILFSLIDYLMMNFCXXXXXXX 177
              V++W+LRDR++ + Q     +++  ++ S +F F+L++  ++DY M+ FC       
Sbjct: 116 LCLVAHWVLRDRMDFVFQVHGTDSSLLGILCS-RFMFSLLVLGMVDYKMLKFCVQNTNVD 174

Query: 178 XXXXXXXXXVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHLTSEDEEDDE 237
                    +YL++ + F  L++D+ +++  + LN++E  +S   +   +L  E    D+
Sbjct: 175 GKRHE----LYLMLALSFAQLILDVLHVVLLTSLNLFEMVRSRR-TRSANLVYEGGTTDD 229

Query: 238 SGFNG---LEGKFIYEKIIDTFTRFLKTIIHIL--LLIPFAMPVMLSKDVVIDLVTLSQN 292
              +    LEGK+IYE + D     LK I+ I+  + +P+++ V+ S  + +  +   ++
Sbjct: 230 DADDEVFILEGKYIYETVFDLTITVLKVILDIIQEVFVPWSITVVYS--IFVRSIKAGES 287

Query: 293 INTIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPC 352
              ++  W NN+KL ++L  V++ QLD   D +CIICMDD+ + + +     R+ KMLPC
Sbjct: 288 FLLVYNYWKNNKKLYEKLSDVSEEQLDDT-DSMCIICMDDM-LPTTETTKMNRRAKMLPC 345

Query: 353 GHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVLPTRRER 392
           GH+LH  CLK+WMERSQTCP+CRL VF        T + R
Sbjct: 346 GHMLHFGCLKSWMERSQTCPICRLSVFANDSNSHATTQAR 385

>Ecym_3048 Chr3 (91031..93043) [2013 bp, 670 aa] {ON} similar to
           Ashbya gossypii ACL019C
          Length = 670

 Score =  168 bits (426), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 115/386 (29%), Positives = 190/386 (49%), Gaps = 21/386 (5%)

Query: 10  QFVLFTLFIYVLTFASVYFAISSSISFLQVTIKLTQGXXXXXXXXXXXXXXXXLWKFSNY 69
           QF+  T   Y L   S+Y   S+S+SFLQ   K T G                       
Sbjct: 12  QFIAVT---YALAAWSLYNCTSTSLSFLQAMYKATYGVHLIIWGNFLLVHYFIGGWLVVR 68

Query: 70  LLFGELRLIEYEHVLERLPFTVINMVFMSSMFNEHDIFTTIIXXXXXXYMKVSNWILRDR 129
           +LFG L L+EYEH+ ERL  TV++ + +    +  +    +I        +V +W++RDR
Sbjct: 69  MLFGRLTLLEYEHIFERLHLTVLSSLSVLITMDRKNSKIGVIAIPFHVLCQVLHWVVRDR 128

Query: 130 LESLLQT-VNDSTTIFNLIFSTQFFFNLILFSLIDY-LMMNFCXXXXXXXX--------- 178
           +E +    +     + +L+FS +F  ++++  ++D+ LMM F                  
Sbjct: 129 MEFVFAPPIGTRMAMKDLLFS-RFMLSIVVLGVVDFKLMMYFYRQHQAEQGYLYYLLFSD 187

Query: 179 -XXXXXXXXVYLLMGMEFTMLLVDLFNILCHSILNIYEFYKSSLVSLDTHLTSEDEEDDE 237
                    + L +G++F +L +D   ++  + L   E +K+     +  L   +E +++
Sbjct: 188 NGQNTSEDRLSLSLGVDFGLLFLDWLQVVLLNCLKFVELFKAGRRVQEHQLLDNNELEND 247

Query: 238 SGFNG---LEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNIN 294
              +G   LE KFIYEKI++T    LK +++I L+       ++  ++ I  +   +   
Sbjct: 248 IEDDGAFILEEKFIYEKIVETVLEILKILLNIFLITSGIHSFVVFYNIFIKSIETCERCV 307

Query: 295 TIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGH 354
            ++  W NNR+L ++L  VT   LD + D  C ICMDD+ + S       +K KMLPCGH
Sbjct: 308 LLFNYWKNNRRLHEKLLDVTAGHLDGV-DITCTICMDDM-LPSKDVKVNNKKAKMLPCGH 365

Query: 355 ILHMNCLKNWMERSQTCPMCRLPVFN 380
           +LH  CLK+WM+R+QTCP+CR PVF 
Sbjct: 366 MLHFGCLKSWMQRAQTCPICRFPVFG 391

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 65/136 (47%), Gaps = 8/136 (5%)

Query: 247 FIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWKIWVNNRKL 306
           F Y   I    R  + ++ + L + F + +M S+D++     L Q+  +I + ++  + +
Sbjct: 627 FTYSSNIFRHHRDPRFVVFLSLWLLFQLSIMYSQDILGARWFLPQH--SIPEGYIYFKPV 684

Query: 307 DDQLPTVTQHQLDSMEDKICIICMDDLSI----NSIQKNFEKRKPKMLPCGHILHMNCLK 362
              L  + +H+  S     C ICM ++ +         N ++    + PC HI H +CL+
Sbjct: 685 --SLAHLAKHEGASKHTADCAICMSEVPVYIEEAEETHNIDQHSYMVTPCDHIFHTDCLE 742

Query: 363 NWMERSQTCPMCRLPV 378
           NWM     CP+CR P+
Sbjct: 743 NWMGYKLQCPVCRTPL 758

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 71/138 (51%), Gaps = 11/138 (7%)

Query: 247 FIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWKIWVNNRKL 306
           F Y   +    + ++ ++ + L + F + ++ S+D++     L Q+  TI + +   + L
Sbjct: 623 FTYSSNVFRHHKDVRFVVFLSLWLLFQISILYSQDILGSRWFLPQH--TIPEGYSYFKPL 680

Query: 307 DDQLPTVTQHQLDSMEDKI-CIICMDDLSINSIQKNFEKRKPK-----MLPCGHILHMNC 360
            +Q   + +H   ++E+ + C ICM D+ I  I++  E  K       + PC H+ H +C
Sbjct: 681 SNQY--ILEHGGGTVENTVDCAICMSDVPI-YIEEIPETHKVDQHSYMVTPCNHVFHTSC 737

Query: 361 LKNWMERSQTCPMCRLPV 378
           L+NWM     CP+CR P+
Sbjct: 738 LENWMSYKLQCPVCRSPL 755

>TBLA0A09640 Chr1 complement(2375252..2376180,2376263..2376311) [978
           bp, 325 aa] {ON} Anc_5.628 YDR265W
          Length = 325

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 15/110 (13%)

Query: 280 KDVVIDLVTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQ 339
           K ++ D   +S N  T   +  NN K+D + P +  +  +  E + CI+CM    IN   
Sbjct: 231 KTLIYDDNPISLNKVTTKNVKYNNEKIDLKNPKILPYIPE--ESRKCILCMS-FMIN--- 284

Query: 340 KNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVLPTR 389
                  P   PCGHI   NCL NW +  + CP+CR     +  E+LP R
Sbjct: 285 -------PSCAPCGHIYCWNCLINWCKEKEECPLCRQKC--DLQEILPLR 325

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 7/72 (9%)

Query: 313 VTQHQLDSMEDKI-CIICMDDLSINSIQKNFEKRKPK-----MLPCGHILHMNCLKNWME 366
           +++H   + E+ + C ICM D+ I  I++  E  K       + PC H+ H +CL+NWM 
Sbjct: 685 ISEHGSGAAENTVDCTICMSDVPI-YIEEIPETHKVDQHSYMVTPCDHVFHTSCLENWMS 743

Query: 367 RSQTCPMCRLPV 378
               CP+CR P+
Sbjct: 744 YKLQCPVCRSPL 755

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 7/72 (9%)

Query: 313 VTQHQLDSMEDKI-CIICMDDLSINSIQKNFEKRKPK-----MLPCGHILHMNCLKNWME 366
           +++H   + E+ + C ICM D+ I  I++  E  K       + PC H+ H  CL+NWM 
Sbjct: 686 ISEHGGGTAENTVDCAICMSDVPI-YIEEVPETHKVDQHSYMVTPCNHVFHTPCLENWMS 744

Query: 367 RSQTCPMCRLPV 378
               CP+CR P+
Sbjct: 745 YKLQCPVCRSPL 756

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 315 QHQLDSMEDKICIICMDDLS--INSIQK--NFEKRKPKMLPCGHILHMNCLKNWMERSQT 370
           +H  +      C ICM ++   I  I++  N +K    + PC HI H  CL+NWM     
Sbjct: 680 EHGTNKNHTVDCTICMSEVPVYIQDIEETHNIDKDTYMITPCNHIFHTTCLENWMSYKLQ 739

Query: 371 CPMCRLPV 378
           CP+CR P+
Sbjct: 740 CPVCRAPL 747

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 7/72 (9%)

Query: 313 VTQHQLDSMEDKI-CIICMDDLSINSIQKNFEKRKPK-----MLPCGHILHMNCLKNWME 366
           +++H   + E  + C ICM D+ I  I++  E  K       + PC H+ H +CL+NWM 
Sbjct: 685 ISEHGGGTAEHTVDCAICMSDVPI-YIEEIPETHKVDQHSYMVTPCNHVFHTSCLENWMN 743

Query: 367 RSQTCPMCRLPV 378
               CP+CR P+
Sbjct: 744 YKLQCPVCRSPL 755

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 326 CIICMDDLSI--NSIQKNFEKRKPKML--PCGHILHMNCLKNWMERSQTCPMCRLPV 378
           C ICM+D+ +  + I K  +  K   +  PC HI H  CL++WM     CP+CR P+
Sbjct: 688 CAICMNDVPVYVDDIPKTHKVDKESYMITPCSHIFHTQCLESWMSYKLQCPVCRAPL 744

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 6/58 (10%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKM-----LPCGHILHMNCLKNWMERSQTCPMCRLPV 378
           C ICM ++ +  ++   E  K  +      PCGH+ H  CL+NWM     CP+CR P+
Sbjct: 703 CAICMSEVPV-YVEDVPETHKVDLQTYMTTPCGHVFHTQCLENWMSYKLQCPVCRSPL 759

>AFR275W Chr6 (928482..930743) [2262 bp, 753 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKL034W (TUL1)
          Length = 753

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 6/58 (10%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKM-----LPCGHILHMNCLKNWMERSQTCPMCRLPV 378
           C ICM +L+I+ ++   E  K  +      PC H+ H  CL+NWM     CP+CR P+
Sbjct: 694 CAICMSELAIH-VEDIPETHKANIHDYMVTPCSHLFHTGCLENWMSYKLQCPVCRAPL 750

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 6/58 (10%)

Query: 326 CIICMDDLSI--NSIQKNFEKRKPK---MLPCGHILHMNCLKNWMERSQTCPMCRLPV 378
           C ICM +++I    I +   K  P    + PC H+ H  CL+NWM     CP+CR P+
Sbjct: 699 CAICMSEVAIYVEDIPET-HKTNPNEYMVTPCAHVFHTECLENWMSYKLQCPVCRAPL 755

>SAKL0A09812g Chr1 complement(863141..865396) [2256 bp, 751 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 751

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 326 CIICMDDLSI--NSIQKNFEK--RKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPV 378
           C ICM D+ I  + I++  +       + PCGHI H  CL++WM     CP+CR P+
Sbjct: 692 CAICMTDVPIYVSDIEETHKVDINSYMVTPCGHIFHTQCLESWMSYKLQCPVCRAPL 748

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 4/68 (5%)

Query: 315 QHQLDSMEDKICIICMDDLSI--NSIQKNFEKRKPKML--PCGHILHMNCLKNWMERSQT 370
           +H   S     C ICM ++++  + I +  +  K   +  PC HI H  CL++WM     
Sbjct: 680 EHGSSSSYSVDCAICMSEVAVYVDDIPETHKVDKDDYMITPCSHIFHTQCLESWMSYKLQ 739

Query: 371 CPMCRLPV 378
           CP+CR P+
Sbjct: 740 CPVCRAPL 747

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 6/59 (10%)

Query: 325 ICIICMDDLSINSIQKNFEKRKPK-----MLPCGHILHMNCLKNWMERSQTCPMCRLPV 378
           +C ICM D+ +  +++  E  K       + PC HI H  CL+NWM     CP+CR P+
Sbjct: 697 VCPICMVDVPV-YVEETEETHKIDAQSYMITPCSHIFHTECLENWMSYKLQCPVCRAPL 754

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 326 CIICMDDLSINSIQ----KNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPV 378
           C ICM ++ I   +       +++   + PC HI H  CL+NWM     CP+CR P+
Sbjct: 706 CAICMSEVPIRVEEVPETHKVDEQTYMVTPCAHIFHTQCLENWMSYKLQCPVCRSPL 762

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 4/57 (7%)

Query: 326 CIICMDDLSINSIQ----KNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPV 378
           C ICM ++ +   +       ++    + PC HI H +CL+NWM     CP+CR P+
Sbjct: 702 CSICMSEIPVYVEELPETHKVDQHSYMVTPCNHIFHTSCLENWMSYKLQCPVCRAPL 758

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 326 CIICMDDLSI--NSIQKNF--EKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPV 378
           C ICM ++ +    I +    +++   + PC HI H  CL+NWM     CP+CR P+
Sbjct: 698 CAICMSEVPVYVKDIPETHAVDQQSYMVTPCNHIFHTACLENWMGYKLQCPVCRAPL 754

