Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B004806.28ON37737717540.0
CAGL0E02497g6.28ON3764035199e-62
Kpol_1037.236.28ON3784115032e-59
NDAI0C026506.28ON3894094991e-58
KAFR0A051306.28ON3964144991e-58
NCAS0D021406.28ON3764024953e-58
KNAG0F029306.28ON3864104842e-56
SAKL0E01518g6.28ON3794124805e-56
TDEL0G044106.28ON3814134737e-55
TPHA0J003906.28ON3804124641e-53
ZYRO0C07546g6.28ON3774154614e-53
Ecym_30326.28ON3774154562e-52
KLLA0C06204g6.28ON3774034553e-52
Kwal_56.224596.28ON3834054474e-51
Smik_15.1676.28ON3784114441e-50
KLTH0C10978g6.28ON3774074431e-50
Suva_15.1726.28ON3984114406e-50
YOL003C (PFA4)6.28ON3784114371e-49
Skud_15.1596.28ON3794134273e-48
ACL003C6.28ON3754023714e-40
CAGL0D02508g3.12ON332431646e-12
TDEL0A003103.12ON329621639e-12
ZYRO0C04092g8.389ON366671631e-11
NDAI0G013403.12ON335431575e-11
KNAG0K025703.12ON328581575e-11
TPHA0P015603.12ON331401567e-11
KLLA0E02069g3.12ON325571557e-11
KAFR0A085903.12ON331381551e-10
Smik_12.3068.389ON359511551e-10
YLR246W (ERF2)8.389ON359511541e-10
TBLA0H001503.12ON345401532e-10
NCAS0E013003.12ON327401522e-10
Kwal_55.221263.12ON360401522e-10
KLTH0F19580g3.12ON342651522e-10
KLTH0F08668g8.389ON358471522e-10
Skud_12.3218.389ON356511522e-10
SAKL0H13860g8.389ON352671523e-10
Kpol_1014.293.12ON326431513e-10
SAKL0C13596g3.12ON333381486e-10
TDEL0F051308.389ON359511487e-10
Suva_10.3428.389ON356501488e-10
Smik_14.63.12ON334651461e-09
Skud_14.153.12ON3361671452e-09
NCAS0C029208.389ON374391452e-09
TPHA0C023608.389ON404501443e-09
YNL326C (PFA3)3.12ON336651433e-09
Suva_14.153.12ON330401424e-09
TBLA0H009208.389ON360671434e-09
Ecym_20143.12ON339401416e-09
KAFR0H019808.389ON361511408e-09
KNAG0A027108.389ON354501391e-08
ZYRO0C03410g3.12ON327411391e-08
SAKL0H16434g8.286ON555501401e-08
KLLA0F19690g8.286ON324401362e-08
TPHA0C010708.286ON333531353e-08
Ecym_41788.389ON368441363e-08
CAGL0G08217g8.389ON326641353e-08
AGL125C8.389ON367511344e-08
KLLA0D18370g8.389ON355501344e-08
Kwal_23.33028.389ON353401345e-08
CAGL0B01991g8.286ON330391326e-08
NDAI0G022508.389ON389391337e-08
KAFR0B053708.286ON329501327e-08
Skud_4.3878.286ON336581328e-08
NDAI0J010008.286ON339461328e-08
ZYRO0D06600g8.286ON330391311e-07
NCAS0B035908.286ON329621291e-07
TDEL0F041308.286ON328461282e-07
Suva_2.2898.286ON335391282e-07
ADL197C3.12ON390531274e-07
YDR126W (SWF1)8.286ON336391264e-07
Kwal_56.236978.286ON338531255e-07
KLTH0G13112g8.286ON349581247e-07
Smik_4.3728.286ON335391247e-07
Ecym_42828.286ON340511212e-06
Kpol_1033.168.286ON321931212e-06
TBLA0D040408.286ON329381202e-06
AGR065W8.286ON326341122e-05
KNAG0H031108.286ON331541122e-05
KLTH0G04972g5.579ON367611025e-04
NDAI0H018905.579ON406621016e-04
NCAS0F013905.579ON37442999e-04
TBLA0E028305.579ON38671990.001
KAFR0I011105.579ON37044940.004
KNAG0C028305.579ON35441930.005
Kwal_47.183665.579ON35661930.006
Kpol_1004.575.579ON36240920.006
TDEL0A044405.579ON36543910.009
Skud_4.7345.579ON38043910.010
SAKL0G06160g5.579ON36439890.018
YDR459C (PFA5)5.579ON37442880.024
Skud_4.5275.626ON76439870.036
Smik_4.5155.626ON76438850.059
TDEL0A049205.626ON75045850.061
NDAI0H008505.626ON78641840.094
ABR203W5.579ON35972830.096
Ecym_41145.579ON37245830.097
Smik_4.7375.579ON37842830.10
Suva_2.6345.579ON38842820.11
KLLA0D06149g5.579ON349141820.12
KLTH0E02420g5.626ON73438820.16
YDR264C (AKR1)5.626ON76430810.17
AER388C5.626ON72437810.20
Suva_2.4325.626ON76338810.20
ZYRO0D13860g5.579ON36576800.21
Ecym_13305.626ON73945800.23
KAFR0H005705.626ON75736790.35
ZYRO0C11132g5.626ON759119780.43
Kpol_526.325.626ON777102780.44
TPHA0C003705.626ON75938760.80
NCAS0C052805.626ON75754750.97
TBLA0J008305.626ON73923741.2
CAGL0K06347g5.579ON35238731.3
CAGL0M08712g5.626ON76330731.8
KAFR0E043104.361ON104947712.8
KLLA0E16721g5.626ON75245703.8
YOR034C (AKR2)5.626ON74941704.1
KNAG0C062305.626ON75230695.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B00480
         (377 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...   680   0.0  
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...   204   9e-62
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...   198   2e-59
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28     196   1e-58
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...   196   1e-58
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...   195   3e-58
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...   191   2e-56
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...   189   5e-56
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...   186   7e-55
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...   183   1e-53
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...   182   4e-53
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...   180   2e-52
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...   179   3e-52
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...   176   4e-51
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...   175   1e-50
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...   175   1e-50
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...   174   6e-50
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...   172   1e-49
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...   169   3e-48
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...   147   4e-40
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    68   6e-12
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    67   9e-12
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    67   1e-11
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      65   5e-11
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    65   5e-11
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    65   7e-11
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    64   7e-11
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    64   1e-10
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    64   1e-10
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    64   1e-10
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    64   2e-10
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    63   2e-10
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    63   2e-10
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    63   2e-10
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    63   2e-10
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    63   2e-10
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    63   3e-10
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    63   3e-10
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    62   6e-10
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    62   7e-10
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    62   8e-10
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    61   1e-09
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    60   2e-09
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     60   2e-09
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    60   3e-09
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    60   3e-09
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    59   4e-09
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    60   4e-09
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    59   6e-09
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    59   8e-09
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    58   1e-08
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    58   1e-08
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...    59   1e-08
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...    57   2e-08
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...    57   3e-08
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    57   3e-08
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    57   3e-08
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    56   4e-08
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    56   4e-08
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    56   5e-08
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...    55   6e-08
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     56   7e-08
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...    55   7e-08
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...    55   8e-08
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....    55   8e-08
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...    55   1e-07
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}      54   1e-07
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...    54   2e-07
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...    54   2e-07
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    54   4e-07
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...    53   4e-07
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...    53   5e-07
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...    52   7e-07
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...    52   7e-07
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...    51   2e-06
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....    51   2e-06
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...    51   2e-06
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...    48   2e-05
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...    48   2e-05
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    44   5e-04
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    44   6e-04
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    43   9e-04
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    43   0.001
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    41   0.004
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    40   0.005
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    40   0.006
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    40   0.006
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    40   0.009
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    40   0.010
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    39   0.018
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    39   0.024
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    38   0.036
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    37   0.059
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    37   0.061
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    37   0.094
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    37   0.096
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    37   0.097
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    37   0.10 
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    36   0.11 
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    36   0.12 
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    36   0.16 
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    36   0.17 
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    36   0.20 
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    36   0.20 
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    35   0.21 
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    35   0.23 
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    35   0.35 
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    35   0.43 
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    35   0.44 
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    34   0.80 
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    33   0.97 
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    33   1.2  
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    33   1.3  
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    33   1.8  
KAFR0E04310 Chr5 (868642..871791) [3150 bp, 1049 aa] {ON} Anc_4....    32   2.8  
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    32   3.8  
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    32   4.1  
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    31   5.2  

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/377 (89%), Positives = 336/377 (89%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT
Sbjct: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60

Query: 61  PPTPAPSTLTQSFISDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMMDHHCPW 120
           PPTPAPSTLTQSFISDVMNNENDIFP           LPRAHHCKTCNTCVVMMDHHCPW
Sbjct: 61  PPTPAPSTLTQSFISDVMNNENDIFPTTTCKKCKKIKLPRAHHCKTCNTCVVMMDHHCPW 120

Query: 121 TMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKXXXXX 180
           TMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYK     
Sbjct: 121 TMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKIIILT 180

Query: 181 XXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAXXXXXXX 240
              PGTIFVW           QNQIWNGMTQIEYWQFEMIENKYFQSKSSKVA       
Sbjct: 181 LLIPGTIFVWLTVLLLLLKTLQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVALQLQLLE 240

Query: 241 XXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLNP 300
               FYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLNP
Sbjct: 241 NLLNFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLNP 300

Query: 301 LSWFNPWYTPLTASYNKINEFAIWDDNETHDNIKDMLLCLPWPLNYSNNSTFQDGELVVK 360
           LSWFNPWYTPLTASYNKINEFAIWDDNETHDNIKDMLLCLPWPLNYSNNSTFQDGELVVK
Sbjct: 301 LSWFNPWYTPLTASYNKINEFAIWDDNETHDNIKDMLLCLPWPLNYSNNSTFQDGELVVK 360

Query: 361 SNDYGETLQDFGVDYDD 377
           SNDYGETLQDFGVDYDD
Sbjct: 361 SNDYGETLQDFGVDYDD 377

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score =  204 bits (519), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 137/403 (33%), Positives = 197/403 (48%), Gaps = 56/403 (13%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M ++   PW G+AIPS +I ++   +++ IL + L+  + +WY     MI  SYYLAI T
Sbjct: 1   MPVKLKWPWLGIAIPSFLIASIGYCAHYFILLNFLSLRKQLWYQFCQTMIWLSYYLAIYT 60

Query: 61  PPTPAPSTLTQSFISDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMMDHHCPW 120
           PP   P+    S       NE  ++              R+HHCKTCN CV+MMDHHCPW
Sbjct: 61  PPGKPPTNFKPS------KNEWKVYCKKCKCYKPE----RSHHCKTCNQCVLMMDHHCPW 110

Query: 121 TMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKXXXXX 180
           TMNCVGY N+PHFIRFL WVI+ TT+L   L  + + ++++R+SP +LY   K +     
Sbjct: 111 TMNCVGYNNFPHFIRFLFWVIVGTTSLAIFLTTRIHSIWVHRSSPSYLY--YKSELIFLT 168

Query: 181 XXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAXXXXXXX 240
              P   F+             NQI+NG +QIE W+ + +E     SK   +        
Sbjct: 169 ILTPLNAFILLTISILMIRCLFNQIFNGRSQIESWEMDRLETLARMSKLLPIL----IEN 224

Query: 241 XXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLNP 300
               F N +        ++    +L N  R   S   ++NFPYDLG   N    +G+  P
Sbjct: 225 VWYIFPNLRNE-----HVESQAEALLNKKR--LSLDELVNFPYDLGPFRNAIQLLGT--P 275

Query: 301 LSWFNPWYTPLTAS--YNKINEFAIWDDNETHDNIKDMLLCLPWP------LNYSNNST- 351
             W  P+  P      + K  E  I D N    ++ D++LCLPWP      LN ++  T 
Sbjct: 276 PLWLYPFSGPQDDGLHFQKNEESMIEDPN----SLNDIILCLPWPPDSTKHLNSTSEHTS 331

Query: 352 -----FQDGELVVK-------------SNDYGETLQDFGVDYD 376
                 ++GE V++              ND+GE+L+DFGVD D
Sbjct: 332 NVQIISEEGEQVIRIRTPEKKLSRSEWLNDWGESLEDFGVDVD 374

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score =  198 bits (503), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 136/411 (33%), Positives = 202/411 (49%), Gaps = 70/411 (17%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M ++   PW G+AIP  +I  +   +++ IL + L+  + IW+  +  MI  SYYLAI T
Sbjct: 1   MPVKLKYPWMGIAIPCFLISFIAYTAHYFILLNFLSIGKQIWFEISVTMIWISYYLAIYT 60

Query: 61  -PPTPA-----PSTLTQSFISDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMM 114
            P  P      PS   +++       + +                R HHCKTC  CV+MM
Sbjct: 61  NPGKPGSNYIPPSNQWKNYCKKCNAYKPE----------------RTHHCKTCQQCVLMM 104

Query: 115 DHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKY 174
           DHHCPWTMNCVGY N+PHF+RFL WVI++TT LL  LI +   L+  RN P +L+   K 
Sbjct: 105 DHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTYLLYFLISRIVFLWKSRNLPSYLFN--KS 162

Query: 175 KXXXXXXXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAX 234
           +        P   FV             NQ+ +G TQIE W+ E +E+ ++  +      
Sbjct: 163 EIIFLTITTPMDGFVLLTISLLFIRCTVNQLLSGRTQIETWENERLESLFYLRRLKP--- 219

Query: 235 XXXXXXXXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTT 294
                     F+ +  + D+  K +K++S           F  +++FPYDLGL NNITT 
Sbjct: 220 --QLISNLWEFHPELKTPDNEAKAEKIVSK-------RIRFDLLVSFPYDLGLINNITTV 270

Query: 295 MGSLNPLSWFNPWYTPLT-ASYNKINEFAIWDDNETHDNIKDMLLCLPWP-------LNY 346
           +GS  P++W   +  P       K NE+++++++     ++D +L LPWP        N 
Sbjct: 271 LGS--PVTWLWFYGEPSGDGMLFKKNEYSLFEEDSI---LEDQILSLPWPPDGGKHGFNI 325

Query: 347 SNNST------FQDGELVVKS---------------NDYGETLQDFGVDYD 376
            N+ST       +DGE V++                ND+GE L+DFGVD D
Sbjct: 326 ENSSTNSIETSTKDGEHVIRKRSPVSKLLESRTQWYNDWGENLEDFGVDID 376

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score =  196 bits (499), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 134/409 (32%), Positives = 192/409 (46%), Gaps = 57/409 (13%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M I+   PW GVAIPS II  +   S++ IL + L+  + IW+  +  MI  SY LAI T
Sbjct: 1   MAIKLKYPWLGVAIPSFIISFIGYNSHYFILSNFLSIKKQIWFQFSLSMIWVSYLLAIFT 60

Query: 61  PPTPAPSTLTQSFISDVMNNENDIFPXXXXXXXXXXXLP-RAHHCKTCNTCVVMMDHHCP 119
            P   P             + ND               P R+HHCKTCN CV+MMDHHCP
Sbjct: 61  NPGKPPKNCKPI-------DFNDQRKWNTHCKKCNNYKPERSHHCKTCNQCVLMMDHHCP 113

Query: 120 WTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKXXXX 179
           WTMNCVGY N+PHFIRFL W+II+T  LL  L+K+   ++  R+ P +++   + +    
Sbjct: 114 WTMNCVGYKNFPHFIRFLMWIIITTGFLLVHLLKRTMTMWNLRHLPSYIFD--RNEIIFL 171

Query: 180 XXXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAXXXXXX 239
               P   F+             NQI  GMTQIE+W+ E +EN ++  K   +       
Sbjct: 172 TILIPMDAFILLTISLLFIRCFNNQIVRGMTQIEFWELERLENLFYNKKLLPMIIATLW- 230

Query: 240 XXXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLN 299
                    ++  +  TK+    +      R    F +I+NFPYD+ +  N+ T MGS  
Sbjct: 231 ---------EVYPNERTKVADNYADDLLSRRKKVRFENIVNFPYDIDIWTNMNTVMGS-- 279

Query: 300 PLSWFNPWYTPLTASYN-KINEFAIWDDNETHDNIKDMLLCLPWPLNYSNN--------- 349
             +W   +  P       + NE +++   E   +++D+LL LPWP +   N         
Sbjct: 280 AFNWIWIFGVPDRNGLKFEKNEISLY---EPGSSVEDLLLSLPWPPDKGRNFISNKDTSV 336

Query: 350 -STFQDGELVVK---------------------SNDYGETLQDFGVDYD 376
            S   DGE VV+                     +ND+GE+L DFGVD +
Sbjct: 337 ESLVYDGEQVVRNRASNDTNISTINKDISREEWNNDWGESLVDFGVDIE 385

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score =  196 bits (499), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 131/414 (31%), Positives = 196/414 (47%), Gaps = 58/414 (14%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M I+   PW G+AIP+ +I  +   +++ IL D L+    +W+  +  MI  SYYLAI  
Sbjct: 1   MAIQLKWPWLGIAIPTFLISFIGYSAHYFILLDHLSWKLQLWFQFSLSMIWLSYYLAIKA 60

Query: 61  PPTPAPSTLTQSFISDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMMDHHCPW 120
            P  +PS      I+D   NE+                PRAHHCKTCN C++MMDHHCPW
Sbjct: 61  DPG-SPS------IAD--KNEDIKTIRTYCKKCDAYKPPRAHHCKTCNKCILMMDHHCPW 111

Query: 121 TMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKXXXXX 180
           TMNCVG+ NYPHF+RFL WVI++T  LL+QL ++   ++    S   L Q  + +     
Sbjct: 112 TMNCVGFKNYPHFLRFLFWVIVTTAFLLAQLFRRIGFIWTNWYSSSALVQ--RQEIVMLT 169

Query: 181 XXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAXXXXXXX 240
              P   F+             NQI++GM+QIE W+ E +E+ ++  K            
Sbjct: 170 ILTPMDAFILLTITLLLIRCTMNQIFSGMSQIEKWEMERLESSFYSRKEKSRDFLMILIN 229

Query: 241 XXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLNP 300
                ++ +   D   ++  L   L+   +   +FHSIINFPYD+ +  N T  +G    
Sbjct: 230 NVFTIFSIESPEDYQEEVNGL---LRQHDKRRLAFHSIINFPYDIDILTNATCVLGPF-- 284

Query: 301 LSWFNPWYTPLTASYN-KINEFAIWDDNETHDNIKDMLLCLPWPLNYSNN---------- 349
            SW NP+  P     + ++NE A    +E    + D+LL LPWP +   +          
Sbjct: 285 FSWLNPFGAPEGDGMHFELNEIA----SEKASTLADLLLSLPWPPDTCTSKYGKSIDEGT 340

Query: 350 ----STFQDGELVVK-----------------------SNDYGETLQDFGVDYD 376
               +  + GE V++                       +N++GE LQ FGVD +
Sbjct: 341 KYVETHIEGGECVLRNRTVSPSFDLPTANENQLSRKSWTNEWGENLQAFGVDIE 394

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score =  195 bits (495), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 130/402 (32%), Positives = 194/402 (48%), Gaps = 54/402 (13%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M ++   PW GV IP  +   +   ++  +L + ++    +W+ ++  M+  SY LAI T
Sbjct: 1   MPVKLKYPWMGVVIPCLLTSFIGYSAHIFVLANFMSWKLQLWFQSSLTMLWISYALAIFT 60