>SAKL0G07370g Chr7 (604332..604383,604452..605365) [966 bp, 321 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import
          Length = 321

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 62/142 (43%), Gaps = 19/142 (13%)

Query: 254 DTFTRFLKTIIHILLL--IPFAMPVML----SKDVVIDLVTLSQNINTIWKIWVNNRKLD 307
           +T ++  + +  ILLL  I  A+P+      S    +D  T++ + N I  + +++    
Sbjct: 193 ETSSKSYRILGGILLLQSISKAIPIFANMTKSYTKPLDDGTVTTSNNEISGVPLDSSIRH 252

Query: 308 DQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMER 367
             L    Q    +   + CI+C+ ++           + P   PCGHI   NC+ NW + 
Sbjct: 253 VDLSDPAQMPFINESSRKCILCLTEM-----------KDPSCAPCGHIFCWNCIINWCKE 301

Query: 368 SQTCPMCRLPVFNEKGEVLPTR 389
              CP+CR      K  +LP R
Sbjct: 302 RSECPLCRQKCL--KQSILPLR 321

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 29/81 (35%), Positives = 36/81 (44%), Gaps = 13/81 (16%)

Query: 308 DQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKM--LP-CGHILHMNCLKNW 364
           D LP V + +L   E   C IC             E   P +  LP CGH   + C+  W
Sbjct: 74  DTLPRVPKKRL--AEGDNCAICCCGY--------LEDEYPLVVELPNCGHTFDLQCVSVW 123

Query: 365 MERSQTCPMCRLPVFNEKGEV 385
           + RS TCPMCR  V   K E+
Sbjct: 124 LSRSTTCPMCRSDVLVRKPEI 144

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 326 CIICMDDLSINSIQK----NFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPV 378
           C ICM  + +    K      ++    + PC HI H  CL+NWM     CP+CR P+
Sbjct: 703 CSICMSGIPLYVDDKPETHKVDQYSYMVTPCNHIFHTECLENWMSYKLQCPVCRTPL 759

>Ecym_1328 Chr1 complement(681157..682070,682146..682194) [963 bp,
           320 aa] {ON} similar to Ashbya gossypii AER390W
           1-intron
          Length = 320

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 19/80 (23%)

Query: 310 LPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQ 369
           LP + +H       + CI+C+ D+             P  LPCGH+   NC+ +W     
Sbjct: 260 LPLIPEHS------RSCILCLVDMV-----------DPSCLPCGHLFCWNCIMHWCTERS 302

Query: 370 TCPMCRLPVFNEKGEVLPTR 389
            CP+CR      K  +LP R
Sbjct: 303 ECPLCRQHC--SKQSILPIR 320

>NDAI0H00840 Chr8 complement(189570..190595) [1026 bp, 341 aa] {ON}
           Anc_5.628 YDR265W
          Length = 341

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 13/62 (20%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEV 385
           CI+C++D+             P   PCGHI    CL +W +    CP+CR P   +  ++
Sbjct: 290 CILCLNDMV-----------DPSCSPCGHIFCWRCLMDWCQERAECPLCRQPCLPQ--QI 336

Query: 386 LP 387
           LP
Sbjct: 337 LP 338

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 30/68 (44%), Gaps = 4/68 (5%)

Query: 315 QHQLDSMEDKICIICMDDLSIN----SIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQT 370
           +H   S     C ICM ++ +           +     + PC H+ H  CL+NWM     
Sbjct: 684 EHGASSDHTVDCAICMSEVPVYVDDVPTTHKVDLDSFMITPCNHVFHTQCLENWMGYKLQ 743

Query: 371 CPMCRLPV 378
           CP+CR P+
Sbjct: 744 CPVCRAPL 751

>NCAS0A08780 Chr1 (1735117..1739625) [4509 bp, 1502 aa] {ON} Anc_1.389
          Length = 1502

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 11/51 (21%)

Query: 326  CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRL 376
            C IC+ D+S+ S           ML CGH     C+ +W++  + CPMC++
Sbjct: 1191 CSICLQDISLGS-----------MLKCGHFFCKRCITSWLKNKKNCPMCKM 1230

>CAGL0M08690g Chr13 complement(865182..866168) [987 bp, 328 aa] {ON}
           similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265w peroxisomal assembly protein - peroxin
          Length = 328

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%), Gaps = 11/54 (20%)

Query: 322 EDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           E + CI+C+            E   P  LPCGH+   +C+ +W + +  CP+CR
Sbjct: 273 ESRNCILCL-----------MEMTDPSCLPCGHVFCWDCITDWTKENPECPLCR 315

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 349 MLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEK 382
           +LPCGH+    CL  W     +CP+CR P+ +E+
Sbjct: 216 VLPCGHVFGRECLYKWTTEHNSCPICRAPILSEE 249

>TDEL0A04940 Chr1 (872976..873072,873142..874025) [981 bp, 326 aa]
           {ON} Anc_5.628 YDR265W
          Length = 326

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 24/97 (24%)

Query: 279 SKDVVIDLVTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSI 338
            KD +  +   SQ    I  I++++   + QLP + Q        + CI+C++ ++    
Sbjct: 242 GKDAITGIPEASQ----IVHIYLSD---ESQLPYIPQ------ASRSCILCLNAMT---- 284

Query: 339 QKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
                   P   PCGHI   +C+ +W +    CP+CR
Sbjct: 285 -------DPSCAPCGHIFCWDCILSWCKERPECPLCR 314

>ZYRO0C11176g Chr3 (866350..866539,866607..867523) [1107 bp, 368 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import,
           interacts with Pex12p, links ubiquitin-conjugating Pex4p
           to protein import machinery; mutations in human homolog
           cause a variety of peroxisomal disorders
          Length = 368

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 13/64 (20%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEV 385
           CI+C+++++            P   PCGH+    C+ NW +  + CP+CR     +  ++
Sbjct: 318 CILCLNEMT-----------DPSCPPCGHLFCWACIMNWCKEREECPLCRQRCLRQ--QI 364

Query: 386 LPTR 389
           LP R
Sbjct: 365 LPLR 368

>Skud_4.528 Chr4 (941613..942626) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 17/68 (25%)

Query: 308 DQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMER 367
           +QLP + +        + CI+C+ D++            P   PCGH+   NCL +W + 
Sbjct: 274 NQLPYIPE------SSRKCILCLMDMT-----------DPSCTPCGHLFCWNCLMSWCKE 316

Query: 368 SQTCPMCR 375
              CP+CR
Sbjct: 317 RPECPLCR 324

>Suva_2.433 Chr2 (765490..766503) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 17/68 (25%)

Query: 308 DQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMER 367
           DQLP + +        + CI+C+ D++            P   PCGH+   +CL +W + 
Sbjct: 274 DQLPYIPE------ASRKCILCLMDMT-----------DPSCTPCGHLFCWDCLMSWCKE 316

Query: 368 SQTCPMCR 375
              CP+CR
Sbjct: 317 RPECPLCR 324

>NCAS0A11350 Chr1 complement(2249991..2251277) [1287 bp, 428 aa]
           {ON} Anc_3.405 YPR093C
          Length = 428

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 8/55 (14%)

Query: 323 DKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQT--CPMCR 375
           D IC IC DDL+   I +       K+ PC H  H +C++ W   S    CP+CR
Sbjct: 9   DNICPICFDDLNDTDILQG------KLKPCNHKYHYDCIRRWHGYSDNSDCPLCR 57

>KLTH0G12408g Chr7 (1055265..1057076) [1812 bp, 603 aa] {ON} weakly
           similar to uniprot|P22470 Saccharomyces cerevisiae
           YDR143C SAN1 Ubiquitin-protein ligase controls turnover
           of a specific class of unstable nuclear proteins
           including Sir4p but not Sir2p or Sir3p san1 mutations
           suppress sir4 spt16 and cdc68 mutations suggesting a
           role in chromatin silencing
          Length = 603

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 20/40 (50%)

Query: 344 KRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKG 383
           K  P  LPCGHI    C++ W     TCP+CR  +    G
Sbjct: 223 KHSPLKLPCGHIFGRECIRQWTNEHNTCPICRARIVGADG 262

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 326 CIICMDDLSINSIQ----KNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPV 378
           C ICM +  +   +       +K    + PC H+ H +CL++WM     CP+CR P+
Sbjct: 698 CAICMAEFPVYVEELPETHQVDKDSYMITPCDHMFHTSCLESWMSYKLQCPVCRSPL 754

>Kpol_526.34 s526 (83624..84610) [987 bp, 328 aa] {ON}
           (83624..84610) [987 nt, 329 aa]
          Length = 328

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 11/54 (20%)

Query: 322 EDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           E + CI+C++ +             P   PCGHI   +C+ NW +    CP+CR
Sbjct: 274 ESRNCILCLNSMV-----------DPSAAPCGHIFCWDCIINWCKERPECPLCR 316

>AER390W Chr5 (1370316..1370364,1370423..1371324) [951 bp, 316 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR265W (PEX10); 1-intron
          Length = 316

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 11/56 (19%)

Query: 320 SMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           S + + CI+C+ D++            P  LPCGH+    C+  W      CP+CR
Sbjct: 260 SEQSRKCILCLADMT-----------DPSCLPCGHMFCWACVMQWCNERNECPLCR 304

>CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093c
          Length = 305

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 9/58 (15%)

Query: 321 MEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQ--TCPMCRL 376
           M  K+C IC++D+   S     +       PCGH  H +C++ W   ++   CPMCR+
Sbjct: 1   MVSKVCAICLEDICGKSSTSYLK-------PCGHEYHSDCIRKWHGHAEDLKCPMCRI 51

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {ON}
           YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 40.8 bits (94), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 37/82 (45%), Gaps = 15/82 (18%)

Query: 308 DQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKM---LP-CGHILHMNCLKN 363
           D LP V + +L   E   C IC           N+   K  +   LP C H   + C+  
Sbjct: 19  DSLPRVEKGKLKDAE--ACSICC---------CNYRDDKYPLVVELPHCNHRFDLECVAV 67

Query: 364 WMERSQTCPMCRLPVFNEKGEV 385
           W+ +S+TCP+CR  V + K  V
Sbjct: 68  WLSKSRTCPLCRDDVLSHKPNV 89

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 350 LP-CGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVLPTRRE 391
           LP CGH   + CL  W  +S +CP+CR  V + + EV  ++ E
Sbjct: 93  LPHCGHDFDLECLSVWFSKSTSCPLCRDDVLSHRAEVDTSQVE 135

>KLLA0F12166g Chr6 complement(1116715..1121301) [4587 bp, 1528 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1528

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 53/114 (46%), Gaps = 23/114 (20%)

Query: 269  LIPFAMPVMLSKDVVIDLVTLSQNINTIWKIWVNN-----RKLD--DQLPTVTQHQLDSM 321
            L+P +     +++ +I  VT   + +   K+ +NN     R LD   QL T     + + 
Sbjct: 1149 LVPLSELNATTRNNIIKKVTRGHDYDDNCKV-INNLESRVRYLDTLGQLKTA----IANG 1203

Query: 322  EDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
            E+  C +C  D+   SI           L CGH    +C+ +W +++ +CPMC+
Sbjct: 1204 ENISCAVCYSDIYTGSI-----------LKCGHFFCKDCVTHWFKKNTSCPMCK 1246

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKG 383
           P  LPCGHI   +C+  W +   +CP+CR  +  ++G
Sbjct: 276 PTELPCGHIFGRDCIFKWTKEHNSCPICRSRIVEDEG 312

>TPHA0C00350 Chr3 complement(58374..59210) [837 bp, 278 aa] {ON}
           Anc_5.628 YDR265W
          Length = 278

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 17/98 (17%)

Query: 278 LSKDVVIDLVTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINS 337
           +SK + +    L++NI   +    N+ +L D+    TQ +    E + C +C+  ++   
Sbjct: 186 VSKPLNLSETKLTKNITDEYH--QNHIRLSDE----TQFKFIPSESRDCALCLSKIT--- 236

Query: 338 IQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
                    P + PCGHI   +C+ +W      CP CR
Sbjct: 237 --------DPSVGPCGHIFCWDCIVDWCRERPECPFCR 266

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query: 326 CIICMDDLS--INSIQKNFEK--RKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           C ICM  +   I  ++   +       + PC HI H  CL+NWM     CP+CR
Sbjct: 703 CAICMSPVPVYIEEVEGTHKVDIHSYMVTPCNHIFHTECLENWMGYKLQCPVCR 756

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 36/76 (47%), Gaps = 9/76 (11%)

Query: 308 DQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLP-CGHILHMNCLKNWME 366
           D LP + Q +L S  D  C IC  +   +      E      LP CGH     C+  W+ 
Sbjct: 88  DSLPRIPQKKLKS--DDTCPICCSNFIADEYPLVVE------LPHCGHKFDFECVSMWLT 139

Query: 367 RSQTCPMCRLPVFNEK 382
           ++ TCPMCR  V ++K
Sbjct: 140 KNTTCPMCRDDVTHKK 155

>KLTH0E02464g Chr5 (216256..216301,216358..217301) [990 bp, 329 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 329

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 13/68 (19%)

Query: 322 EDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNE 381
           E + CI+C+  L ++          P   PCGH+   +CL NW +    CP+CR     +
Sbjct: 275 ESRKCILCLS-LMVD----------PSCAPCGHLFCWDCLLNWSKERPECPLCRQTCQTQ 323