Query: 61  -PPTPAPSTLTQSFISDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMMDHHCP 119
            P  PA S             +  +F              RAHHCKTCN CV+MMDHHCP
Sbjct: 61  NPGRPAKSFKPLKKEWTHFCKKCQLFKPE-----------RAHHCKTCNQCVLMMDHHCP 109

Query: 120 WTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKXXXX 179
           WTMNCVG+ N+PHF+RFL WV+++T  LL QL+K+   L+  ++ P +L++  K +    
Sbjct: 110 WTMNCVGFKNFPHFLRFLFWVVVTTGFLLYQLLKRTIYLWGVKDLPSYLFE--KTEITFL 167

Query: 180 XXXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAXXXXXX 239
               P   FV             NQI  G TQIE W+ E +EN Y++ K           
Sbjct: 168 IILIPMDGFVLITVALLFIRCLSNQIIGGKTQIESWELERLENLYYRKK----LLPQLLV 223

Query: 240 XXXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLN 299
                + N+K   + +     L   LQ   R    F +I+ FPYDL + +N  T +GS  
Sbjct: 224 NLWEIYPNEKTPENKV-----LAKKLQERGR-KVRFENIVTFPYDLDIWSNALTVLGS-- 275

Query: 300 PLSWFNPWYTPLTASYN-KINEFAIWDDNETHDNIKDMLLCLPWPLNYSNN--------- 349
           P+ W   +  P +   + K NE A++++      I+D+LL LPWP +   N         
Sbjct: 276 PVQWLWLFGGPDSDGMHFKKNELALYEEGAA---IEDLLLSLPWPPDGGRNFIQQKGTNV 332

Query: 350 -STFQDGELVVK--------------SNDYGETLQDFGVDYD 376
            S  ++GE V++              +ND+GE L+DFGVD D
Sbjct: 333 ESITENGEQVIRQRNFENDNSYRKTWNNDWGENLEDFGVDVD 374

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score =  191 bits (484), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 126/410 (30%), Positives = 193/410 (47%), Gaps = 64/410 (15%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M ++  +PW+G+AIP  +IF +   +++ IL++ L+  + I +     MI  SYY+AI T
Sbjct: 1   MPVQLKQPWHGIAIPCSLIFFIGYPAHWFILRNSLSNKRQIIFQFCLTMIWISYYMAIYT 60

Query: 61  PPTPAPSTLTQSFISDVMNNE----NDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMMDH 116
            P   P    Q      MN      N   P             R+HHCKTC  CV+MMDH
Sbjct: 61  NPGKPPHGSAQQHTDGDMNRYCAKCNGFKPE------------RSHHCKTCQQCVLMMDH 108

Query: 117 HCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFH--LYQNVKY 174
           HCPWTMNC+G+ N+P F+RFL WVII+T+ L   L+ +   ++  RN P    +      
Sbjct: 109 HCPWTMNCLGFGNFPQFMRFLIWVIITTSQLFWYLLLRIAAIWQARNMPIKGGVVSTTTK 168

Query: 175 KXXXXXXXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAX 234
           +        P  +FV             NQ+  GMTQIE W+ E ++N ++  K   +  
Sbjct: 169 ELVSLVVLTPMDLFVLFTITALFVRCVTNQVIGGMTQIESWEMERLQNMFYSKKLLPIMI 228

Query: 235 XXXXXXXXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTT 294
                      +  + + +   + +KL+   + G      F S++NFPYD+ L  NI  +
Sbjct: 229 ERVWEK-----FPHEQTPEHELEAEKLLEMNEQGL---LKFSSVVNFPYDVDLLTNIHQS 280

Query: 295 MGSLNPLSWFNPWYTPLTASYNKI----NEFAIWDDNETHDNIKDMLLCLPWPLNYSN-- 348
           +GS   L W  P+    TA  N +    N+ + ++DN +   I D+LLCL WP +     
Sbjct: 281 LGSPMLLLW--PFS---TAQGNGVTFQKNDISTYEDNLS---ISDLLLCLSWPPDGGRRI 332

Query: 349 ------------NSTFQDGELVVK------------SNDYGETLQDFGVD 374
                       + T +DGE +++             N +GETL+ FGVD
Sbjct: 333 PHPQREDGAHMIDQTVEDGEFMIRKRNSPIESRTTWENQWGETLEGFGVD 382

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score =  189 bits (480), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 138/412 (33%), Positives = 190/412 (46%), Gaps = 69/412 (16%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M ++   PW G+AIP  +I  +   +++ IL + L T + +W+  +  MI  SYYLAI T
Sbjct: 1   MAVKLKWPWLGIAIPLFLISFIGYCAHYFILSNFLPTKKQLWFEFSLGMIWISYYLAIYT 60

Query: 61  -PPTPAPSTLTQSFI-SDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMMDHHC 118
            P  P P      F   +  N  N+  P             RAHHCK CN CV+ MDHHC
Sbjct: 61  NPGKPTPGFRPSKFEWENFCNKCNNYKPE------------RAHHCKACNQCVLSMDHHC 108

Query: 119 PWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKXXX 178
           PWTMNCVG+ N+ HFIRFL WVI +T+ LL+ L+K+   L+  R+ P +     + +   
Sbjct: 109 PWTMNCVGHRNFAHFIRFLFWVIETTSFLLTYLVKRILFLWNRRHMPNYFVH--RSELIF 166

Query: 179 XXXXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAXXXXX 238
                P   FV            +NQI  GMTQIE W+ + IEN +   +          
Sbjct: 167 LTILTPMDAFVLLTISLLLLRCAKNQILKGMTQIESWEMDRIENMFHSGQLIPRMLENLK 226

Query: 239 XXXXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSL 298
                   N+         I+KL+S  QN      S   I+NFPYDL    N   ++G +
Sbjct: 227 EIRPGSLSNQD------DDIRKLLS--QN----RLSLDEIVNFPYDLNPWANAVNSLGDM 274

Query: 299 NPLSWFNPWYTPLTASYNKI----NEFAIWDDNETHDNIKDMLLCLPWPLNYSNN----- 349
              SW  PW    TA  N +    NE +++   E    I+D LL LPWP +   +     
Sbjct: 275 --YSWILPWG---TAKGNGMIFEKNELSVY---EPEIPIEDKLLSLPWPPDGGRHKVPGG 326

Query: 350 ---------STFQDGELVVKS---------------NDYGETLQDFGVDYDD 377
                    S+ +DGE VV+                ND+GE L DFGVD D+
Sbjct: 327 GANDVNIVESSTRDGERVVRKRWVDPRTTMPRKKWYNDWGENLADFGVDLDE 378

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score =  186 bits (473), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 125/413 (30%), Positives = 192/413 (46%), Gaps = 74/413 (17%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M ++   PW G+AIP  ++  +    +F IL + L+ ++ +W+     +I  SYY AI T
Sbjct: 1   MPVKLKWPWLGIAIPCVLVSFIGYCGHFFILSNFLSPSKQLWFQCNLALIWLSYYYAIYT 60

Query: 61  -PPTPAPSTLT-----QSFISDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMM 114
            P  P P+        +++     N + +                RAHHCKTCN CV+MM
Sbjct: 61  NPGRPRPNFEVPKYEWKNYCKKCQNYKPE----------------RAHHCKTCNQCVLMM 104

Query: 115 DHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKY 174
           DHHCPWTMNCVG+ N+PHF+RFL WVI++T  LL QL+ +   L+  RN P +++   + 
Sbjct: 105 DHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLYQLVSRIIVLWRDRNLPDYMFH--RS 162

Query: 175 KXXXXXXXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAX 234
           +        P   FV             NQI+NGM+QIE W+ E ++  +     SK   
Sbjct: 163 ELVFLTILTPLDAFVLLTITILLCRCLANQIFNGMSQIETWELERLQALF----DSKRLV 218

Query: 235 XXXXXXXXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTT 294
                     F   +   +  T  +  ++              ++NFPYDL   +N    
Sbjct: 219 PLLIEAAWDIFPGTREQINESTAAELSMNK-------ELRLEDVVNFPYDLDPWSNAEQL 271

Query: 295 MGSLNPLSWFNPWYTP----LTASYNKINEFAIWDDNETHDNIKDMLLCLPWP------- 343
           +G  NPL W  P+  P    ++   N+I+E++      +  + +D+LL LPWP       
Sbjct: 272 LG--NPLLWLWPFGRPKGDGMSFVKNEISEYS------SRASYEDLLLSLPWPPDGGRTR 323

Query: 344 -----LNYSNNSTFQDGELVVKS---------------NDYGETLQDFGVDYD 376
                L+ S  S  + GE +++                ND+GE L+DFGVD D
Sbjct: 324 AGPGSLSSSIESITKQGEQLIRRRPNDTSDLIGRRQWQNDWGENLEDFGVDVD 376

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score =  183 bits (464), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 132/412 (32%), Positives = 201/412 (48%), Gaps = 71/412 (17%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M ++F  PW G+AIP  +I  +  +S++ IL+  L+  +  ++  +  MI  SYY+AI+ 
Sbjct: 1   MPVKFKWPWMGIAIPCVLISFIGYLSHYYILRQHLSLIKQCYFEFSLTMIWVSYYMAIII 60

Query: 61  PP-------TPAPSTLTQSFISDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVM 113
            P        P P    ++F     N + +                R+HHCKTCN CV+M
Sbjct: 61  NPGKPGKNFKPLPHEW-RNFCKKCNNYKPE----------------RSHHCKTCNQCVLM 103

Query: 114 MDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVK 173
           MDHHCPWTMNC+G+ N+PHF+RFL W++ +T  LL   IK+   ++  RN P +L++  +
Sbjct: 104 MDHHCPWTMNCIGFNNFPHFMRFLLWIMATTGFLLFYQIKRIIYMWNNRNLPSYLFE--R 161