Query: 382 KGEVLPTR 389
              +LP R
Sbjct: 324 --SILPIR 329

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           P  LPCGHI    CL  W +   TCP+CR
Sbjct: 230 PTKLPCGHIFGRECLYRWCKLENTCPLCR 258

>Smik_4.516 Chr4 (931711..932724) [1014 bp, 337 aa] {ON} YDR265W
           (REAL)
          Length = 337

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 31/67 (46%), Gaps = 17/67 (25%)

Query: 309 QLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERS 368
           QLP + +        + CI+C+ +++            P   PCGH+   +CL +W +  
Sbjct: 275 QLPYIPE------SSRKCILCLTNMT-----------DPSCAPCGHLFCWDCLMSWCKER 317

Query: 369 QTCPMCR 375
             CP+CR
Sbjct: 318 PECPLCR 324

>YDR265W Chr4 (998864..999877) [1014 bp, 337 aa] {ON}
           PEX10Peroxisomal membrane E3 ubiquitin ligase, required
           for for Ubc4p-dependent Pex5p ubiquitination and
           peroxisomal matrix protein import; contains zinc-binding
           RING domain; mutations in human homolog cause various
           peroxisomal disorders
          Length = 337

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 32/69 (46%), Gaps = 17/69 (24%)

Query: 307 DDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWME 366
            +QLP + +        + CI+C+ ++S            P   PCGH+   +CL +W +
Sbjct: 273 KNQLPFIPE------ASRKCILCLMNMS-----------DPSCAPCGHLFCWSCLMSWCK 315

Query: 367 RSQTCPMCR 375
               CP+CR
Sbjct: 316 ERPECPLCR 324

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 40.0 bits (92), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 15/82 (18%)

Query: 308 DQLPTVTQHQLDSMEDKICIIC----MDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKN 363
           D LP V +  L   +   C IC    +DD     +         K+  C H   + C+  
Sbjct: 67  DSLPRVNKCDLKGAD--ACSICCCGYLDDTHPLVV---------KLPHCSHRFDLECVAV 115

Query: 364 WMERSQTCPMCRLPVFNEKGEV 385
           W+ +S+TCP+CR  V + K +V
Sbjct: 116 WLSKSRTCPLCRDDVLSHKPKV 137

>SAKL0C01760g Chr3 complement(149641..154065) [4425 bp, 1474 aa] {ON}
            weakly similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 51/122 (41%), Gaps = 26/122 (21%)

Query: 274  MPVMLSKDVVIDLVTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDL 333
            MP     D        +QN+  I  ++   + L        +H+    E+  C +C +++
Sbjct: 1119 MPATAKDDEA-----YAQNLAKINSLYARTKYLKKLSKLKEEHK--EGEELSCAVCFNEI 1171

Query: 334  SINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRL-----PVFN---EKGEV 385
             + S+ K           CGH    +C+  W++   TCP+C+       V+N   ++GE 
Sbjct: 1172 FVGSVVK-----------CGHFFCYSCIHTWLKEHNTCPLCKTNVTPSEVYNFRYKEGEE 1220

Query: 386  LP 387
            LP
Sbjct: 1221 LP 1222

>SAKL0C03586g Chr3 (337347..341771) [4425 bp, 1474 aa] {ON} weakly
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1474

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 51/122 (41%), Gaps = 26/122 (21%)

Query: 274  MPVMLSKDVVIDLVTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDL 333
            MP     D        +QN+  I  ++   + L        +H+    E+  C +C +++
Sbjct: 1119 MPATAKDDEA-----YAQNLAKINSLYARTKYLKKLSKLKEEHK--EGEELSCAVCFNEI 1171

Query: 334  SINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRL-----PVFN---EKGEV 385
             + S+ K           CGH    +C+  W++   TCP+C+       V+N   ++GE 
Sbjct: 1172 FVGSVVK-----------CGHFFCYSCIHTWLKEHNTCPLCKTNVTPSEVYNFRYKEGEE 1220

Query: 386  LP 387
            LP
Sbjct: 1221 LP 1222

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 44/89 (49%), Gaps = 16/89 (17%)

Query: 308 DQLPTVTQHQLDSMEDK--ICIICMDDLSINSIQKNFEKRKP--KMLP-CGHILHMNCLK 362
           D LP +   + +S++DK   C IC          K  E + P    LP CGH   + C+ 
Sbjct: 87  DSLPRI---KANSIKDKNAECAIC--------FCKFLEDKYPLVAELPHCGHRFDLECIS 135

Query: 363 NWMERSQTCPMCRLPVFNEKGEVLPTRRE 391
            W+ +S TCP+CR  V + K ++  ++ E
Sbjct: 136 VWLSKSDTCPLCRDSVLSHKTDIDVSKTE 164

>Kwal_55.19999 s55 (206149..206607) [459 bp, 152 aa] {ON} YDR265W
           (PEX10) - C3HC4 zinc-binding integral peroxisomal
           membrane protein [contig 157] PARTIAL
          Length = 152

 Score = 39.7 bits (91), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 34/88 (38%), Gaps = 18/88 (20%)

Query: 307 DDQLPTVTQHQLDSM-----EDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCL 361
           D Q+  +   Q   M     + + CI+C+  +             P   PCGH+    CL
Sbjct: 78  DSQVEHIGLEQASEMSFIPSDSRKCILCLGFM-----------LDPSCAPCGHVFCWKCL 126

Query: 362 KNWMERSQTCPMCRLPVFNEKGEVLPTR 389
            +W      CP+CR     +   VLP R
Sbjct: 127 LSWCNERPECPLCRQTCHAQN--VLPLR 152

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 18/32 (56%)

Query: 344 KRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           K  P  LPCGHI    C+  W +   +CP+CR
Sbjct: 248 KHSPIKLPCGHIFGRECIYKWSKLENSCPLCR 279

>TPHA0A03340 Chr1 (734754..735908) [1155 bp, 384 aa] {ON} Anc_3.405
           YPR093C
          Length = 384

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 11/59 (18%)

Query: 320 SMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQ--TCPMCRL 376
           +M   IC IC+D +         +K   K+ PC H  H++C++ W   S    CP CR+
Sbjct: 13  TMVSSICAICLDAI---------DKSIAKLEPCNHKYHIDCIRTWHNYSNDLNCPTCRI 62

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 39.3 bits (90), Expect = 0.006,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 13/76 (17%)

Query: 310 LPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKM--LP-CGHILHMNCLKNWME 366
           LP + +  L   ++  C IC  +          E + P +  LP C H   + CL  W+ 
Sbjct: 65  LPRINKKMLKPSDN--CSICYTNY--------LEDKYPLVVELPHCHHKFDLECLSVWLS 114

Query: 367 RSQTCPMCRLPVFNEK 382
           RS TCP+CR  V   +
Sbjct: 115 RSTTCPLCRDDVMGHR 130

>KAFR0H00560 Chr8 complement(99045..100028) [984 bp, 327 aa] {ON}
           Anc_5.628 YDR265W
          Length = 327

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 13/66 (19%)

Query: 324 KICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKG 383
           + CI+C+  +             P   PCGH+   +C+ NW      CP+CR     +  
Sbjct: 275 RTCILCLSKIV-----------DPSCAPCGHLYCWDCILNWCNEKPECPLCRQKCHPQ-- 321

Query: 384 EVLPTR 389
           ++LP +
Sbjct: 322 QILPIK 327

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 17/32 (53%)

Query: 344 KRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           K  P  LPCGH+    CL  W     +CP+CR
Sbjct: 267 KHSPIRLPCGHVFGRECLYKWSRLENSCPLCR 298

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 24/95 (25%)

Query: 285  DLVTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLDSMEDKI-CIICMDDLSINSIQKNFE 343
            +L+T+S N+N+  K    N+ L D         + S E  + C IC+  + I SI     
Sbjct: 1105 NLITIS-NLNSRLKFLNQNKILQD---------ISSTESILNCSICLTSIEIGSI----- 1149

Query: 344  KRKPKMLPCGHILHMNCLKNWMERS--QTCPMCRL 376
                  L CGH    +C+ NW+E+S  + CP+C++
Sbjct: 1150 ------LKCGHYYCQDCIWNWLEKSKKKNCPICKI 1178

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 6/78 (7%)

Query: 308 DQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMER 367
           +QLP     +L +  D+ C IC    S      +FE     +  C H  H  C+K W+++
Sbjct: 193 EQLPRTNCAELSNSSDE-CPICRIAYS-----DDFETEITCLPNCSHHFHFECIKLWLQK 246

Query: 368 SQTCPMCRLPVFNEKGEV 385
           +  CP+CR  V   K E 
Sbjct: 247 NSLCPLCRDNVMECKAET 264

>Kwal_56.23900 s56 complement(764530..766299) [1770 bp, 589 aa] {ON}
           YDR143C (SAN1) - (putative) transcriptional regulator
           [contig 171] FULL
          Length = 589

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 19/40 (47%)

Query: 344 KRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKG 383
           K  P  LPC H+    C++ W     TCP+CR  +    G
Sbjct: 219 KHSPVQLPCSHVFGRECIRQWTNLHNTCPICRANIVGADG 258

>CAGL0B05049g Chr2 (487186..491598) [4413 bp, 1470 aa] {ON} some
            similarities with uniprot|Q06554 Saccharomyces cerevisiae
            YLR247c
          Length = 1470

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 22/32 (68%)

Query: 349  MLPCGHILHMNCLKNWMERSQTCPMCRLPVFN 380
            M+ CGH+   +C+ +W++  +TCP+C+ P  N
Sbjct: 1176 MVNCGHLFCTSCIFSWLKNRKTCPLCKHPTSN 1207

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 17/32 (53%)

Query: 344 KRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           K  P  LPCGHI    C+  W     +CP+CR
Sbjct: 259 KHSPIKLPCGHIFGRECIYKWSRLENSCPLCR 290

>ZYRO0D05830g Chr4 (495428..497770) [2343 bp, 780 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 780

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 9/60 (15%)

Query: 336 NSIQKNFEKRK-----PKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVLPTRR 390
           +S Q+  E +K     P  LPC HI    CL  W +   +CP+CR  +     EV P +R
Sbjct: 282 DSSQQGEESQKKYLHSPVQLPCAHIFGRECLDKWSQIENSCPLCRRKIV----EVQPEQR 337

>KAFR0B03070 Chr2 complement(638210..640141) [1932 bp, 643 aa] {ON}
           Anc_8.317 YDR143C
          Length = 643

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 17/29 (58%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           P  LPCGHI    CL  W +   TCP+CR
Sbjct: 299 PLKLPCGHIFGRECLFKWSKVENTCPLCR 327

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score = 38.5 bits (88), Expect = 0.009,   Method: Composition-based stats.
 Identities = 25/97 (25%), Positives = 41/97 (42%), Gaps = 13/97 (13%)

Query: 284 IDLVTLSQNINTIWKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFE 343
           I+L  +    N +W I  N  +LD+ +        D  ED +C IC            + 
Sbjct: 3   IELTEVHGVFNWVWDIPKNEDRLDESMA-------DEDED-VCGICRASYHAPCPNCRYP 54

Query: 344 KRKPKML--PCGHILHMNCLKNWMERSQT---CPMCR 375
                ++   CGH  H++C+  W++   +   CPMCR
Sbjct: 55  GESCAIVLGRCGHNFHVHCISRWVDTPTSKGLCPMCR 91

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 17/32 (53%)

Query: 344 KRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           K  P  LPCGHI    C+  W     +CP+CR
Sbjct: 249 KHSPIKLPCGHIFGRECIYKWSRLENSCPLCR 280

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 39/99 (39%), Gaps = 20/99 (20%)

Query: 297 WKIWVNNRK-------LDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKP-- 347
           W  W+++ +         D LP V    L    D  C IC             E   P  
Sbjct: 56  WLEWISDGEKRGVPEGFSDSLPRVATTHLSP--DDTCAIC--------CCVYLEDSYPLV 105

Query: 348 -KMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEV 385
            K+  C H   + C+  W+ +S TCPMCR  V + K ++
Sbjct: 106 VKLPNCNHKFDLQCITLWLSKSSTCPMCRNDVMSSKTKI 144

>CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143c SAN1 mating-type regulation protein
          Length = 717

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           P  +PCGHI   +CL  W     +CP+CR
Sbjct: 290 PVKIPCGHIFGRSCLYEWTRLENSCPLCR 318

>ZYRO0E05192g Chr5 (393899..398461) [4563 bp, 1520 aa] {ON} similar to
            uniprot|Q06554 Saccharomyces cerevisiae YLR247C
            Hypothetical ORF
          Length = 1520

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 16/60 (26%)

Query: 326  CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR-----LPVFN 380
            C IC+  +   SI           + CGH     C+ +W++ +Q+CP+C+     L V+N
Sbjct: 1201 CAICLGTIHTGSI-----------IKCGHFFCRKCIHSWLKNNQSCPLCKTRATLLEVYN 1249

>KNAG0G02390 Chr7 complement(548272..550338) [2067 bp, 688 aa] {ON}
           Anc_8.317 YDR143C
          Length = 688

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 17/29 (58%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           P  LPCGHI   +C+  W     +CP+CR
Sbjct: 335 PTKLPCGHIFGRDCIFKWSHLENSCPLCR 363

>Skud_12.328 Chr12 complement(575254..579927) [4674 bp, 1557 aa] {ON}
            YLR247C (REAL)
          Length = 1557

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 16/72 (22%)

Query: 326  CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR-----LPVFN 380
            C IC+ D+ I +I           + CGH    NC+  W+     CP+C+       V+N
Sbjct: 1240 CSICLGDVEIGAI-----------IKCGHYFCKNCILTWLRAHNKCPICKSFCSVSEVYN 1288

Query: 381  EKGEVLPTRRER 392
             K +    R+E+
Sbjct: 1289 FKFKNTKERKEK 1300

>KAFR0F02840 Chr6 complement(564020..565357) [1338 bp, 445 aa] {ON}
           Anc_6.332 YCR066W
          Length = 445

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 15/68 (22%)

Query: 307 DDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWME 366
           D Q+P ++Q  LD++    C IC D L +           P + PCGH     C++ ++ 
Sbjct: 13  DTQIPNISQ--LDAL--LRCHICKDFLKV-----------PVLTPCGHTFCSICIREYIN 57

Query: 367 RSQTCPMC 374
           R   CP+C
Sbjct: 58  RQSKCPLC 65

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 348 KMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVLPT 388
           K+  CGH     CL  W+ +++TCPMCR  + + K EV+ T
Sbjct: 51  KLPHCGHNFDYECLSIWLSKNKTCPMCRDDITSHK-EVIDT 90

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 25/50 (50%), Gaps = 11/50 (22%)

Query: 326  CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
            C IC++ +   SI           + CGH     C+++W++   +CP+C+
Sbjct: 1226 CTICLNQIYTGSI-----------IKCGHFFCKKCIQSWLKNKNSCPLCK 1264

>SAKL0A09526g Chr1 (834338..836326) [1989 bp, 662 aa] {ON} conserved
           hypothetical protein
          Length = 662

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 349 MLPCGHILHMNCLKNWMERSQTCPMCRLPVFN 380
           M PCGH +H +C   + + S  CP C++ V N
Sbjct: 397 MSPCGHAIHQHCFDEYTKHSYKCPHCQVTVLN 428

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 15/65 (23%)

Query: 320 SMEDKICIICMDDLS-INSIQKNFEKRKPKMLPCGHILHMNCLKNWMER-SQTCPMCR-- 375
           S E++ C+IC +  + +N+I         ++L C HI H +C+  W+ R S  CP+C+  
Sbjct: 104 SDEEESCVICQEQFNELNNI---------RVLGCSHIFHSHCIDRWICRNSACCPLCKRS 154

Query: 376 --LPV 378
             LPV
Sbjct: 155 YSLPV 159

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 21/40 (52%)

Query: 344 KRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKG 383
           K  P  L CGH+    C+  W + + +CP+CR  +   +G
Sbjct: 223 KHSPTELKCGHVFGRVCIYQWTKENNSCPICRANIVGREG 262

>KLLA0E16677g Chr5 complement(1481372..1482289) [918 bp, 305 aa]
           {ON} similar to uniprot|Q05568 Saccharomyces cerevisiae
           YDR265W PEX10 RING finger peroxisomal membrane peroxin
           required for peroxisomal matrix protein import interacts
           with Pex12p links ubiquitin-conjugating Pex4p to protein
           import machinery mutations in human homolog cause a
           variety of peroxisomal disorders
          Length = 305

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           P   PCGH+   +C+  W    Q CP+CR
Sbjct: 265 PSATPCGHLFCWDCIMEWTLERQECPLCR 293

>Kwal_26.8030 s26 (616729..618711) [1983 bp, 660 aa] {ON} [contig
           55] FULL
          Length = 660

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 349 MLPCGHILHMNCLKNWMERSQTCPMCRLPVFN 380
           M PCGH +H +C   + + S  CP C++ V N
Sbjct: 403 MSPCGHAIHQHCFDEYTKHSYKCPSCQVSVLN 434

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
           similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 12/58 (20%)

Query: 324 KICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWME---RSQTCPMCRLPV 378
           K C IC D ++ N           K++PC H  H++C++ W       +TCP CR+ +
Sbjct: 7   KECPICWDSMADNV---------AKLIPCQHEFHLSCIRKWYHSRISDRTCPNCRVEI 55

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 26/50 (52%), Gaps = 11/50 (22%)

Query: 326  CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
            C IC+  +++ +I           + CGH    +C+ +W++   +CPMC+
Sbjct: 1154 CPICLGKITMGAI-----------IKCGHFFCRSCIHSWLKNHNSCPMCK 1192

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 15/82 (18%)

Query: 308 DQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNF-EKRKP---KMLPCGHILHMNCLKN 363
           D LP V   +L +  +  C IC         Q NF +   P   K+  C H   + CL  
Sbjct: 55  DSLPRVPNSKLKA--EDTCAIC---------QCNFLDDPYPLVAKVPRCNHKFDLECLSI 103

Query: 364 WMERSQTCPMCRLPVFNEKGEV 385
           W++ + TCPMCR  + ++K E+
Sbjct: 104 WLQNNHTCPMCRDDLRSKKVEI 125

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 2/30 (6%)

Query: 350 LPCGHILHMNCLKNWMERSQTCPMCRLPVF 379
           +PC H  H  CL  W  ++  CP+CRL  F
Sbjct: 264 IPCQHTFHCQCLDKW--KNSKCPVCRLSSF 291

>KLTH0D06886g Chr4 (600181..602175) [1995 bp, 664 aa] {ON} conserved
           hypothetical protein
          Length = 664

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 349 MLPCGHILHMNCLKNWMERSQTCPMCRLPVFN 380
           M PCGH +H +C   + + S  CP C++ + N
Sbjct: 402 MSPCGHAIHQHCFDEYTKHSYKCPSCQVSILN 433

>TPHA0C00850 Chr3 (177213..179558) [2346 bp, 781 aa] {ON} Anc_8.317
           YDR143C
          Length = 781

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 15/29 (51%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           P  LPC HI    CL  W     TCP+CR
Sbjct: 276 PTELPCKHIFGRECLYKWTRVQNTCPLCR 304

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 37.0 bits (84), Expect = 0.031,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 9/69 (13%)

Query: 308 DQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLP-CGHILHMNCLKNWME 366
           D LP +T   L   ++  C IC    + +      E      LP C H   + CL  W+ 
Sbjct: 70  DSLPRITARNLVKGDE--CSICCSKYNEDDYPLVVE------LPHCSHRFDLECLTPWLL 121

Query: 367 RSQTCPMCR 375
           ++ TCP+CR
Sbjct: 122 KNSTCPLCR 130

>KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly
           similar to uniprot|Q06834 Saccharomyces cerevisiae
           YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 291

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 11/53 (20%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQT--CPMCRL 376
           C IC + LS  +          +++ CGH  H NC++ W   S+   CP CR+
Sbjct: 4   CPICFESLSKGAC---------RLVECGHKYHFNCIRRWHYHSKNLQCPTCRI 47

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {ON}
           Anc_3.405 YPR093C
          Length = 102

 Score = 35.8 bits (81), Expect = 0.034,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 17/58 (29%)

Query: 326 CIICMDDLSINSIQKNFEKRKP--KMLPCGHILHMNCLKNWME------RSQTCPMCR 375
           C ICM+++            +P  ++LPC H  H +C++ W        R   CP CR
Sbjct: 10  CPICMEEIG---------PHEPLGELLPCHHKFHSDCIRKWHTTTTGEIRRPLCPFCR 58

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 11/50 (22%)

Query: 326  CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
            C IC+D ++           K  ML CGH    +C+ +W++    CP+C+
Sbjct: 1267 CTICLDAIT-----------KGCMLKCGHFFCEDCIYDWLQTRTICPICK 1305

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 15/29 (51%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           P  LPC HI    CL  W     TCP+CR
Sbjct: 259 PVELPCHHIFGRECLYKWTRHENTCPLCR 287

>TDEL0A03090 Chr1 (550834..552594) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 18/32 (56%)

Query: 349 MLPCGHILHMNCLKNWMERSQTCPMCRLPVFN 380
           M PCGH +H +C   +   S  CP C++ V N
Sbjct: 348 MSPCGHAIHQHCFDEYTRHSYKCPHCQVTVLN 379

>Kwal_14.1287 s14 (263082..267638) [4557 bp, 1518 aa] {ON} YLR247C -
            Hypothetical ORF [contig 244] FULL
          Length = 1518

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 12/51 (23%), Positives = 27/51 (52%), Gaps = 11/51 (21%)

Query: 326  CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRL 376
            C IC+ ++ + S+           + CGH    +C+ +W++   +CP+C++
Sbjct: 1189 CTICLGEIYMGSV-----------IKCGHFFCQDCICSWLKNHSSCPLCKM 1228

>NCAS0C05290 Chr3 (1076165..1077157) [993 bp, 330 aa] {ON} Anc_5.628
           YDR265W
          Length = 330

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           P   PCGHI    C+ +W +    CP+CR
Sbjct: 290 PSCSPCGHIFCWECILDWCKERPECPLCR 318

>SAKL0D08272g Chr4 complement(687452..691927) [4476 bp, 1491 aa] {ON}
            similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1491

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 28/61 (45%), Gaps = 14/61 (22%)

Query: 319  DSMEDK---ICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
            D+M  K    C IC  ++ + SI           + CGH    +C+ +W+     CP+C+
Sbjct: 1154 DAMHRKKKFTCTICFSEIYMGSI-----------IKCGHFFCKSCIHSWLRNKNACPLCK 1202

Query: 376  L 376
            +
Sbjct: 1203 M 1203

>TBLA0I02360 Chr9 (541190..543124) [1935 bp, 644 aa] {ON} Anc_6.332
           YCR066W
          Length = 644

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 15/68 (22%)

Query: 307 DDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWME 366
           D ++P ++Q  LDS+    C IC D L I           P + PCGH     C++ ++ 
Sbjct: 13  DSEIPNLSQ--LDSL--LRCHICKDFLKI-----------PVLTPCGHTFCSLCIRGYLN 57

Query: 367 RSQTCPMC 374
           +   CP+C
Sbjct: 58  KEPKCPLC 65

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 7/51 (13%)

Query: 332 DLSINSIQKNFEKRK-------PKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           D   NS   N E+ +       P  LPC HI    CL  W +   +CP+CR
Sbjct: 219 DTGNNSSSTNIEEAEEPVYLHSPVKLPCDHIFGRECLYKWSKLENSCPLCR 269

>KLLA0E18503g Chr5 complement(1645113..1647065) [1953 bp, 650 aa]
           {ON} conserved hypothetical protein
          Length = 650

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 349 MLPCGHILHMNCLKNWMERSQTCPMCRLPVFN 380
           M PCGH +H +C   +++ S  CP C + V N
Sbjct: 388 MDPCGHAIHQHCFDEYIKHSYKCPNCNVSVIN 419

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 37.7 bits (86), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 19/42 (45%), Gaps = 7/42 (16%)

Query: 349 MLPCGHILHMNCLKNW-------MERSQTCPMCRLPVFNEKG 383
           M+PC H  H  CLK W         R   CP+CR+ +   K 
Sbjct: 182 MIPCQHYFHAGCLKEWFSPQRRGKRRPLVCPLCRMDIVKCKA 223

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 13/76 (17%)

Query: 310 LPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKP---KMLPCGHILHMNCLKNWME 366
           LP + + +L+S ++  C IC  +          E   P   ++  C H   + CL  W+ 
Sbjct: 93  LPRINRKKLNSTDN--CSICYTNY--------LEDEYPLVVELPHCNHRFDLECLSVWLS 142

Query: 367 RSQTCPMCRLPVFNEK 382
           RS TCP+CR  V   +
Sbjct: 143 RSTTCPLCRDDVMGHR 158

>KNAG0I01380 Chr9 (265230..269711) [4482 bp, 1493 aa] {ON} Anc_1.389
            YLR247C
          Length = 1493

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 11/50 (22%)

Query: 326  CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
            C IC+  +   SI K           CGH    +C+ +W++  +TCP+C+
Sbjct: 1177 CSICLGIIHHGSIMK-----------CGHFFCRDCIHSWLKNQRTCPICK 1215

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 18/32 (56%)

Query: 344 KRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           K  P +LPC H+    CL  W +   +CP+CR
Sbjct: 210 KHSPVVLPCNHVFGRECLFKWSQLENSCPLCR 241

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 51/111 (45%), Gaps = 27/111 (24%)

Query: 281  DVVIDLVTLSQNI-NTIWKIWVNNRKLDDQLPTVTQ--------HQLDSMEDKI------ 325
            D +I ++ L  N+ N+I +   ++++  + L  ++Q          L  ++D I      
Sbjct: 1090 DSLISIIQLEPNVKNSILRSIKDDKQYKENLTKISQIESRIKYLKNLSKIQDLIEQNKSF 1149

Query: 326  -CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
             C IC++ + + SI           + CGH    +C+ +W++    CP+C+
Sbjct: 1150 NCPICLNTIYMGSI-----------IKCGHFFCKHCIFSWLKNKSVCPICK 1189

>Smik_12.320 Chr12 complement(573526..578187) [4662 bp, 1553 aa] {ON}
            YLR247C (REAL)
          Length = 1553

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 11/50 (22%)

Query: 326  CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
            C IC+ ++ I +I           + CGH    NC+  W+     CP+C+
Sbjct: 1236 CSICLGEVEIGAI-----------IKCGHYFCKNCILTWLRAHSKCPICK 1274