Query: 174 YKXXXXXXXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVA 233
            +        P  +F+             NQI NG TQIE W+ + +EN+++  K     
Sbjct: 162 SEVIALFVCTPLNLFILLTITLLFCRCLFNQIINGKTQIEDWEMDRLENRFYLKK----- 216

Query: 234 XXXXXXXXXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITT 293
                       Y +  S     + ++LI   + G R++    SI+NFPYDLG+  NIT 
Sbjct: 217 LLPQLILNLWELYPELKSAKHDEEAERLIE--KKGIRYD----SIVNFPYDLGIFKNITA 270

Query: 294 TMGSLNPLSWFNPWYTPLTASYN-KINEFAIWDDNETHDNIKDMLLCLPWP--------- 343
            +G   PL W  P+  P     N + NE A++D + +   +    L LPWP         
Sbjct: 271 LVGQ--PLYWLWPFGGPSGNGMNFEKNEIALFDPDSS---LPVFTLALPWPPDKGRHNNS 325

Query: 344 --LNYSNNSTF--QDGELVVKS---------------NDYGETLQDFGVDYD 376
             LN  +N  F   DGE VV++               N++GE L+DFGVD +
Sbjct: 326 KTLNTDSNVEFITTDGEQVVRNRTHAKNPILSREEWFNEWGENLEDFGVDVE 377

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  182 bits (461), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 132/415 (31%), Positives = 191/415 (46%), Gaps = 79/415 (19%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M ++   P+ G+AIP  +I  +   +++ IL + L+T + IW+  +  MI +SYYLAI T
Sbjct: 1   MPVQLKWPFLGIAIPCFLISFIGYNAHYFILSNFLSTQKQIWFEFSLTMIWFSYYLAIYT 60

Query: 61  -PPTPAPSTLT-----QSFISDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMM 114
            P  P P+        +S+     N + +                RAHHCKTCN CV+ M
Sbjct: 61  LPGQPLPNFQPSKNSWKSYCKKCRNYKPE----------------RAHHCKTCNQCVLAM 104

Query: 115 DHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKY 174
           DHHCPWT NCVGY N+PHF+RFL WVI +T  LL +L  +AY +    NSP +L+   K 
Sbjct: 105 DHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLYELCLRAYFILSNHNSPTYLWN--KS 162

Query: 175 KXXXXXXXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAX 234
           +        P   F+             NQI+ G TQIE W++E +E  Y+  +      
Sbjct: 163 ELIFLTILIPMDGFILLTISILFIRCLSNQIFCGRTQIETWEYERLEGLYYSKR------ 216

Query: 235 XXXXXXXXXXFYN--KKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNIT 292
                     F+    +L T  +      +S+     R       ++NFPYD+   +N  
Sbjct: 217 --LLPHLLANFWELYPELRTRELEDEASRLST-----RRRIGLDHLVNFPYDIDPWSNTI 269

Query: 293 TTMGSLNPLSWFNPWYTP----LTASYNKINEFAIWDDNETHDNIKDMLLCLPWPLNYSN 348
             +GS  PL W  P+  P    +    N I+EF          N+ DMLL LPWP +   
Sbjct: 270 EFLGS--PLFWLWPFGKPKGDGMFFPKNDISEFE-------ETNLTDMLLALPWPPDGGK 320

Query: 349 N------------STFQDGELVVKS---------------NDYGETLQDFGVDYD 376
           +            +T +DGE V++                N +GE L+DFGVD D
Sbjct: 321 DKVISIDGPNAVETTVRDGEQVIRKRLVDPRDPSSRTQWQNTWGENLEDFGVDVD 375

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score =  180 bits (456), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 129/415 (31%), Positives = 190/415 (45%), Gaps = 80/415 (19%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M ++   PW G+AIP  +I  +   +   +LQ  L+  Q IW+  +  MI  SYY AI T
Sbjct: 1   MPVKLKWPWLGIAIPCFLIAFIGYSAQLFVLQGFLSVKQQIWFQFSLTMIWLSYYKAIYT 60

Query: 61  -PPTPAPS--TLTQSFISDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMMDHH 117
            P +P P    L   + +     +N                 R HHCKTC  CV++MDHH
Sbjct: 61  NPGSPVPGFQPLKHEWKNYCKKCQN-------------FKPERTHHCKTCAQCVLVMDHH 107

Query: 118 CPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKXX 177
           CP+TMNCVGY N+PHF+RFL W+I +TT L  Q  K+ + ++  R+S   L    K +  
Sbjct: 108 CPFTMNCVGYNNFPHFMRFLFWIITTTTYLSIQFFKRTWFVWNIRHSTAQLV--TKKEII 165

Query: 178 XXXXXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAXXXX 237
                 P   FV            +NQ+ NGMTQIE W+ + IE+               
Sbjct: 166 FLTILTPANAFVLLTISILFGRCIKNQVLNGMTQIEAWEMDRIES--------------- 210

Query: 238 XXXXXXXFYNKKLSTDSITKIQKLISSLQNGARW---------NTSFHSIINFPYDLGLS 288
                  FYN++L    ++ +++L  +  +G +            SF  ++NFPYD    
Sbjct: 211 ------MFYNRRLVPQLLSNLEELYPNSLDGHKGEIDRILNNRKISFEDLVNFPYDSDPW 264

Query: 289 NNITTTMGSLNPLSWFNPWYTP-LTASYNKINEFAIWDDNETHDNIKDMLLCLPWP---- 343
            N+   MG +  L+W NP+  P       + NE + ++   T   + D LL LPWP    
Sbjct: 265 RNLINCMGPM--LTWLNPFGKPNGNGMVFEKNELSAYEHGST---LTDKLLSLPWPPDGE 319

Query: 344 --LNYSNN-----STFQDGELVVKS---------------NDYGETLQDFGVDYD 376
              N SN+     S+ ++GE +++                ND+GE L  FGVD D
Sbjct: 320 RAPNSSNSRLKVESSTRNGEHIIRKRSPEPRLNLSRTEWYNDWGENLAHFGVDVD 374

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score =  179 bits (455), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 133/403 (33%), Positives = 183/403 (45%), Gaps = 59/403 (14%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M I+    W GVAIP+ ++  +   S++ IL + L+ N+ I+Y T   MI  SYYLAI T
Sbjct: 1   MAIKLKNRWLGVAIPAFLVALIGYGSHYFILSNFLSWNEQIFYQTCQTMIWVSYYLAIYT 60

Query: 61  PPTPAPSTLTQSFISDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMMDHHCPW 120
            P   P     S  ++  +N                   RAHHCKTCN CV+ MDHHCPW
Sbjct: 61  NPGIPPKDFKPS--AEEWHN--------YCKKCRVYKPERAHHCKTCNQCVLAMDHHCPW 110

Query: 121 TMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKXXXXX 180
           T+NCVG++N+PHF+RFL WVI ST  LL  LI + Y L+  R++ FH       +     
Sbjct: 111 TLNCVGHSNFPHFMRFLFWVIFSTAYLLFLLIGRIYLLWSIRHTAFH--HRSTSEIIFIC 168

Query: 181 XXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAXXXXXXX 240
              P   FV             NQ  +GMTQIE W+ + I++ +++++            
Sbjct: 169 IMTPMDAFVLLTVSSLLGRCIYNQCLHGMTQIESWEMDRIQSLHYKNRLLAQVIDRLVER 228

Query: 241 XXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLNP 300
                  K+       +I KL+S          +     NFPYD+    NI   MG    
Sbjct: 229 RPEILPAKQ------HEINKLLSKRY------VNQEDFTNFPYDVNPWTNINNAMGPW-- 274

Query: 301 LSWFNPWYTPLT--ASYNKINEFAIWDDNETHDNIKDMLLCLPWPLN------------Y 346
             W  PW  P T   S+ K NE   +D N +   I+DML+ LPWP +             
Sbjct: 275 YLWLWPWSKPPTIGTSFAK-NELFFYDPNSS---IEDMLMSLPWPPDGLTHHSRALGSGS 330

Query: 347 SNNSTFQDGELVVKS---------------NDYGETLQDFGVD 374
           S  +    GE V++                ND+GE L DFGVD
Sbjct: 331 SIETIVSGGEQVIRDKSVDLRDRLGRNSWYNDWGEDLSDFGVD 373

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score =  176 bits (447), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 127/405 (31%), Positives = 181/405 (44%), Gaps = 60/405 (14%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M ++   PW G+AIPS +I  +   S++ IL + L+  Q +W+     MI  SY LAI T
Sbjct: 1   MPVKLKWPWLGIAIPSSLIAFIGYGSHYFILGNFLSLGQQVWFQICLSMIWISYALAIFT 60

Query: 61  PPTPAPSTLTQSFISDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMMDHHCPW 120
            P   P+   Q       N                    R HHCKTC+ CV++MDHHCPW
Sbjct: 61  NPGKPPTGF-QPLPHQWKN---------ICQKCKTYKPERTHHCKTCDQCVLVMDHHCPW 110

Query: 121 TMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKXXXXX 180
           TMNCVG+ N+PHF+RFL WVII+T+ L   L K+ +  +  R++  ++    K +     
Sbjct: 111 TMNCVGHNNFPHFVRFLVWVIITTSYLGFMLWKRIFMHWQLRHTRIYVQ---KIELVFIF 167

Query: 181 XXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAXXXXXXX 240
              P   FVW           +NQ   GMTQIE W++E IEN++   +            
Sbjct: 168 INTPLNAFVWLTIILLLLRCSKNQFLCGMTQIERWEWERIENQFNNGR-----LIPQLLE 222