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 37.4 bits (85), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 19/40 (47%)

Query: 344 KRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLPVFNEKG 383
           K  P  L CGH     C+  W +   +CP+CR  +   +G
Sbjct: 239 KHSPTQLKCGHRFGRMCIYQWTKEHNSCPICRAEIVGREG 278

>KLTH0G18150g Chr7 complement(1564780..1569444) [4665 bp, 1554 aa]
            {ON} similar to uniprot|Q06554 Saccharomyces cerevisiae
            YLR247C Hypothetical ORF
          Length = 1554

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 12/51 (23%), Positives = 27/51 (52%), Gaps = 11/51 (21%)

Query: 326  CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRL 376
            C IC+ ++ + S+           + CGH    +C+ +W++   +CP+C++
Sbjct: 1223 CTICLGEIYMGSV-----------IKCGHFFCQSCIFSWLKNHASCPLCKM 1262

>NDAI0E00440 Chr5 (80965..82215) [1251 bp, 416 aa] {ON} Anc_8.808
           YOL054W
          Length = 416

 Score = 37.4 bits (85), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 3/32 (9%)

Query: 347 PKMLPCGHILHMNCLKNWM---ERSQTCPMCR 375
           P M PCGH     CL NW+    +   CP CR
Sbjct: 40  PMMTPCGHNFCYGCLNNWITGGSKDLNCPQCR 71

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 35.8 bits (81), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (53%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLPVFNEKGEVLPTRR 390
           CGHI  + C+  W+    TCPMCR  V   K + L T +
Sbjct: 113 CGHIFDLQCISMWLSNQVTCPMCRDVVNGHKVQDLDTSK 151

>Ecym_7253 Chr7 complement(534000..535853) [1854 bp, 617 aa] {ON}
           similar to KLTH0D06886g KLTH0D06886p Lachancea
           thermotolerans
          Length = 617

 Score = 37.4 bits (85), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 18/32 (56%)

Query: 349 MLPCGHILHMNCLKNWMERSQTCPMCRLPVFN 380
           M PCGH +H +C  +    S  CP C++ V N
Sbjct: 386 MSPCGHAIHQHCFNDHTRHSYKCPQCQVTVVN 417

>TPHA0I00560 Chr9 (112560..113744) [1185 bp, 394 aa] {ON} Anc_8.808
           YOL054W
          Length = 394

 Score = 37.0 bits (84), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 4/39 (10%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQT----CPMCRLPVFNE 381
           P M  CGH     CLK+W   ++T    CP CR  V +E
Sbjct: 40  PMMTACGHNYCYGCLKSWFTSNETTELSCPQCRSSVGSE 78

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 37.0 bits (84), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 21/31 (67%), Gaps = 3/31 (9%)

Query: 348 KMLPCGHILHMNCLKNWME---RSQTCPMCR 375
           +++PCGH  H+ C++ W      +++CP+CR
Sbjct: 31  RLMPCGHEYHLACIRKWFHLHSGNRSCPVCR 61

>ZYRO0B02046g Chr2 (164680..166017) [1338 bp, 445 aa] {ON} conserved
           hypothetical protein
          Length = 445

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 18/32 (56%)

Query: 349 MLPCGHILHMNCLKNWMERSQTCPMCRLPVFN 380
           M PCGH +H +C +     S  CP C++ V N
Sbjct: 237 MSPCGHAIHQHCFEEHTRHSYKCPHCQVTVLN 268

>SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly
           similar to uniprot|Q12161 Saccharomyces cerevisiae
           YOL054W PSH1 Nuclear protein putative RNA polymerase II
           elongation factor isolated as Pob3p/Spt16p- binding
           protein
          Length = 331

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 4/36 (11%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQ----TCPMCRLPV 378
           P M  CGH    +C+ NW+  +     TCP CR  V
Sbjct: 4   PVMTSCGHNYCYDCISNWLNNNNATELTCPQCRTSV 39

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score = 35.0 bits (79), Expect = 0.13,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 3/27 (11%)

Query: 352 CGHILHMNCLKNWMERSQT---CPMCR 375
           C H  H++C++ W+E +     CPMCR
Sbjct: 62  CNHNFHVHCIQQWLETATAKGLCPMCR 88

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%)

Query: 350 LPCGHILHMNCLKNWMERSQTCPMCRLPVF 379
           +PC H  H  CL  W  ++  CP+CR   F
Sbjct: 258 IPCQHTFHCQCLDKW--KNSQCPVCRYSSF 285

>SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008W APC11
           Catalytic core subunit of the Anaphase- Promoting
           Complex/Cyclosome (APC/C) which is a ubiquitin- protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 144

 Score = 35.0 bits (79), Expect = 0.14,   Method: Composition-based stats.
 Identities = 16/66 (24%), Positives = 31/66 (46%), Gaps = 5/66 (7%)

Query: 315 QHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKML--PCGHILHMNCLKNWMERSQT-- 370
           QH+    E+ +C IC    +       +   +  ++   C H  H++C+  W++ + +  
Sbjct: 25  QHEAADTEEDVCGICRVSYNGTCPSCKYPGDECPLVVGECNHNFHVHCIVQWLDTATSRG 84

Query: 371 -CPMCR 375
            CPMCR
Sbjct: 85  LCPMCR 90

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 350 LP-CGHILHMNCLKNWMERSQTCPMCRLPVFNEK 382
           LP C H   + CL  W+ RS TCP+CR  V   +
Sbjct: 132 LPHCHHKFDLECLSVWLSRSTTCPLCRDDVMGHR 165

>YOL054W Chr15 (228614..229834) [1221 bp, 406 aa] {ON}  PSH1E3
           ubiquitin ligase that mediates poyubiquitination and
           degradation of centromere-binding protein Cse4p and
           prevents Cse4p from mislocalizing to euchromatin;
           ubiquitylation of Cse4p may be antagonized by Scm3p
          Length = 406

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 33/91 (36%), Gaps = 29/91 (31%)

Query: 308 DQLPTVTQHQLDSMEDKI---------CIICMDDLSINSIQKNFEKRKPKMLPCGHILHM 358
           D+L     HQ D  +D I         C IC D + +           P M PCGH    
Sbjct: 3   DELHNRLLHQNDGTKDAILYKIIESLVCSICHDYMFV-----------PMMTPCGHNYCY 51

Query: 359 NCLKNW----MERSQTCPMCR-----LPVFN 380
            CL  W     ++   CP CR     +P  N
Sbjct: 52  GCLNTWFASNTQKELACPQCRSDITTIPALN 82

>KNAG0J01560 Chr10 (287736..288665) [930 bp, 309 aa] {ON} Anc_5.628
           YDR265W
          Length = 309

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 14/29 (48%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           P   PCGH    +CL  W      CP+CR
Sbjct: 268 PSCAPCGHTYCWDCLFKWCNERPECPLCR 296

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 350 LP-CGHILHMNCLKNWMERSQTCPMCRLPVFNEK 382
           LP C H   + CL  W+ RS TCP+CR  V   +
Sbjct: 127 LPHCHHKFDLECLSVWLSRSTTCPLCRDNVMGHR 160

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 33.9 bits (76), Expect = 0.20,   Method: Composition-based stats.
 Identities = 9/26 (34%), Positives = 15/26 (57%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLP 377
           CGH  H++C+  W++    CP+   P
Sbjct: 81  CGHAFHLHCINKWIKTRDACPLDNQP 106

>TBLA0B02670 Chr2 (615206..616642) [1437 bp, 478 aa] {ON} Anc_8.808
           YOL054W
          Length = 478

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 26/65 (40%), Gaps = 20/65 (30%)

Query: 325 ICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQ----TCPMCR----- 375
           +C IC D + +           P + PCGH     CL +W   S     +CP CR     
Sbjct: 29  VCSICQDYMFV-----------PMVTPCGHSFCYGCLCSWFSSSNVDGLSCPHCRTSITS 77

Query: 376 LPVFN 380
            P FN
Sbjct: 78  APYFN 82

>Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W -
           Hypothetical ORF [contig 36] FULL
          Length = 300

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 4/36 (11%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQ----TCPMCRLPV 378
           P M  CGH    +C+ NW+  +     TCP CR P+
Sbjct: 4   PVMTTCGHNYCYDCISNWLVSNNANELTCPQCRSPL 39

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 349  MLPCGHILHMNCLKNWMERSQTCPMCR 375
            M+ CGH    NC+ +W++ +  CP+C+
Sbjct: 1283 MISCGHFFCNNCIFSWLKLNSNCPLCK 1309

>AAR147W Chr1 (608865..613607) [4743 bp, 1580 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YOR191W (RIS1)
          Length = 1580

 Score = 35.8 bits (81), Expect = 0.27,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 12/64 (18%)

Query: 312  TVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTC 371
            TV+Q    S+E+ IC  CM+ + I S+          + PCGH+L   C++ ++E ++  
Sbjct: 1275 TVSQ----SLENMICPFCMEQMEIESLS--------VLTPCGHLLCDACVEPYLEDARES 1322

Query: 372  PMCR 375
               R
Sbjct: 1323 EYAR 1326

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 2/31 (6%)

Query: 350 LPCGHILHMNCLKNWMERSQTCPMCRLPVFN 380
           +PC H  H  CL  W  ++  CP+CR    N
Sbjct: 258 IPCSHTFHCQCLDKW--KNSKCPVCRHTNLN 286

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 2/30 (6%)

Query: 350 LPCGHILHMNCLKNWMERSQTCPMCRLPVF 379
           +PC H  H  CL  W  ++  CP+CR   F
Sbjct: 188 IPCQHTFHCQCLNRW--KNSKCPVCRYSSF 215

>KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some
           similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 306

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 4/36 (11%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQ----TCPMCRLPV 378
           P M  CGH     C+ NW+  +     TCP CR P+
Sbjct: 4   PVMTSCGHNYCYECISNWLVSNNANELTCPQCRSPL 39

>CAGL0J04796g Chr10 (456300..458099) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q06436 Saccharomyces cerevisiae YLR427w
          Length = 599

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 26/65 (40%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWME----------------RSQ 369
           C IC++++ +           P+M+ CGHI  M+CL+N+ E                + +
Sbjct: 152 CPICLNEIPV----------APRMVTCGHIFCMSCLENFFEIEEVVKNPETGIKQKKKFK 201

Query: 370 TCPMC 374
            CP+C
Sbjct: 202 ECPLC 206

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 15/30 (50%), Gaps = 2/30 (6%)

Query: 350 LPCGHILHMNCLKNWMERSQTCPMCRLPVF 379
           +PC H  H  CL  W  ++  CP+CR    
Sbjct: 300 IPCQHTFHCQCLNKW--KNSKCPICRFSTL 327

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
           {ON} weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 273

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 12/55 (21%)

Query: 326 CIICMDD--LSINSIQKNFEKRKPKMLPCGHILHMNCLKNWM--ERSQTCPMCRL 376
           C IC+DD   +I SI          + PC H  H +CL+ W        CP+CR+
Sbjct: 5   CPICLDDDRTNIESI--------GTLQPCNHKFHRDCLRRWHLYAHDLVCPICRV 51

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} similar
           to uniprot|Q06834 Saccharomyces cerevisiae YPR093C ASR1
           Protein involved in a putative alcohol- responsive
           signaling pathway accumulates in the nucleus under
           alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 10/54 (18%)

Query: 324 KICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQ--TCPMCR 375
           +IC IC++ ++        E  + ++LPC H  H++C++ W   S    CP CR
Sbjct: 3   EICGICLESMN--------ETDQGELLPCEHRYHVSCIRKWHLYSNDFKCPTCR 48

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 34.3 bits (77), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 349 MLP-CGHILHMNCLKNWMERSQTCPMCR 375
            LP CGH     C+  W+ +++TCP+CR
Sbjct: 123 QLPHCGHHFDFECISIWLSKNETCPICR 150

>Smik_15.113 Chr15 (194228..195448) [1221 bp, 406 aa] {ON} YOL054W
           (REAL)
          Length = 406

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 25/65 (38%), Gaps = 20/65 (30%)

Query: 325 ICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNW----MERSQTCPMCR----- 375
           +C IC D + +           P M PCGH     CL  W     ++   CP CR     
Sbjct: 29  VCSICHDYMFV-----------PMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDITT 77

Query: 376 LPVFN 380
           +P  N
Sbjct: 78  IPALN 82

>Suva_10.344 Chr10 complement(595952..600634) [4683 bp, 1560 aa] {ON}
            YLR247C (REAL)
          Length = 1560

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 12/50 (24%), Positives = 23/50 (46%), Gaps = 11/50 (22%)

Query: 326  CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
            C IC+ ++ + +I           + CGH    +C+  W+     CP+C+
Sbjct: 1243 CSICLGEVEVGAI-----------IKCGHYFCKSCILTWLRSHSKCPICK 1281

>YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}
            IRC20Putative helicase; localizes to the mitochondrion
            and the nucleus; YLR247C is not an essential gene; null
            mutant displays increased levels of spontaneous Rad52p
            foci
          Length = 1556

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 23/50 (46%), Gaps = 11/50 (22%)

Query: 326  CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
            C IC+ ++ I +I           + CGH    +C+  W+     CP+C+
Sbjct: 1239 CSICLGEVEIGAI-----------IKCGHYFCKSCILTWLRAHSKCPICK 1277

>KNAG0I02880 Chr9 complement(562281..563666) [1386 bp, 461 aa] {ON}
           Anc_6.332 YCR066W
          Length = 461