Query: 241 XXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLNP 300
                Y   +      K  KLI++       +     I+NFPYDL +  N    +G+L  
Sbjct: 223 NLAEIYGDDILNSPNAK--KLINAR------DLQLEEIVNFPYDLNIVANTRHAIGNL-- 272

Query: 301 LSWFNPWYTPLTASYN-KINEFAIWDDNETHDNIKDMLLCLPWPLNYSNNSTFQD----- 354
           L+   PW +P+        N+ + +D   T   I+D LL LPWP +        D     
Sbjct: 273 LTCILPWSSPVGNGLKFTKNDLSSYDTCHT---IEDKLLSLPWPPDGGRQQPTGDSQVSS 329

Query: 355 --------GELVVKS---------------NDYGETLQDFGVDYD 376
                   GE V++                ND+GE L DFGVD +
Sbjct: 330 RIEMHSSRGEPVLRKRLRDPRINMQRTEWYNDWGENLSDFGVDVE 374

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score =  175 bits (444), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 126/411 (30%), Positives = 191/411 (46%), Gaps = 70/411 (17%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M ++   PW G+AIP+ +I  +   +++ IL + L   + I +  +  MI +SYYLAI T
Sbjct: 1   MAVKLRWPWLGIAIPTLLISFIGYGAHYFILSNFLPIAKQIGFEFSLSMIWFSYYLAIYT 60

Query: 61  -PPTPAPS-----TLTQSFISDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMM 114
            P  P P+      +  +F     N + +                R+HHCKTCN CV+MM
Sbjct: 61  NPGRPLPNYQPTPGIWPNFCKKCQNYKPE----------------RSHHCKTCNQCVLMM 104

Query: 115 DHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKY 174
           DHHCPWTMNCVG+ NYPHF+RFL W+II+T+ L    +K+   ++  RN P +L++  K 
Sbjct: 105 DHHCPWTMNCVGFGNYPHFLRFLFWIIITTSILFCIQVKRICFIWQRRNFPGYLFK--KS 162

Query: 175 KXXXXXXXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKS--SKV 232
           +        P   FV             NQI NG +QIE W  + +E+  F S+    K+
Sbjct: 163 ELTFLTILSPLNFFVLLTITVLFLRCLFNQIVNGRSQIESWDMDRLES-LFDSRRLIQKL 221

Query: 233 AXXXXXXXXXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNIT 292
                           +   + + K Q+            +SF  ++NFPY+  L  N  
Sbjct: 222 IYNTWRIYPESKTLQHERDAEGLLKQQR------------SSFEGLVNFPYNFDLHTNAI 269

Query: 293 TTMGSLNPLSWFNPWYTPLTASYNKINEFAIWDDNETHDNIKDMLLCLPWPLNYSNNSTF 352
             +G ++   W  P+  P T + N   +  I  + E    ++D++L LPWP +    +T 
Sbjct: 270 LYLGPVH--LWLWPYGIP-TGNGNNFPKNDI-SNYEVDSPLEDIILSLPWPPDGGETTTV 325

Query: 353 ------------QDGELVVKS---------------NDYGETLQDFGVDYD 376
                       + GE VV+S               ND+GE+L DFGVD D
Sbjct: 326 SNPKTSTIETCNEGGEQVVRSRVAQNGRSASREKWFNDWGESLDDFGVDVD 376

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score =  175 bits (443), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 122/407 (29%), Positives = 181/407 (44%), Gaps = 64/407 (15%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M +E   PW G+A+PS +I  +   S++ ILQ+  +T Q +W+  +  +I  SY  AI  
Sbjct: 1   MPVELKWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAFAIFK 60

Query: 61  PPTPAPSTLTQSFISDVMNNENDIFPXXXXXXXXXXXLP-RAHHCKTCNTCVVMMDHHCP 119
            P   P            N E  I              P R HHCKTC  CV+ MDHHCP
Sbjct: 61  NPGRPPP-----------NFEPPIHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCP 109

Query: 120 WTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKXXXX 179
           WTMNCVG+ N+PHF+RFL WV+++T+ L   L ++A+  +  RN+   ++ +   +    
Sbjct: 110 WTMNCVGHNNFPHFVRFLTWVVLTTSYLGLLLTQRAFDHWASRNTRKFVHTS---ELCFL 166

Query: 180 XXXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAXXXXXX 239
               P   F+            +NQ  NGMTQIE W+ + IEN +F  +           
Sbjct: 167 FVNAPLNAFILLTVSLLVFRCVKNQFLNGMTQIESWEKDRIENLFFNERLVPQLIDNLKE 226

Query: 240 XXXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLN 299
                 +++  +       QKL+SS Q           IINFPYD+ +  N+ ++MG + 
Sbjct: 227 LFPEDTFDEGAA-------QKLLSSKQ------LELEDIINFPYDVDILENMKSSMGPI- 272

Query: 300 PLSWFNPWYTPLTASYNKINEFAIWD--DNETHDNIKDMLLCLPWPLNYSNNSTFQD--- 354
                  W  P     ++   F   D  D +   +I+D LL LPWP +     + +    
Sbjct: 273 -----YSWCLPCGRPRDEGTRFVTNDLSDYDIKASIEDKLLSLPWPPDGGRQKSQRSADI 327

Query: 355 ----------GELVVKS---------------NDYGETLQDFGVDYD 376
                     GE  +++               ND+GE L DFGVD D
Sbjct: 328 ASTLETFSSGGEATLRNRSFDSRISVPRTEWHNDWGENLSDFGVDVD 374

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score =  174 bits (440), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 127/411 (30%), Positives = 194/411 (47%), Gaps = 70/411 (17%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M ++   PW G+AIP+ +I  +   +++ IL + L+ ++ I + ++  MI  SYYLAI T
Sbjct: 21  MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSVSKQIAFESSLSMIWVSYYLAIYT 80

Query: 61  -PPTPAPSTLTQ-----SFISDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMM 114
            P  P+P+         ++     N + +                R+HHCK CN CV+MM
Sbjct: 81  NPGKPSPTYQPNPNTWPNYCKKCQNYKPE----------------RSHHCKACNQCVLMM 124

Query: 115 DHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKY 174
           DHHCPWTMNCVG+ NYPHF+RF+ WVI +T  L    +K+   ++  R+ P +L++  K 
Sbjct: 125 DHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLFCIQLKRVSFIWQQRHLPGYLFK--KS 182

Query: 175 KXXXXXXXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAX 234
           +        P   FV             NQI NG +QIE W  + +E+ +   +  K   
Sbjct: 183 ELVFLTILTPLNFFVLLTIVILFLRCLFNQIINGRSQIESWDMDRLESLFDSQRLIK--- 239

Query: 235 XXXXXXXXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTT 294
                      Y +  S       +KL++  Q+  R    F  ++NFPY++ L  N T  
Sbjct: 240 --KLIENTWRIYPEARSPQLERDAEKLLT--QHKIR----FEEVVNFPYNIDLFTNATIY 291

Query: 295 MGSLNPLSWFNPWYTPLTASYNKINEFAIWDDN--ETHDNIKDMLLCLPWP--------- 343
           +G L      + W  P  A     N F   D +  E + +++D++L LPWP         
Sbjct: 292 LGPL------HLWLWPCGAPAGDGNSFQKNDISKYEVNSSLEDIMLSLPWPPDGGKIKTA 345

Query: 344 LNYSN---NSTFQDGELVVKS---------------NDYGETLQDFGVDYD 376
            N+SN    +  + GE VV+S               ND+GE+L DFGVD D
Sbjct: 346 SNHSNLAIETCNEGGEQVVRSRIAQHGRSATREKWYNDWGESLDDFGVDVD 396

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score =  172 bits (437), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 120/411 (29%), Positives = 189/411 (45%), Gaps = 70/411 (17%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M ++   PW G+AIP+ +I  +   +++ IL + L+  + I +     MI  SYYLAI T
Sbjct: 1   MPVKLRWPWLGIAIPTFLISFIGYGAHYFILSNFLSVPKQITFEFCLSMIWLSYYLAICT 60

Query: 61  PPT------PAPSTLTQSFISDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMM 114
            P         P  + ++F     + + +                R+HHCKTCN CV+MM
Sbjct: 61  NPGRPLPNYKPPPDIWRNFCKKCQSYKPE----------------RSHHCKTCNQCVLMM 104

Query: 115 DHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKY 174
           DHHCPWTMNCVG+ NYPHF+RFL W+I++T+ L     K+ Y ++  R+ P + ++  K 
Sbjct: 105 DHHCPWTMNCVGFANYPHFLRFLFWIIVTTSVLFCIQAKRIYFIWQQRHLPGYFFK--KS 162

Query: 175 KXXXXXXXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSK--V 232
           +        P   FV             NQI NG +QIE W  + +E+ +   + ++  +
Sbjct: 163 ELIFLTISSPLNSFVLLTITILFLRCLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLI 222

Query: 233 AXXXXXXXXXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNIT 292
                       F NKK + + +TK +               F  ++NFPYD  L  N  
Sbjct: 223 DNTWRIYPESRSFQNKKDAEEHLTKKR-------------PRFDELVNFPYDFDLYTNAL 269

Query: 293 TTMGSLNPLSWFNPWYTPLTASYNKINEFAIWDDNETHDNIKDMLLCLPWPLNYSNNSTF 352
             +G ++   W  P+  P T   N   +  I    E + +++D +L LPWP +    +T 
Sbjct: 270 LYLGPIH--LWLWPYGVP-TGDGNNFPKNGI-SKYEANSSLEDHILSLPWPPDGGKTNTV 325

Query: 353 ------------QDGELVVKS---------------NDYGETLQDFGVDYD 376
                       + GE ++++               ND+GE+L DFGVD D
Sbjct: 326 FNHGSSTIEMRNESGEQLIRTRLPQNGRHASREKWYNDWGESLDDFGVDVD 376