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 13/58 (22%)

Query: 317 QLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMC 374
           QLDS+    C IC D L +           P + PCGH     C++  + +S  CP+C
Sbjct: 21  QLDSL--LRCHICKDFLKV-----------PVLTPCGHTFCSICIREAINKSAKCPLC 65

>KAFR0H00710 Chr8 (132097..132783) [687 bp, 228 aa] {ON} Anc_3.405
           YPR093C
          Length = 228

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 9/55 (16%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQ--TCPMCRLPV 378
           C IC++DL+ N I         ++ PC H  H+ C++ W   S    CP C+   
Sbjct: 3   CPICLEDLAANDI-------ISELKPCNHKYHLVCIRKWQLDSNQLKCPYCQCKT 50

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 350 LPCGHILHMNCLKNWMERSQTCPMCR 375
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 252 IPCQHTFHCQCLDKW--KNSKCPVCR 275

>Kpol_480.22 s480 (52842..54119) [1278 bp, 425 aa] {ON}
           (52842..54119) [1278 nt, 426 aa]
          Length = 425

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 15/58 (25%)

Query: 325 ICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQT----CPMCRLPV 378
           +C IC D + +           P M+ CGH    +CL +W   ++T    CP CR  V
Sbjct: 35  LCSICHDYMYV-----------PMMVACGHNYCYSCLSSWFTSNETQELSCPQCRANV 81

>Skud_15.102 Chr15 (187319..188539) [1221 bp, 406 aa] {ON} YOL054W
           (REAL)
          Length = 406

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 25/65 (38%), Gaps = 20/65 (30%)

Query: 325 ICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNW----MERSQTCPMCR----- 375
           +C IC D + +           P M PCGH     CL  W     ++   CP CR     
Sbjct: 29  VCSICHDYMFV-----------PMMTPCGHNYCYGCLNTWFASNTQKELACPQCRSDIVI 77

Query: 376 LPVFN 380
           +P  N
Sbjct: 78  IPALN 82

>Suva_15.115 Chr15 (200851..202086) [1236 bp, 411 aa] {ON} YOL054W
           (REAL)
          Length = 411

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 25/65 (38%), Gaps = 20/65 (30%)

Query: 325 ICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNW----MERSQTCPMCR----- 375
           IC IC D + +           P M PCGH     CL  W     ++   CP CR     
Sbjct: 29  ICSICHDYMFV-----------PMMTPCGHNYCYGCLNTWFSSNTQKELACPQCRSDITT 77

Query: 376 LPVFN 380
           +P  N
Sbjct: 78  IPALN 82

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 350 LPCGHILHMNCLKNWMERSQTCPMCR 375
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 33.9 bits (76), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 10/69 (14%)

Query: 308 DQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLP-CGHILHMNCLKNWME 366
           D LP V +   D + + +C IC ++   +      E      LP C H   + C+  W+ 
Sbjct: 72  DSLPRVPK---DKIPNDLCSICFENFREDEYPLVIE------LPHCSHKFDLQCISVWLS 122

Query: 367 RSQTCPMCR 375
            + TCP+CR
Sbjct: 123 SNSTCPVCR 131

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 26/65 (40%), Gaps = 9/65 (13%)

Query: 311 PTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQT 370
           P     +   +E   C +C++ L       + E      +PC H  H  CL  W  +   
Sbjct: 232 PFTGHKETGDVELPTCPVCLERL-------DSEVTGLATIPCQHTFHCQCLNKW--KDSR 282

Query: 371 CPMCR 375
           CP+CR
Sbjct: 283 CPVCR 287

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 350 LPCGHILHMNCLKNWMERSQTCPMCR 375
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 251 IPCQHTFHCQCLDKW--KNSKCPVCR 274

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 350 LPCGHILHMNCLKNWMERSQTCPMCR 375
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>NDAI0I00400 Chr9 complement(80973..82418) [1446 bp, 481 aa] {ON}
           Anc_6.332 YCR066W
          Length = 481

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 23/49 (46%), Gaps = 11/49 (22%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMC 374
           C IC D L           + P + PCGH     C++ +++ +  CP+C
Sbjct: 28  CHICKDFL-----------KTPVLTPCGHTFCSVCIREYLQSNSKCPLC 65

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 350 LPCGHILHMNCLKNWMERSQTCPMCR 375
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 350 LPCGHILHMNCLKNWMERSQTCPMCR 375
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 257 IPCQHTFHCQCLNKW--KNSRCPVCR 280

>NDAI0D02810 Chr4 complement(650919..651677) [759 bp, 252 aa] {ON} 
          Length = 252

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 44/105 (41%), Gaps = 34/105 (32%)

Query: 306 LDDQLPTVTQHQLDSMEDKI-----CIICMDDLSINSIQKNFEKR-------------KP 347
           +D ++P     ++ + +D+I     CIIC++ + +     + EK+             K 
Sbjct: 124 MDKKIPIDRFVEMSTKDDRIPINECCIICLERVKVVPSTNDLEKQQNGTEQTTDMIPSKV 183

Query: 348 KMLPCGHILHMNCLKNWME------RSQT----------CPMCRL 376
             LPC H  H  C+K+W        +S T          CP+CRL
Sbjct: 184 VKLPCEHYFHKCCIKDWFSTIRKGMKSSTHSFAIGPTYFCPLCRL 228

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 350 LPCGHILHMNCLKNWMERSQTCPMCR 375
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 255 IPCQHTFHCQCLDKW--KNSRCPVCR 278

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 11/52 (21%)

Query: 326 CIICMDDLS-INSIQKNFEKRKPKMLPCGHILHMNCLKNWMER-SQTCPMCR 375
           C IC +D + +N++          +L C H+ H  C+  W+ R S  CP+C+
Sbjct: 120 CAICQEDFNKLNNVC---------LLGCNHVFHTYCIDQWICRNSACCPLCK 162

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 350 LPCGHILHMNCLKNWMERSQTCPMCR 375
           +PC H  H  CL  W  ++  CP+CR
Sbjct: 251 IPCQHTFHCQCLDKW--KNSRCPVCR 274

>Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)
           [1008 nt, 336 aa]
          Length = 335

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 11/57 (19%)

Query: 321 MEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQ--TCPMCR 375
           M D  C IC ++         F++ +  + PC H  H+ C++ W   +    CP CR
Sbjct: 1   MSDLECAICFEE---------FKEDRCALNPCHHTFHLECIRIWHSYADDLKCPTCR 48

>SAKL0B08976g Chr2 complement(766719..767687) [969 bp, 322 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093C ASR1 Protein involved in a putative
           alcohol-responsive signaling pathway accumulates in the
           nucleus under alcohol stress contains a Ring/PHD finger
           domain
          Length = 322

 Score = 34.3 bits (77), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 11/53 (20%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQ--TCPMCRL 376
           C IC++ L  N           +++ C H  H+ C++ W   SQ   CP CR+
Sbjct: 6   CSICLEALGQNI---------GRLVTCQHEYHLECIREWHNHSQDFKCPTCRV 49

>AAL146W Chr1 (92509..98211) [5703 bp, 1900 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR184C (UBR1)
          Length = 1900

 Score = 34.7 bits (78), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 27/51 (52%), Gaps = 6/51 (11%)

Query: 331  DDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQ------TCPMCR 375
            DDL + S+Q+  +      + C HI+H  C + ++++ +       CP+C+
Sbjct: 1245 DDLKLYSLQEARKGSTTTFVSCNHIIHYECFRRYIQKKRFSNNLFICPLCQ 1295

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 33.5 bits (75), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 32/64 (50%), Gaps = 11/64 (17%)

Query: 322 EDKICIICMDDLSINSIQKNFEKRKP---KMLPCGHILHMNCLKNWMERSQTCPMCRLPV 378
           +D+IC IC          K F+   P   ++  C H   + C+  W++++ +CP+CR  V
Sbjct: 111 KDEICSICR--------CKFFDDDYPLIIELPNCKHYFDLECITLWLQKNSSCPICRNDV 162

Query: 379 FNEK 382
             +K
Sbjct: 163 LEKK 166

>AAL030C Chr1 complement(284758..289377) [4620 bp, 1539 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR247C
          Length = 1539

 Score = 34.7 bits (78), Expect = 0.65,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 11/50 (22%)

Query: 326  CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCR 375
            C IC+ D+   +I           +  GH     C+ +W+E  Q+CP+C+
Sbjct: 1219 CTICLCDICDGAI-----------IGRGHFYCQECISSWLETKQSCPLCK 1257

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 32.3 bits (72), Expect = 0.67,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLP 377
           C H  H++C+  W++    CP+   P
Sbjct: 78  CNHAFHLHCINKWLQTRNACPLDNQP 103

>ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116W DMA2 Protein involved in regulating spindle
           position and orientation functionally redundant with
           Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 579

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 56/137 (40%), Gaps = 15/137 (10%)

Query: 245 GKFI-YEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWKIWVN- 302
           G F+ ++++    T    T+IH   ++   M      + +   V +   IN  WK   N 
Sbjct: 410 GTFLNHQRLAPASTMSKDTLIHDGDILQLGMDFRGGTEEIYRCVKMRVEINRSWKRRANA 469

Query: 303 -NRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCL 361
            N++   ++  + Q     +E++ C IC+    I   Q  F      + PC H  H  C+
Sbjct: 470 FNKEALQRIKNI-QRMTMGLEEEDCSICLSK--IKPCQAMF------ISPCSHSWHFQCI 520

Query: 362 KNWMERSQT---CPMCR 375
           +  +  S     CP CR
Sbjct: 521 RRLVMTSYPQFVCPNCR 537

>YPR093C Chr16 complement(719558..720424) [867 bp, 288 aa] {ON}
           ASR1Ubiquitin ligase that modifies and regulates RNA Pol
           II; involved in a putative alcohol-responsive signaling
           pathway; accumulates in the nucleus under alcohol
           stress; contains a Ring/PHD finger domain similar to the
           mammalian rA9 protein
          Length = 288

 Score = 33.9 bits (76), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%), Gaps = 2/27 (7%)

Query: 352 CGHILHMNCLKNWMERS--QTCPMCRL 376
           CGH  H+NC++ W + S    CP+CR+
Sbjct: 23  CGHKFHLNCIREWHKYSINLKCPICRV 49

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 35/75 (46%), Gaps = 7/75 (9%)

Query: 308 DQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMER 367
           D LP +   ++   ED  C IC       + +++      ++  C H   + C+  W+ +
Sbjct: 87  DSLPRIPASKI--KEDDSCPIC-----CCTYKEDDHPLVAELPHCNHKFDLECISVWLSK 139

Query: 368 SQTCPMCRLPVFNEK 382
           S +CP+CR  V + K
Sbjct: 140 STSCPLCRDDVMSHK 154

>ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {ON}
           similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 160

 Score = 33.1 bits (74), Expect = 0.78,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 28/59 (47%), Gaps = 5/59 (8%)

Query: 322 EDKICIICMDDLSINSIQKNFEKRKPKML--PCGHILHMNCLKNWMERSQT---CPMCR 375
           +D +C IC    +       +   +  ++   C H  H++C+  W++ + +   CPMCR
Sbjct: 32  DDDVCGICRASYNATCPSCKYPGDECSLVVGECNHNFHVHCIYRWLDTTTSKGLCPMCR 90

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 350 LPCGHILHMNCLKNWMERSQTCPMCR 375
           +PC H  H  CL  W  +   CP+CR
Sbjct: 254 IPCQHTFHCQCLDKW--KDSRCPVCR 277

>AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL054W (PSH1)
          Length = 414

 Score = 34.3 bits (77), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 15/59 (25%)

Query: 321 MEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQT----CPMCR 375
           +E  IC IC D + +           P M  CGH     C+ NW+  + +    CP CR
Sbjct: 33  LETTICTICHDYMYV-----------PVMTGCGHNYCYFCISNWLNNTSSTELNCPQCR 80

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 32.3 bits (72), Expect = 0.82,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 15/26 (57%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLP 377
           C H  H++C+  W++  + CP+   P
Sbjct: 89  CNHAFHLHCINKWIKTREACPLDNQP 114

>KLLA0E06469g Chr5 complement(581935..584832) [2898 bp, 965 aa] {ON}
           similar to uniprot|P38164 Saccharomyces cerevisiae
           YBL104C Hypothetical ORF
          Length = 965

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 14/71 (19%)

Query: 310 LPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKM-------LPCGHILHMNCLK 362
           LP V     +S E +I     DD  IN ++   E+++ KM       L C H +H    +
Sbjct: 893 LPIVINGTTNSCEVRI----DDDAKINEVK---ERKRLKMNEWFSFCLKCNHGMHAGHAE 945

Query: 363 NWMERSQTCPM 373
            W ER   CP+
Sbjct: 946 EWFERHSICPV 956

>TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON}
           Anc_3.190 YDL008W
          Length = 153

 Score = 32.7 bits (73), Expect = 0.93,   Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 3/35 (8%)

Query: 352 CGHILHMNCLKNWMERSQT---CPMCRLPVFNEKG 383
           C H  H++C+  W++ + +   CPMCR     +KG
Sbjct: 67  CNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKG 101

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score = 32.7 bits (73), Expect = 0.93,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 352 CGHILHMNCLKNWMERSQT---CPMCR 375
           C H  H++C+K W+    +   CP+CR
Sbjct: 87  CNHNFHVHCIKQWLSTETSKGLCPLCR 113