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score =  169 bits (427), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 124/413 (30%), Positives = 189/413 (45%), Gaps = 73/413 (17%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M ++   PW G+AIP+ +I  +   +++ IL + L+ ++ + +  +  MI  SYYLAI T
Sbjct: 1   MAVKLKWPWLGIAIPTFLISFIGYGAHYFILSNFLSISKQLLFELSLSMIWVSYYLAIYT 60

Query: 61  ---PPTP--APSTLT-QSFISDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMM 114
               P P   PS L   +F     + + +                R+HHCK CN CV+MM
Sbjct: 61  NAGRPLPNYRPSPLIWPNFCKKCQSYKPE----------------RSHHCKACNQCVLMM 104

Query: 115 DHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKY 174
           DHHCPWTMNCVG+ NYPHF+RFL WVI++T+ L    +K+   ++  R+ P +L++  K 
Sbjct: 105 DHHCPWTMNCVGFRNYPHFLRFLFWVIVTTSILFCMQVKRICFIWQQRSLPGYLFE--KS 162

Query: 175 KXXXXXXXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAX 234
           +        P   FV             NQI NG +QIE W  + +E     S       
Sbjct: 163 ELIFLTILSPLDFFVLLTIAILFLRCLSNQIINGRSQIESWDMDRLE-----SLCDSGKL 217

Query: 235 XXXXXXXXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTT 294
                      Y +  S+       KL++      R    F  +++FPY+     N    
Sbjct: 218 IPKLIDNTWRIYPEARSSQHERDADKLLTQ-----RGRARFDELVSFPYNFNPCTNAILY 272

Query: 295 MGSLNPLSWFNPWYTPLTAS----YNKINEFAIWDDNETHDNIKDMLLCLPWP------- 343
           +G +    W  P+ TP         N I+++      E +  ++D++L LPWP       
Sbjct: 273 LGPIR--LWLWPYGTPAGDGNSFPKNDISQY------EVNSPLEDIILSLPWPPDGNKTK 324

Query: 344 -LNYSNNSTF----QDGELVVKS---------------NDYGETLQDFGVDYD 376
            ++  NNST     + GE +V+S               ND+GE+L DFGVD D
Sbjct: 325 AVSNHNNSTIETYNEGGEQIVRSRNAQHGSDAIREKWYNDWGESLDDFGVDVD 377

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score =  147 bits (371), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 114/402 (28%), Positives = 173/402 (43%), Gaps = 55/402 (13%)

Query: 1   MVIEFSRPWYGVAIPSCIIFTLTTVSYFGILQDVLTTNQTIWYFTTAIMISYSYYLAIVT 60
           M +    PW GVAIP  +I      ++F +L + L+  + +W+  +  MI  SY+ AI  
Sbjct: 1   MAVLVKWPWLGVAIPCFLISFTGYFAHFFVLTNFLSFKELLWFQVSLSMIWISYWKAIYK 60

Query: 61  PPTPAPSTLTQSFISDVMNNENDIFPXXXXXXXXXXXLPRAHHCKTCNTCVVMMDHHCPW 120
                P   T+ F       +N                 R HHCK CN CV++MDHHCPW
Sbjct: 61  ----NPGRPTKGFRPLRYEWQN------YCTKCETYKPERTHHCKRCNQCVLVMDHHCPW 110

Query: 121 TMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNSPFHLYQNVKYKXXXXX 180
           TMNC+G            W+I +T  LL   +K+    ++ R +  +L    K +     
Sbjct: 111 TMNCLGLQYLAPQHSIFCWIIATTGILLHYFVKRIKFTWVNRYATANLVS--KQELIFLT 168

Query: 181 XXXPGTIFVWXXXXXXXXXXXQNQIWNGMTQIEYWQFEMIENKYFQSKSSKVAXXXXXXX 240
              P   F+            +NQI NG TQIE W+ + IEN ++  +            
Sbjct: 169 ILTPLDAFILLTISLLFVRCVKNQIVNGRTQIEAWEMDRIENLFYHQRLLPQLLTNL--- 225

Query: 241 XXXXFYNKKLSTDSITKIQKLISSLQNGARWNTSFHSIINFPYDLGLSNNITTTMGSLNP 300
                  K++   S+   +K +    + +    SF  +INFPYD+    N+   MGS  P
Sbjct: 226 -------KEIYPGSLEGQEKEVEEFLSSS--TCSFDEVINFPYDINPWVNLLNCMGS--P 274

Query: 301 LSWFNPWYTPLT-ASYNKINEFAIWDDNETHDNIKDMLLCLPWPLNYSNNSTF------- 352
           L+W NP+  P       + NE + +D+  +   I+D LL LPWP + + +          
Sbjct: 275 LNWLNPFGGPKADGMVFQKNEISDYDEATS---IQDKLLALPWPPDDTRHGIAFPSVSHV 331

Query: 353 ----QDGELVVKS--------------NDYGETLQDFGVDYD 376
               Q GE VV+               ND+GE+L+ FGVD +
Sbjct: 332 EKDTQGGEQVVRRRHVPIAVPPRNEWYNDWGESLEHFGVDVE 373

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 29/43 (67%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVII 142
           R HHC TCN CV+ MDHHCPW   CVGY N   FI+FL +  +
Sbjct: 116 RCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLIYCTV 158

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 67.4 bits (163), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 39/62 (62%), Gaps = 3/62 (4%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLY 159
           R HHC  CN C++ MDHHCPW  +CVG+ N  +FI+FL +  +   N+   LI    +LY
Sbjct: 118 RCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLMYATLYAFNV---LIFDTIQLY 174

Query: 160 IY 161
           I+
Sbjct: 175 IW 176

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 41/67 (61%), Gaps = 3/67 (4%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKL 158
           PRA HC TC  C++  DHHC W  NC+G  NY +FI FLA  I+S+  L++     +  +
Sbjct: 190 PRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSSIFLIANC---SIHI 246

Query: 159 YIYRNSP 165
           Y +RN P
Sbjct: 247 YHHRNLP 253

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 29/43 (67%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVII 142
           R HHC TCN C++ MDHHCPW   C+G+ N   FI+FL +  I
Sbjct: 119 RCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLIYCTI 161

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 65.1 bits (157), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 34/58 (58%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYK 157
           R HHC +C+ C++ MDHHCPW   CVG+ N   FI+FL +       +LS    Q Y+
Sbjct: 113 RCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLYTTAYAIFVLSMTSVQLYR 170

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 29/40 (72%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAW 139
           R+HHC TCN CV+ MDHHCPW   C+G+ N   FI+FL +
Sbjct: 120 RSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIY 159

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 64.3 bits (155), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 34/57 (59%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAY 156
           R HHC  CN C + MDHHCPW  +CVG+ N   F++FLA+  + +  +L     Q Y
Sbjct: 115 RCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVLLMTSAQLY 171

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (73%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
           R HHC +CN C++ MDHHCPW   C+G+ N  +FI+FL
Sbjct: 116 RCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFL 153

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 34/51 (66%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLS 149
           PR+ HC TCN CV++ DHHC W  NC+G  NY  F+ FL   +IS+  LL+
Sbjct: 184 PRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVISSIILLA 234

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 34/51 (66%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLS 149
           PR+ HC TCN CV++ DHHC W  NC+G  NY  F+ FL   I+S+  LL+
Sbjct: 184 PRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVILLT 234

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (72%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAW 139
           R HHC +C+ C++ MDHHCPW   C+G+ N+ +FI FL +
Sbjct: 116 RCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIY 155

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (72%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAW 139
           R HHC TC+ C++ MDHHCPW   C+G+ N  +F++FL +
Sbjct: 111 RCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFLIY 150

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 27/40 (67%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAW 139
           R HHC  CN C + MDHHCPW  +CVGY N  +FI FL +
Sbjct: 143 RCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLY 182

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 35/65 (53%), Gaps = 8/65 (12%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAW--------VIISTTNLLSQL 151
           R HHC  C  C + MDHHCPW  +CVGY N  +F++FL +         ++S T LL   
Sbjct: 116 RCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFSILIFLLSGTELLLWF 175

Query: 152 IKQAY 156
             Q Y
Sbjct: 176 KNQRY 180

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 31/47 (65%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTT 145
           PRA HC TC  CV+  DHHC W  NC+G  NY +F+ FLA   ++TT
Sbjct: 187 PRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLASCCLATT 233

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 32/51 (62%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLS 149
           PR  HC TCN CV++ DHHC W  NCVG  NY  F+ FL   I S+  LL+
Sbjct: 184 PRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSVFLLT 234

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 38/67 (56%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKL 158
           PRA HC TC  C++  DHHC W  NC+G  NY +F  FL   +I+T  +++    +  + 
Sbjct: 181 PRASHCSTCEACIITHDHHCKWVNNCIGQRNYHYFFTFLVSCVIATAFIIANCAIRVSRS 240

Query: 159 YIYRNSP 165
              +++P
Sbjct: 241 VHAKDAP 247

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 62.8 bits (151), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 29/43 (67%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVII 142
           R HHC  C+ C++ MDHHCPW   CVG+ N  +F++FL +  +
Sbjct: 116 RCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFLIYTTV 158

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (73%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
           R+HHC +CN C + MDHHCPW  +C+G+ N   FI+FL
Sbjct: 115 RSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFL 152

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (62%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLS 149
           PRA HC TC  CV+  DHHC W  NCVG  NY +FI FL   +++   L++
Sbjct: 190 PRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFIIFLIGTVLAELFLIA 240

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLL 148
           PR+ HC TCN CV++ DHHC W  NC+G  NY  F+ FL   I S+  LL
Sbjct: 184 PRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFSSILLL 233

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 37/65 (56%), Gaps = 3/65 (4%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLY 159
           R HHC +C+ CV+ MDHHCPW   C G+ N   FI+FL +   +T      LI   Y+L 
Sbjct: 116 RCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFLMY---TTCYAFLVLIYTCYELG 172

Query: 160 IYRNS 164
            + NS
Sbjct: 173 TWFNS 177

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 67/167 (40%), Gaps = 28/167 (16%)

Query: 22  LTTVSYFGILQDVLTTNQTI--WYFT-----TAIMISYSYYLAIVTPPTPAPSTLTQSFI 74
           LT+  YF  +   LT    I  W+       T ++  Y+YY  I T P  +P       +
Sbjct: 15  LTSCLYFWTVYTTLTRIHQIPGWFLAVTLIPTLMVALYTYYKVISTGPG-SPLDFPDLLV 73

Query: 75  SDVMNNENDIFPXXXXXXXXXXXLPR-----------------AHHCKTCNTCVVMMDHH 117
            D+   EN +             L R                  HHC +C+ C++ MDHH
Sbjct: 74  HDLKAAENGLELPPEYMSKRCMTLKRDGRFRVCQICHVWKPDRCHHCSSCDICILKMDHH 133

Query: 118 CPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLYIYRNS 164
           CPW   C G+ N   FI+FL +   +T      LI   Y+L  + NS
Sbjct: 134 CPWFAECTGFKNQKFFIQFLMY---TTFYAFLVLIDTCYELGTWFNS 177

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 23/39 (58%), Positives = 27/39 (69%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
           PR+ HC  C TCV+M DHHC W  NCVG  NY +F+ FL
Sbjct: 193 PRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFL 231

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 32/50 (64%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLL 148
           PR+ HC  C+ CV+ +DHHC W  NCVG  NY +F+ FL   I++   LL
Sbjct: 205 PRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIMTVIFLL 254

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 37/65 (56%), Gaps = 3/65 (4%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLY 159
           R HHC +C+ C++ MDHHCPW   C G+ N   FI+FL +   +T      LI   Y+L 
Sbjct: 116 RCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLMY---TTLYAFLVLIYTCYELG 172

Query: 160 IYRNS 164
            + NS
Sbjct: 173 TWFNS 177

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 27/40 (67%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAW 139
           R HHC +C+ C++ MDHHCPW   C G+ N   FI+FL +
Sbjct: 116 RCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMY 155

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 36/67 (53%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKL 158
           PRA HC  C  C+ + DHHC W  NCVG  NY +FI FL   I+S+  ++        ++
Sbjct: 199 PRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVGAILSSIFIIINCSIHVARI 258

Query: 159 YIYRNSP 165
               N+P
Sbjct: 259 RRASNAP 265

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 28/40 (70%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAW 139
           R+HHC +CN C +  DHHCPW  +C+G+ N   F++FL +
Sbjct: 120 RSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMY 159

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 31/51 (60%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLS 149
           PRA HC  C  CV+  DHHC W  NCVG  NY +F+ FL    +++  LL+
Sbjct: 187 PRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLISGTLASIFLLA 237

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 28/50 (56%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLL 148
           PRA HC+ C  CV   DHHC W  NCVG  NY +F+ FL     + T L 
Sbjct: 195 PRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFLTATCATCTVLF 244

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (65%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWV 140
           R HHC  C+ C++ MDHHCPW   C+G+ N   FI++L + 
Sbjct: 117 RCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLLYA 157

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 4/50 (8%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLS 149
           R+ HC  CN C++M+DHHC W  NC+G  NY +F  FL    +S   LLS
Sbjct: 142 RSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFL----LSNVTLLS 187

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 26/40 (65%)

Query: 98  LPRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
           +PR+ HC  C  C+ + DHHC W  NCVGY NY +F  FL
Sbjct: 137 VPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLI 152
           R+ HC  C TC+++ DHHC W  NC+G  NY +F  FL    IS +    +L+
Sbjct: 149 RSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYAFLRLL 201

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 30/44 (68%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIIS 143
           RA HC TCN+C++  DHHC W  NCVG  NY +F+ F+   +++
Sbjct: 199 RASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAVLT 242

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 37/64 (57%), Gaps = 5/64 (7%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKL 158
           PRA HC  C  CV+  DHHC W  NCVG  NY +F+ FL    +S+T   + LI     L
Sbjct: 169 PRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFL----LSSTLACALLIANC-AL 223

Query: 159 YIYR 162
           +++R
Sbjct: 224 HLHR 227

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 34/51 (66%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLS 149
           PRA HC  C++C++  DHHC W  NC+G  N+ +F+ FL   ++S+  LL+
Sbjct: 196 PRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLSSIWLLT 246

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 29/50 (58%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLL 148
           PR+ HC  C+ CV+  DHHC W  NC+G  NY  F+ FL    IS   L+
Sbjct: 183 PRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMASTISCILLI 232

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 25/40 (62%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLA 138
           PRA HC  C  C++  DHHC W  NC+G  NY +F+ FL 
Sbjct: 182 PRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLV 221

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score = 55.5 bits (132), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 25/39 (64%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLA 138
           R+ HC  CN+C+ + DHHC W  NCVG  NY +F  FL 
Sbjct: 146 RSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFLC 184

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 24/39 (61%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
           PR+ HC  C  C++  DHHC W  NC+G  NY  F+ FL
Sbjct: 226 PRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFL 264

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 4/50 (8%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLS 149
           R+ HC  CN CV++ DHHC W  NC+G  NY +F  FL    +S T LL 
Sbjct: 147 RSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFL----VSNTLLLG 192

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 32/58 (55%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYK 157
           R+ HC  CN C+++ DHHC W  NC+G  NY  F  FL   I+S +    +L   + K
Sbjct: 146 RSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMSYAFLRLCSISLK 203

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 30/46 (65%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTT 145
           R+ HC+ CN+C+++ DHHC W  NC+G  NY +F  FL    I+ T
Sbjct: 149 RSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMT 194

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 25/39 (64%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLA 138
           R+ HC  CN CV+ +DHHC W  NCVG  NY +F  FL 
Sbjct: 145 RSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFLV 183

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 33/62 (53%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLY 159
           R+ HC  C+ CV++ DHHC W  NCVG  NY +F  FL     S T    +L+   Y   
Sbjct: 147 RSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFLITNTFSLTYAFIRLLTIFYTTN 206

Query: 160 IY 161
           +Y
Sbjct: 207 VY 208

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 27/46 (58%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTT 145
           R+ HC  C  CV++ DHHC W  NC+G  NY  F  FL   +IS +
Sbjct: 148 RSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLS 193

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
            R+ HC  CN CV++ DHHC W  NC+G  NY  F  FL
Sbjct: 145 ARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFL 183

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 7/53 (13%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLA-------WVIISTT 145
           R HHC  C+ C +  DHHC W   C+GY N+  F+ FL        W+ I TT
Sbjct: 181 RCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFLLYASVYAFWICIITT 233

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
            R+ HC  CN CV++ DHHC W  NC+G  NY  F  FL
Sbjct: 145 ARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLI 152
           R+ HC  C  C  + DHHC W  NC+G  NY +F  FLA  +  T    ++L+
Sbjct: 141 RSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASNVFLTVYGFTRLL 193

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAW-VIISTTNLLSQLIKQAY 156
           R  HC  C+ CV + DHHC W  NC+G  NY +F  FL   V ++    L  L  Q +
Sbjct: 143 RTKHCPICDQCVQLADHHCVWANNCIGRGNYQYFYLFLVSNVFLTNYGFLRLLFLQRF 200

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 24/39 (61%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
            R+ HC  CN C+++ DHHC W  NC+G  NY  F  FL
Sbjct: 145 ARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFL 183

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%), Gaps = 4/51 (7%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLS 149
            R+ HC  C  C+++ DHHC W  NC+G  NY +F  FL    +S  ++LS
Sbjct: 142 ARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFL----LSNCSMLS 188

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query: 48  IMISYSYYLAIVTPPTPAPSTLTQSFISDVMNNENDI--FPXXXXXXXXXXXLPRAHHCK 105
           IM +   Y  ++T  T   +++     S+     ++I  FP             R+ HC 
Sbjct: 91  IMFTSLPYFGVMTMITKPENSIEHGINSNNRYRFDEILYFPNVSCKTCRKPKPARSKHCS 150

Query: 106 TCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLA 138
            C+ C+++ DHHC W  NC+G  NY  F  F+ 
Sbjct: 151 ICDKCILLQDHHCIWVNNCIGMGNYKWFYLFIG 183

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
           R+ HC  C+ C+++ DHHC W  NC+G  N+ +F  FL
Sbjct: 147 RSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFL 184

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 20/34 (58%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHF 133
           R+ HC  C  CV + DHHC W  NCVG  NY  F
Sbjct: 136 RSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLF 169

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%)

Query: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLI 152
            R+ HC  C  C+ + DHHC W   C+G  N+ +F  FLA   +  T   ++L 
Sbjct: 148 ARSKHCSICRRCIQLADHHCIWFNTCIGRGNFFYFYVFLACHCLILTYAFARLF 201

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIR-------FLAWVIISTTNLLSQLI 152
           R HH  T   C+   DH+C W    VG  NY  F++       F  +VI+ST + L ++I
Sbjct: 142 RTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAFYFWAFAIFVIVSTASFLPKII 201

Query: 153 K 153
           +
Sbjct: 202 R 202

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 7/62 (11%)

Query: 98  LPRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRF-------LAWVIISTTNLLSQ 150
           L R HH +    C+   DH+C W    +G  NY  FI++       LAW+ +S +  +  
Sbjct: 125 LERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLFIQYVFYYNLLLAWIWLSISAFIRS 184

Query: 151 LI 152
           ++
Sbjct: 185 IV 186

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 98  LPRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAW 139
           L R+HH K    C++  DH+C W    +   NY  F++++ W
Sbjct: 126 LSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLFLQYVGW 167

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 1/71 (1%)