>TDEL0B00890 Chr2 (170522..172144) [1623 bp, 540 aa] {ON} Anc_8.808
           YOL054W
          Length = 540

 Score = 33.9 bits (76), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 4/38 (10%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQ----TCPMCRLPVFN 380
           P M  CGH    +CL  W E +     +CP CR  V N
Sbjct: 40  PMMTQCGHNYCYDCLLAWFESNPEEELSCPQCRASVIN 77

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 32.3 bits (72), Expect = 0.98,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLP 377
           C H  H++C+  W++    CP+   P
Sbjct: 105 CNHAFHLHCINKWLQTRNACPLDNQP 130

>AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL008W
           (APC11)
          Length = 147

 Score = 32.7 bits (73), Expect = 0.99,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 352 CGHILHMNCLKNWMERSQT---CPMCR 375
           C H  H++C+  W+  S +   CPMCR
Sbjct: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92

>NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {ON}
           Anc_8.808 YOL054W
          Length = 392

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 15/59 (25%)

Query: 321 MEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWM----ERSQTCPMCR 375
           +E  IC IC + + +           P M  CGH     CLK+W+    ++   CP CR
Sbjct: 25  LESAICTICSEYMFV-----------PMMTSCGHNYCYGCLKSWISTNSKKELACPQCR 72

>TDEL0E04390 Chr5 (819719..825592) [5874 bp, 1957 aa] {ON} Anc_5.190
            YGR184C
          Length = 1957

 Score = 34.3 bits (77), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query: 331  DDLSINSIQKNFEKRKPKML-PCGHILHMNCLKNWMERSQ------TCPMCRLPVFNEKG 383
            DD S+ + + N  +   K+L  C H +H +C K ++++ +       CP+C+        
Sbjct: 1264 DDKSLENFRDNGSRGSKKVLVSCNHSVHHSCFKRYVQKKRFSSNAFICPLCQ----TYSN 1319

Query: 384  EVLPTRR 390
             VLP RR
Sbjct: 1320 CVLPIRR 1326

>Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON}
           similar to Ashbya gossypii AER016C
          Length = 148

 Score = 32.7 bits (73), Expect = 1.00,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 3/27 (11%)

Query: 352 CGHILHMNCLKNWMERSQT---CPMCR 375
           C H  H++C+  W+  S +   CPMCR
Sbjct: 66  CHHNFHVHCIYQWLNTSTSKGLCPMCR 92

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 32.0 bits (71), Expect = 1.0,   Method: Composition-based stats.
 Identities = 7/22 (31%), Positives = 13/22 (59%)

Query: 352 CGHILHMNCLKNWMERSQTCPM 373
           C H  H++C+  W++    CP+
Sbjct: 77  CNHAFHLHCINKWLQTRNACPL 98

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 27/65 (41%), Gaps = 9/65 (13%)

Query: 311 PTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQT 370
           P   + ++   E   C +C++ L       + E      +PC H  H  CL  W +    
Sbjct: 212 PFTAKKEVQDTELPTCPVCLERL-------DSEVTGLATIPCQHTFHCVCLNKWGD--NR 262

Query: 371 CPMCR 375
           CP+CR
Sbjct: 263 CPVCR 267

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 349  MLPCGHILHMNCLKNWM--ERSQTCP 372
            +LPCGH  H  C++ W   E  Q CP
Sbjct: 1307 ILPCGHEGHFQCIQEWFLDENEQECP 1332

>Kpol_1028.46 s1028 complement(110464..110775,110777..111811) [1347
           bp, 448 aa] {ON}
           complement(110464..110775,110777..111811) [1347 nt, 449
           aa]
          Length = 448

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 11/49 (22%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMC 374
           C IC D L I           P + PCGH     C+++++     CP+C
Sbjct: 29  CHICKDFLRI-----------PVLTPCGHTFCSICIRSYVNSESKCPLC 66

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 32.0 bits (71), Expect = 1.2,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLP 377
           C H  H++C+  W++    CP+   P
Sbjct: 90  CNHAFHLHCINKWIQTRDACPLDNQP 115

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 350 LPCGHILHMNCLKNWMERSQTCPMCR 375
           +PC H  H +CL  W +    CP+CR
Sbjct: 285 IPCQHTFHCSCLDKWND--SRCPVCR 308

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 31.6 bits (70), Expect = 1.2,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 22/52 (42%), Gaps = 4/52 (7%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMCRLP 377
           C+ C  + + NS  +           C H  H++C+  W++    CP+   P
Sbjct: 55  CVNCQQEATFNSEHECVAAWGE----CNHAFHLHCITQWIKSRNVCPLDNKP 102

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
           RING-box protein
          Length = 102

 Score = 31.6 bits (70), Expect = 1.2,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLP 377
           C H  H++C+  W++    CP+   P
Sbjct: 69  CNHAFHLHCINKWIKTRDACPLDNQP 94

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 3/38 (7%)

Query: 351 PCGHILHMNCLKNWMERSQTCPMCRLPVFNE-KGEVLP 387
           PC H  H  CL  W  ++  CP+CR     +   E LP
Sbjct: 233 PCQHTFHCKCLDQW--KNGNCPVCRYSQLKDVNNEPLP 268

>NCAS0J01850 Chr10 (347959..349902) [1944 bp, 647 aa] {ON} Anc_4.308
           YLR427W
          Length = 647

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 54/124 (43%), Gaps = 44/124 (35%)

Query: 293 INTIWKIWVNNR-----KLDDQLPTVTQHQLDSM---EDKICIICMDDLSINSIQKNFEK 344
           IN  +K++VN+R     + +D    V + ++  +   + + C IC+ +  I         
Sbjct: 136 INANYKLFVNDRADYREQSNDPNKLVPEEKIIRVVVPKGQNCPICLSEEPI--------- 186

Query: 345 RKPKMLPCGHILHMNCLKNW----------------MERSQTCPMCRLPVFNEKGEVLPT 388
             P+M+ CGHI  M+CL N+                 ++ + CP+C        G ++  
Sbjct: 187 -APRMITCGHIFCMSCLINFFSIEETIKNPETGYVKKKKYKECPLC--------GSIV-- 235

Query: 389 RRER 392
           RRER
Sbjct: 236 RRER 239

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 2/26 (7%)

Query: 349  MLPCGHILHMNCLKNWM--ERSQTCP 372
            +LPCGH  H  C++ W   E+ + CP
Sbjct: 1302 LLPCGHEGHFQCIQEWFLNEKERECP 1327

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 31.6 bits (70), Expect = 1.3,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLP 377
           C H  H++C+  W++    CP+   P
Sbjct: 74  CNHAFHLHCINKWIKTRDACPLDNQP 99

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 31.6 bits (70), Expect = 1.4,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLP 377
           C H  H++C+  W++    CP+   P
Sbjct: 76  CNHAFHLHCINKWIKTRDACPLDNQP 101

>CAGL0J03586g Chr10 complement(343893..345128) [1236 bp, 411 aa]
           {ON} similar to uniprot|P10862 Saccharomyces cerevisiae
           YCR066w RAD18 DNA repair protein
          Length = 411

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 330 MDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMC 374
           +DDL    I K+F K  P + PCGH     C++ ++     CP+C
Sbjct: 21  LDDLLRCHICKDFLK-NPVLTPCGHTFCSLCIRGYLSNEPKCPLC 64

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 31.6 bits (70), Expect = 1.4,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLP 377
           C H  H++C+  W++    CP+   P
Sbjct: 78  CNHAFHLHCINKWIKTRDACPLDNQP 103

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 31.6 bits (70), Expect = 1.6,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLP 377
           C H  H++C+  W++    CP+   P
Sbjct: 83  CNHAFHLHCINKWIKTRDACPLDNQP 108

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 31.6 bits (70), Expect = 1.6,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLP 377
           C H  H++C+  W++    CP+   P
Sbjct: 85  CNHAFHLHCINKWIKTRDACPLDNQP 110

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 31.6 bits (70), Expect = 1.6,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLP 377
           C H  H++C+  W++    CP+   P
Sbjct: 85  CNHAFHLHCINKWIKTRDACPLDNQP 110

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 17/31 (54%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLPVFNEK 382
           C H   + C+  W+ +S TCP+CR  V   K
Sbjct: 70  CNHRFDLECISVWLSKSVTCPLCRDNVLEHK 100

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 31.6 bits (70), Expect = 1.7,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLP 377
           C H  H++C+  W++    CP+   P
Sbjct: 88  CNHAFHLHCINKWIKTRDACPLDNQP 113

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 31.6 bits (70), Expect = 1.7,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLP 377
           C H  H++C+  W++    CP+   P
Sbjct: 88  CNHAFHLHCINKWIKTRDACPLDNQP 113

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 31.6 bits (70), Expect = 1.7,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLP 377
           C H  H++C+  W++    CP+   P
Sbjct: 88  CNHAFHLHCINKWIKTRDACPLDNQP 113

>ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]
           {ON} some similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 445

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 28/63 (44%), Gaps = 14/63 (22%)

Query: 321 MEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQ---TCPMCRLP 377
           +E  IC IC D + +           P M  CGH    +CL +W + +    +CP CR  
Sbjct: 25  LESLICSICHDLMFV-----------PVMTQCGHNYCYDCLSSWFDSNSNELSCPQCRAS 73

Query: 378 VFN 380
           + +
Sbjct: 74  ISD 76

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 31.6 bits (70), Expect = 1.7,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 14/26 (53%)

Query: 352 CGHILHMNCLKNWMERSQTCPMCRLP 377
           C H  H++C+  W++    CP+   P
Sbjct: 89  CNHAFHLHCINKWIKTRDACPLDNQP 114

>CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highly
            similar to uniprot|Q03897 Saccharomyces cerevisiae
            YDR128w
          Length = 1120

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 352  CGHILHMNCLKNWMERSQTCPM---CRLP 377
            C H+LH+ C K W   S+ CP    C  P
Sbjct: 1086 CQHVLHLKCSKEWWNVSKECPTGCGCNCP 1114

>ZYRO0D08404g Chr4 complement(728281..729510) [1230 bp, 409 aa] {ON}
           similar to uniprot|P10862 Saccharomyces cerevisiae
           YCR066W RAD18 Protein involved in postreplication repair
           binds single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 409

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 21/49 (42%), Gaps = 11/49 (22%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMC 374
           C IC D L I           P + PC H     C++ ++ R   CP+C
Sbjct: 28  CHICKDLLKI-----------PVLTPCSHTFCSLCIREYLTREPKCPLC 65

>KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3.22
            YOL138C
          Length = 1365

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 12/59 (20%)

Query: 323  DKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNW--MERSQTCP-MCRLPV 378
            + +C++C + +   +I          +L CGH  H +C K W   E   +CP  C  P+
Sbjct: 1314 NSLCVLCEEPMKKMTIS---------LLACGHEGHFDCFKKWFIQEAMDSCPGGCTHPI 1363

>KLLA0E07591g Chr5 (685564..686559) [996 bp, 331 aa] {ON} similar to
           uniprot|Q75DF9 Ashbya gossypii ABR067C ABR067Cp and
           weakly similar to YMR026C uniprot|Q04370 Saccharomyces
           cerevisiae YMR026C PEX12 RING-finger peroxisomal
           membrane peroxin that plays an essential role in
           peroxisome biogenesis and peroxisomal matrix protein
           import forms translocation subcomplex with Pex2p and
           Pex10p
          Length = 331

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/69 (20%), Positives = 31/69 (44%), Gaps = 11/69 (15%)

Query: 310 LPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQ 369
           LP V     ++    +C +C ++++           +P M+  G++ ++ C K W+    
Sbjct: 265 LPGVASEVDNNDTTDVCPLCGEEIT-----------EPAMISSGYVANLECAKKWVSTEN 313

Query: 370 TCPMCRLPV 378
           TC    +P+
Sbjct: 314 TCFATGVPI 322

>SAKL0A01474g Chr1 complement(140890..142296) [1407 bp, 468 aa] {ON}
           similar to gnl|GLV|CAGL0J03586g Candida glabrata
           CAGL0J03586g and weakly similar to YCR066W
           uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 468

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 11/49 (22%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMC 374
           C +C D L           + P + PCGH     C++ ++ R   CP+C
Sbjct: 44  CHVCKDFL-----------KTPVLTPCGHTFCSLCIREYLNRELKCPLC 81

>TDEL0B05200 Chr2 (914227..915801) [1575 bp, 524 aa] {ON} Anc_2.157
           YHR115C
          Length = 524

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 57/138 (41%), Gaps = 15/138 (10%)

Query: 245 GKFI-YEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIWKIWVN- 302
           G F+ ++++    T    T+IH   ++   M      + +   V +   +N  WK   N 
Sbjct: 353 GTFLNHQRLAPASTLSKDTLIHDGDVLQLGMDFRGGTEEIYRCVKIRVELNRSWKRRANA 412

Query: 303 -NRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCL 361
            N++   ++  + Q     +E++ C IC+    I   Q  F      + PC H  H  C+
Sbjct: 413 FNKEAIQRIRNL-QKLTTGVEEEDCSICLS--KIKPCQAMF------ISPCSHCWHFQCI 463

Query: 362 KNWMERSQT---CPMCRL 376
           +  +  S     CP CRL
Sbjct: 464 RRLVMTSYPQFVCPNCRL 481

>KNAG0G03280 Chr7 complement(703783..704838) [1056 bp, 351 aa] {ON}
           Anc_8.808 YOL054W
          Length = 351