Query: 98  LPRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYK 157
           L R HH      CV   DH+C W    +G  NY  F++F+A+  I+ + +   ++   + 
Sbjct: 131 LERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFVAYYAINLSIIWVSIVSYIHM 190

Query: 158 LYIYR-NSPFH 167
           +   R N P H
Sbjct: 191 IIRKRPNQPHH 201

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIIS 143
           R+HH    N C+   DH+C W    +G  NY  F+ FL +  +S
Sbjct: 129 RSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFVIFLFYCTVS 172

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWV 140
           R HH     +CV   DH+C W    +G  NY  FI+FL ++
Sbjct: 136 RTHHSGRTGSCVFKFDHYCGWLGTLIGAGNYLLFIQFLVYM 176

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 7/61 (11%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL-------AWVIISTTNLLSQLI 152
           R HH  T   C+   DH+C W    VG  NY  F++F         ++I S  + L ++I
Sbjct: 135 RTHHSSTLGYCIPRFDHYCVWIGTIVGRKNYRLFVQFAFYFWLFTIYMIASIASFLRRII 194

Query: 153 K 153
           K
Sbjct: 195 K 195

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 21/40 (52%)

Query: 98  LPRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
           + R HH K    C+   DHHC W    +G +NY  F +F+
Sbjct: 132 IGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFV 171

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 22/43 (51%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVII 142
           RAHH      CV   DH C W    +G  NY  FI+F+ ++ I
Sbjct: 137 RAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVMYMAI 179

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 22/43 (51%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVII 142
           R HH      CV   DH+C W    +G  NY  F++F+A+  I
Sbjct: 142 RTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFVQFVAYFSI 184

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 20/39 (51%)

Query: 98  LPRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRF 136
           + R HH  T   CV   DH+C W    VG  NY  FI+F
Sbjct: 135 MERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQF 173

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 21/42 (50%)

Query: 98  LPRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAW 139
           + R HH      C+   DH+C W    +G  NY  F++F A+
Sbjct: 139 MERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQFAAY 180

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLA 138
           R+      N  V   DH+CPW  N VG  N+  FI F+A
Sbjct: 482 RSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFIA 520

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 20/38 (52%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
           R+ +    N  V   DH+CPW  N VG  N+  FI F+
Sbjct: 482 RSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 23/45 (51%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIIST 144
           R+       T +   DH+CPW  N VG  N+  F+ F+A + ++ 
Sbjct: 472 RSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFVALIEVAV 516

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 37.0 bits (84), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWV 140
           R+ +    N  V   DH CPW  N VG  N+ +FI F+  V
Sbjct: 484 RSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFILLV 524

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 36.6 bits (83), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 31/72 (43%), Gaps = 6/72 (8%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL------AWVIISTTNLLSQLIK 153
           R HH      CV  +DH+C W    +G  NY  F +FL      A +I  +   L + I 
Sbjct: 132 RTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLMCFLMHALIIFVSVVSLQRRIA 191

Query: 154 QAYKLYIYRNSP 165
            + ++   R  P
Sbjct: 192 SSARMRGEREDP 203

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 36.6 bits (83), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 24/45 (53%)

Query: 98  LPRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVII 142
           + R+HH +    CV   DH+C W    +G  NY  F++++ +  I
Sbjct: 135 IERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFTI 179

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 21/42 (50%)

Query: 98  LPRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAW 139
           + R+HH      C+   DH+C W    +G  NY  F++F  +
Sbjct: 139 MERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFVQFTGY 180

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 21/42 (50%)

Query: 98  LPRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAW 139
           + R HH      CV   DH+C W    +G  NY  F++F+ +
Sbjct: 145 MERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFVTY 186

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/141 (20%), Positives = 54/141 (38%), Gaps = 11/141 (7%)

Query: 29  GILQDVLTTNQTIWYFTTAIMISYSYYLAIVTPPTPAPSTLTQSFISDVMNNEN-----D 83
           G++  VL+    IWY    +++        + P    P +  ++  S+    +N     D
Sbjct: 56  GLIIVVLSLTFLIWYIWALMLVLGPGRQPTIPPFKIIPDSEIRTVSSESAVPDNSIAPPD 115

Query: 84  IFPXXXX------XXXXXXXLPRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
           I+P                 + R HH      CV   DH+C W    +G  NY  F++F 
Sbjct: 116 IYPCDERGYPIWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQFT 175

Query: 138 AWVIISTTNLLSQLIKQAYKL 158
            ++ +    L+  +  Q  ++
Sbjct: 176 FYLDLVVLILMISIATQMRQM 196

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 19/38 (50%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
           R+   +     +V  DH CPW  N VG  N+  FI FL
Sbjct: 464 RSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFL 501

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 108 NTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
           N  V   DH+CPW  N VG  N+  FI F+
Sbjct: 490 NAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 23/37 (62%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRF 136
           RA + +  ++ ++  DH+CPW  N +G+ N+  FI F
Sbjct: 458 RAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 19/38 (50%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
           R+      N  V   DH+CPW  N VG  N+  F+ F+
Sbjct: 481 RSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFI 518

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 5/76 (6%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIISTTNLLSQLIKQAYKLY 159
           RAHH +    CV   DH C +  + +G  NY  F+++  ++ I    + + ++  AY   
Sbjct: 137 RAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCVFMTIWLAIIWTSIV--AYIRS 194

Query: 160 I---YRNSPFHLYQNV 172
           I   YR    HL  N+
Sbjct: 195 ITRDYRGHGSHLNGNL 210

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 24/45 (53%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIIST 144
           R+ +    N  +   DH+CPW  N +G+ N+  F+ F+ ++ I  
Sbjct: 466 RSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIMFLQIGV 510

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 20/36 (55%)

Query: 108 NTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIIS 143
           N+ V   DH+CPW  N +G  N+  FI F+  V I 
Sbjct: 481 NSTVSRFDHYCPWVYNDIGLKNHKIFIFFIISVEIG 516

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 47/119 (39%), Gaps = 13/119 (10%)

Query: 31  LQDVLTTNQTIWYFTTAIMISYSYYLAIVTP------PTPAPSTLTQSFISDVMNNENDI 84
           +QD  T N    +    I+++ SY L ++        PT   + + +  I D++      
Sbjct: 404 IQDQYTAN----FLLMIIILAVSYLLVVLVKSDPGRIPTEKNTQVIRETIKDLLATGK-- 457

Query: 85  FPXXXXXXXXXXXLP-RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVII 142
           F             P R+      N+ V   DH+CPW  N +G  N+  F+  +  V I
Sbjct: 458 FDSKNFCIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLVEI 516

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 41/102 (40%), Gaps = 5/102 (4%)

Query: 47  AIMISYSYYLA--IVTPPTPAPSTLTQSFISDVMNNENDI--FPXXXXXXXXXXXLP-RA 101
           +I+IS SY     + + P   P+      I + + N   I  F             P R+
Sbjct: 431 SIIISLSYLFVNLVRSDPGTKPAEFNHDSIRETITNLMLIGKFDTNNFCIESSVRKPLRS 490

Query: 102 HHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIIS 143
            +    +  V   DH CPW  N +G  N+  F+ F+  ++I 
Sbjct: 491 RYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVIG 532

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
           R+ +    N  V   DH+CPW  N VG  N+  F+ F+
Sbjct: 474 RSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFI 511

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 25/54 (46%), Gaps = 7/54 (12%)

Query: 99  PRAHHCKTCNTC-VVMMDHHCPWTMNCVGYTNYPHFIRFLA------WVIISTT 145
           P   H  T NT  V   DH CPW  N +G  N+ +F+ F+       W  IS T
Sbjct: 465 PLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFILLTEVGIWFFISLT 518

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/23 (47%), Positives = 15/23 (65%)

Query: 115 DHHCPWTMNCVGYTNYPHFIRFL 137
           DH+CPW  N +G  N+  FI F+
Sbjct: 493 DHYCPWVYNDIGLRNHKRFIMFI 515

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 19/38 (50%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
           R  H      CV   DH+C W    +G+ NY  F++F+
Sbjct: 126 RTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFV 163

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 108 NTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137
           +  ++  DH+CPW  N VG  N+  FI F+
Sbjct: 474 DALILRFDHYCPWIYNDVGLKNHKLFIFFI 503

>KAFR0E04310 Chr5 (868642..871791) [3150 bp, 1049 aa] {ON} Anc_4.361
           YJR132W
          Length = 1049

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 324 WDDNETHDNIKDMLLC-LPWPLNYSNNSTFQDGELVVKSNDYGETLQ 369
           W DN+    ++ ++L   P  L Y+NNS FQ+G   + +N  GE ++
Sbjct: 170 WKDNDARQELEKLILEYFPQLLEYANNSLFQNGS-TMTNNKVGELMK 215

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 21/45 (46%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWVIIST 144
           R+ + +     +   DH CPW  N +G  N+  F  F+  + IS 
Sbjct: 478 RSKYDRDSACLISAFDHFCPWVYNQIGLLNHKLFYMFVVLLEISV 522

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 19/41 (46%)

Query: 100 RAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFLAWV 140
           R+ +       V   DH+CPW  N VG  N+  F+ F   V
Sbjct: 458 RSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVTV 498

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 111 VVMMDHHCPWTMNCVGYTNYPHFIRFLAWV 140
           V+  DH+CPW  N VG  N+  F+ ++  V
Sbjct: 481 VLRFDHYCPWVYNDVGLLNHKKFMYYVMSV 510

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.135    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,831,852
Number of extensions: 1606575
Number of successful extensions: 4415
Number of sequences better than 10.0: 122
Number of HSP's gapped: 4422
Number of HSP's successfully gapped: 126
Length of query: 377
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 266
Effective length of database: 40,753,473
Effective search space: 10840423818
Effective search space used: 10840423818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 66 (30.0 bits)