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 15/55 (27%)

Query: 325 ICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQT----CPMCR 375
           +C IC + +S+           P M+ CGH     CLK+W+  ++     CP CR
Sbjct: 28  VCTICHELMSV-----------PMMVECGHNYCYTCLKHWLTSNENTVLKCPDCR 71

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
            YOL138C (REAL)
          Length = 1332

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 349  MLPCGHILHMNCLKNWM--ERSQTCP 372
            +LPCGH  H  C++ W   E+   CP
Sbjct: 1298 ILPCGHEGHFQCIQEWFLDEKEHECP 1323

>TDEL0A07470 Chr1 (1302286..1303512) [1227 bp, 408 aa] {ON}
           Anc_6.332 YCR066W
          Length = 408

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 345 RKPKMLPCGHILHMNCLKNWMERSQTCPMC 374
           R P + PCGH     C++ ++ +   CP+C
Sbjct: 36  RVPVLTPCGHTFCSLCIRQYLRQDPKCPLC 65

>KAFR0D01670 Chr4 complement(332442..333515) [1074 bp, 357 aa] {ON}
           Anc_8.808 YOL054W
          Length = 357

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 27/65 (41%), Gaps = 21/65 (32%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKML-PCGHILHMNCL----KNWMERSQTCPMCRL---- 376
           C IC + LSI           P M+ PCGH     CL    KN   R   CP CR+    
Sbjct: 33  CNICHEILSI-----------PMMVTPCGHTYCYECLLTWFKNNENRELNCPDCRVSIEV 81

Query: 377 -PVFN 380
            P FN
Sbjct: 82  EPCFN 86

>Kwal_56.23543 s56 complement(591514..594411) [2898 bp, 965 aa] {ON}
           YDR103W (STE5) - scaffold protein for MAP kinase cascade
           [contig 176] FULL
          Length = 965

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 11/56 (19%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTC------PMCR 375
           C +C++ +S  ++ +     K   L CGH++H  CL  + E   +C      P CR
Sbjct: 162 CCLCLEYISCRTVGE-----KVVSLECGHLVHEECLMTYFENPTSCHIDELFPFCR 212

>KLTH0A06556g Chr1 (545636..547018) [1383 bp, 460 aa] {ON} similar
           to uniprot|P10862 Saccharomyces cerevisiae YCR066W RAD18
           Protein involved in postreplication repair binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity forms heterodimer with Rad6p
           contains RING-finger motif
          Length = 460

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 10/30 (33%), Positives = 17/30 (56%)

Query: 345 RKPKMLPCGHILHMNCLKNWMERSQTCPMC 374
           + P + PCGH     C++ ++ R   CP+C
Sbjct: 45  KTPVLTPCGHTFCSLCIREYLNRELKCPLC 74

>AER113W Chr5 (848584..850581) [1998 bp, 665 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR427W (MAG2)
          Length = 665

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 25/52 (48%), Gaps = 10/52 (19%)

Query: 310 LPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCL 361
           LP  +  ++ +   + C IC+ +  +           P+M PCGHIL M C+
Sbjct: 213 LPADSIRRVVAPRGQACPICLAEEVV----------APRMAPCGHILCMTCM 254

>TPHA0C04910 Chr3 complement(1062455..1063126) [672 bp, 223 aa] {ON}
           Anc_8.869
          Length = 223

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 9/80 (11%)

Query: 304 RKLDD--QLPTVTQHQLDSMEDKICIIC--MDD-----LSINSIQKNFEKRKPKMLPCGH 354
           ++L+D  QL  +T+   D  E++  I C   DD     L+ NS   N +K    + PCG 
Sbjct: 93  KRLNDIVQLNGLTETVSDENENRRVIKCDFGDDVFIGTLNPNSNATNAQKNFVYISPCGD 152

Query: 355 ILHMNCLKNWMERSQTCPMC 374
           ++  N L    +  + CP C
Sbjct: 153 VMQRNALGLMKKSERKCPSC 172

>KNAG0H02590 Chr8 (476608..482550) [5943 bp, 1980 aa] {ON} Anc_5.190
            YGR184C
          Length = 1980

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 25/85 (29%)

Query: 297  WKIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHIL 356
            WK + NN +L       ++H + S++D        D S+N ++K F       + C H +
Sbjct: 1238 WKGFQNNAEL---AVNSSEHDVKSLQD--------DSSVN-LRKVF-------VSCNHHI 1278

Query: 357  HMNCLKNWMERSQ------TCPMCR 375
            H NC + ++++ +       CP+C+
Sbjct: 1279 HHNCFRRYIQKKRFSSTAFICPLCQ 1303

>Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {ON}
           similar to Ashbya gossypii AGL217W
          Length = 386

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 18/43 (41%), Gaps = 9/43 (20%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQT----CPMCR-----LPVFN 380
           P M  CGH     C+ NW+  +      CP CR     +P  N
Sbjct: 4   PVMTSCGHNYCYYCISNWLNNNNATELNCPQCRTTIGAMPALN 46

>NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {ON}
            Anc_3.22 YOL138C
          Length = 1393

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 25/56 (44%), Gaps = 17/56 (30%)

Query: 323  DKICIIC---MDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWM--ERSQTCPM 373
            + +C+IC   M  L++ +++            CGH  H  C KNW   E   TCP 
Sbjct: 1343 NSLCVICECPMKKLTLTALR------------CGHEAHFQCFKNWFLDEGMNTCPA 1386

>Suva_7.477 Chr7 complement(817323..823175) [5853 bp, 1950 aa] {ON}
            YGR184C (REAL)
          Length = 1950

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 13/53 (24%), Positives = 30/53 (56%), Gaps = 7/53 (13%)

Query: 330  MDDLSINSIQKNFEKRKPKM-LPCGHILHMNCLKNWMERSQ------TCPMCR 375
            +DD  + ++++N  +   K+ + C H +H NC K ++++ +       CP+C+
Sbjct: 1272 IDDEVLEALKENGTRGSRKVFVSCNHHIHHNCFKRYVQKKRFSSNAFICPLCQ 1324

>TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {ON}
           Anc_8.317 YDR143C
          Length = 698

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 347 PKMLPCGHILHMNCLKNWMERSQTCPMCR 375
           P  L C HI   +CL  W +   +CP+CR
Sbjct: 332 PVQLSCKHIFCRSCLYEWSKLKNSCPLCR 360

>Smik_16.333 Chr16 complement(596750..597622) [873 bp, 290 aa] {ON}
           YPR093C (REAL)
          Length = 290

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 9/53 (16%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERS--QTCPMCRL 376
           C IC   L I+   K F     ++  C H  H+NC++ W + S    CP+CR+
Sbjct: 4   CPIC---LEIDQEYKQF----GRLEVCRHQFHLNCIREWHKYSIDLKCPICRI 49

>Skud_3.140 Chr3 (216311..217780) [1470 bp, 489 aa] {ON} YCR066W
           (REAL)
          Length = 489

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 11/49 (22%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMC 374
           C IC D L +           P + PCGH     C++  +    +CP+C
Sbjct: 28  CHICKDFLKV-----------PVLTPCGHTFCSLCIREHLNNQPSCPLC 65

>KAFR0H02090 Chr8 complement(397562..400285) [2724 bp, 907 aa] {ON}
           Anc_8.359 YLR148W
          Length = 907

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 51/124 (41%), Gaps = 3/124 (2%)

Query: 238 SGFNGLEGKFIYEKIIDTFTRFLKTIIHILLLIPFAMPVMLSKDVVIDLVTLSQNINTIW 297
           S  NG +G    + II++       II I  ++P    V+   ++  +L+   QN + I 
Sbjct: 711 SNLNGEDGA---KNIINSILADSNGIIQINDILPVLNNVITIANIKDELIKNLQNHSNIM 767

Query: 298 KIWVNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFEKRKPKMLPCGHILH 357
           K    + +  + L  +    +  +  +   I     S  S  K  + RK  + PC H  H
Sbjct: 768 KSIATDIEKTNNLKKLISSDIKELNTRTYQIMEPGNSCKSCDKLLQNRKFLVFPCKHCFH 827

Query: 358 MNCL 361
            +CL
Sbjct: 828 TDCL 831

>TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON}
           Anc_3.190 YDL008W
          Length = 184

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 41/82 (50%), Gaps = 9/82 (10%)

Query: 301 VNNRKLDDQLPTVTQHQLDSMEDKICIICMDDLSINSIQKNFE---KRKPKMLP-CGHIL 356
           + N++ +  +   + H +   ++ +C IC    + N    N +   KR P ++  C H  
Sbjct: 25  IQNKERELGIDYSSGHNMVDEDEDVCGICR--FNYNRTCPNCKVPGKRCPLVVGNCFHNF 82

Query: 357 HMNCLKNWMERSQT---CPMCR 375
           H++C+  W++ + +   CPMCR
Sbjct: 83  HVHCIYKWLDTTTSKGLCPMCR 104

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
            YOL138C (REAL)
          Length = 1326

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 14/26 (53%), Gaps = 2/26 (7%)

Query: 349  MLPCGHILHMNCLKNWM--ERSQTCP 372
            +LPCGH  H  C++ W   E    CP
Sbjct: 1292 ILPCGHEGHFQCIQEWFLNENEHECP 1317

>TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {ON}
           Anc_3.405 YPR093C
          Length = 555

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 15/26 (57%), Gaps = 2/26 (7%)

Query: 352 CGHILHMNCLKNW--MERSQTCPMCR 375
           C H  H NC++ W    +S  CP+CR
Sbjct: 22  CQHNFHFNCIRQWHLTSKSLECPVCR 47

>KLLA0C08756g Chr3 complement(765847..767130) [1284 bp, 427 aa] {ON}
           similar to uniprot|Q75EN0 Ashbya gossypii AAR049C RAD18
           Postreplication repair ubiquitin-protein ligase E3 RAD18
           and weakly similar to YCR066W uniprot|P10862
           Saccharomyces cerevisiae YCR066W RAD18 Protein involved
           in postreplication repair binds single-stranded DNA and
           has single-stranded DNA dependent ATPase activity forms
           heterodimer with Rad6p contains RING-finger motif
          Length = 427

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 8/26 (30%), Positives = 16/26 (61%)

Query: 349 MLPCGHILHMNCLKNWMERSQTCPMC 374
           + PCGH     C++ ++++   CP+C
Sbjct: 44  LTPCGHSFCSICIRKYLQKESKCPLC 69

>AGL191W Chr7 (339295..341043) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR143C (SAN1)
          Length = 582

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 10/31 (32%), Positives = 15/31 (48%)

Query: 344 KRKPKMLPCGHILHMNCLKNWMERSQTCPMC 374
           K  P  LPCGH+   +C+  W +   +   C
Sbjct: 218 KHSPTELPCGHVFGRDCIFRWTQEHNSLSYC 248

>Suva_3.104 Chr3 (148368..149825) [1458 bp, 485 aa] {ON} YCR066W
           (REAL)
          Length = 485

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 20/49 (40%), Gaps = 11/49 (22%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMC 374
           C IC D L +           P + PCGH     C++  +     CP+C
Sbjct: 28  CHICKDFLKV-----------PVLTPCGHTFCSLCIREHLNNQPNCPLC 65

>NCAS0D04540 Chr4 (861304..862713) [1410 bp, 469 aa] {ON} Anc_6.332
           YCR066W
          Length = 469

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 22/49 (44%), Gaps = 11/49 (22%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMC 374
           C IC D L +           P + PC H     C++ +++ +  CP+C
Sbjct: 28  CHICKDFLKV-----------PVLTPCSHTFCSLCIREYLKDNSKCPLC 65

>YCR066W Chr3 (231500..232963) [1464 bp, 487 aa] {ON}  RAD18E3
           ubiquitin ligase; forms heterodimer with Rad6p to
           monoubiquitinate PCNA-K164; heterodimer binds
           single-stranded DNA and has single-stranded DNA
           dependent ATPase activity; required for postreplication
           repair
          Length = 487

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 20/49 (40%), Gaps = 11/49 (22%)

Query: 326 CIICMDDLSINSIQKNFEKRKPKMLPCGHILHMNCLKNWMERSQTCPMC 374
           C IC D L +           P + PCGH     C++  +     CP+C
Sbjct: 28  CHICKDFLKV-----------PVLTPCGHTFCSLCIRTHLNNQPNCPLC 65

>NDAI0D01920 Chr4 (451715..457948) [6234 bp, 2077 aa] {ON} Anc_5.190
            YGR184C
          Length = 2077

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 34/63 (53%), Gaps = 13/63 (20%)

Query: 330  MDDLSINSIQKNFEKRKPKM-LPCGHILHMNCLKNWMERSQ------TCPMCR------L 376
            +DD ++ +++ N  +   K+ + C H +H NC K ++++ +       CP+C+      +
Sbjct: 1347 IDDKNLENLRTNGLRGSRKVFVSCNHHIHNNCFKRYIQKKRFVNNAFICPLCQTFSNCII 1406

Query: 377  PVF 379
            PV+
Sbjct: 1407 PVY 1409

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.141    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,691,043
Number of extensions: 1623221
Number of successful extensions: 7449
Number of sequences better than 10.0: 282
Number of HSP's gapped: 7503
Number of HSP's successfully gapped: 285
Length of query: 492
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 378
Effective length of database: 40,409,475
Effective search space: 15274781550
Effective search space used: 15274781550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)