Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A091205.698ON63363331420.0
KNAG0C065705.698ON59055421150.0
TBLA0E01140singletonON61152821140.0
TBLA0B04710singletonON61554021070.0
ZYRO0G06688g5.698ON61355020840.0
Kpol_529.285.698ON61053120770.0
TDEL0B022305.698ON57451220660.0
Suva_11.3295.698ON60153120480.0
CAGL0G02453g5.698ON59752520420.0
NCAS0A032205.698ON61153420280.0
TPHA0O02000singletonON62053720250.0
YKR093W (PTR2)5.698ON60153120150.0
TPHA0N01960singletonON59153020040.0
SAKL0E14828g5.698ON59253120020.0
Smik_11.3565.698ON60253120030.0
NDAI0E050205.698ON61953819780.0
KAFR0H00230singletonON59656719560.0
KAFR0H002405.698ON59155419440.0
KLLA0E12915g5.698ON65453319070.0
Skud_11.3315.698ON39939914740.0
Kwal_47.16930na 1ON6115276735e-79
KLTH0D16544gna 1ON6265696283e-72
AGL365Cna 2ON5995166151e-70
Ecym_2823na 2ON6135405844e-66
AFR228WsingletonON5765355255e-58
TBLA0F021307.309ON88093900.033
TBLA0F01600singletonON567117870.073
NDAI0F029202.138ON40464850.099
NCAS0A106203.276ON1085140800.54
NDAI0F01930singletonON564117790.56
TBLA0E026203.276ON1136140751.8
TBLA0A03430singletonON56493751.9
TBLA0B062604.341aON124471752.3
ADL156Cna 3ON483147733.0
Suva_2.730na 4ON562149724.1
NCAS0H018905.396ON59170707.0
YDR536W (STL1)na 4ON569149707.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A09120
         (633 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa] ...  1214   0.0  
KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON} Anc_5...   819   0.0  
TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {O...   818   0.0  
TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON}            816   0.0  
ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {...   807   0.0  
Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}...   804   0.0  
TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {O...   800   0.0  
Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093...   793   0.0  
CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly...   791   0.0  
NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {O...   785   0.0  
TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {...   784   0.0  
YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integ...   780   0.0  
TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {...   776   0.0  
SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} simi...   775   0.0  
Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093...   776   0.0  
NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON} Anc_5...   766   0.0  
KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON}      758   0.0  
KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}...   753   0.0  
KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]...   739   0.0  
Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093...   572   0.0  
Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093...   263   5e-79
KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]...   246   3e-72
AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON} NOH...   241   1e-70
Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar...   229   4e-66
AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-synteni...   206   5e-58
TBLA0F02130 Chr6 complement(522486..525128) [2643 bp, 880 aa] {O...    39   0.033
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    38   0.073
NDAI0F02920 Chr6 (715012..716226) [1215 bp, 404 aa] {ON} Anc_2.1...    37   0.099
NCAS0A10620 Chr1 complement(2115434..2118691) [3258 bp, 1085 aa]...    35   0.54 
NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON}               35   0.56 
TBLA0E02620 Chr5 complement(659914..663324) [3411 bp, 1136 aa] {...    33   1.8  
TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {O...    33   1.9  
TBLA0B06260 Chr2 complement(1477173..1480907) [3735 bp, 1244 aa]...    33   2.3  
ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON} S...    33   3.0  
Suva_2.730 Chr2 (1271371..1273059) [1689 bp, 562 aa] {ON} YDR536...    32   4.1  
NCAS0H01890 Chr8 complement(365526..367301) [1776 bp, 591 aa] {O...    32   7.0  
YDR536W Chr4 (1508005..1509714) [1710 bp, 569 aa] {ON}  STL1Glyc...    32   7.6  

>TBLA0A09120 Chr1 complement(2259486..2261387) [1902 bp, 633 aa]
           {ON} Anc_5.698 YKR093W
          Length = 633

 Score = 1214 bits (3142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/633 (93%), Positives = 591/633 (93%)

Query: 1   MFNLKKNKSTESFETENEXXXXXXXXXXXXXXXXXXXXXXXXXDIDYIPTQDEKRDQKFE 60
           MFNLKKNKSTESFETENE                         DIDYIPTQDEKRDQKFE
Sbjct: 1   MFNLKKNKSTESFETENEQVNDVTTIDVTDNNQNVVQMVNGGGDIDYIPTQDEKRDQKFE 60

Query: 61  TFQEDSSIINDENXXXXXXXXXXXXXXXXXLKHVGGKIPLRCWLMAVIELAERFSYYGLS 120
           TFQEDSSIINDEN                 LKHVGGKIPLRCWLMAVIELAERFSYYGLS
Sbjct: 61  TFQEDSSIINDENEVITEDFEEPTEEELRTLKHVGGKIPLRCWLMAVIELAERFSYYGLS 120

Query: 121 APFQNYMQNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPVFAGYMADTYWGKFTTICI 180
           APFQNYMQNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPVFAGYMADTYWGKFTTICI
Sbjct: 121 APFQNYMQNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPVFAGYMADTYWGKFTTICI 180

Query: 181 GTGIYIVGIFILFITSLPSITSHNTAMGGFIVTLILVGIATGMIKANLSVMIAEQIPKRK 240
           GTGIYIVGIFILFITSLPSITSHNTAMGGFIVTLILVGIATGMIKANLSVMIAEQIPKRK
Sbjct: 181 GTGIYIVGIFILFITSLPSITSHNTAMGGFIVTLILVGIATGMIKANLSVMIAEQIPKRK 240

Query: 241 RRVITKKNGTRVIEDPDITIQNVFMTFYFMINIGSLSVIATTELEAHKGFWAAYLLPFCF 300
           RRVITKKNGTRVIEDPDITIQNVFMTFYFMINIGSLSVIATTELEAHKGFWAAYLLPFCF
Sbjct: 241 RRVITKKNGTRVIEDPDITIQNVFMTFYFMINIGSLSVIATTELEAHKGFWAAYLLPFCF 300

Query: 301 FWVAVIVLIVGNKTYIKTPVGDKVISKCFKVLRILMRNRFNPDSAKPAFNPDKNYPWSDK 360
           FWVAVIVLIVGNKTYIKTPVGDKVISKCFKVLRILMRNRFNPDSAKPAFNPDKNYPWSDK
Sbjct: 301 FWVAVIVLIVGNKTYIKTPVGDKVISKCFKVLRILMRNRFNPDSAKPAFNPDKNYPWSDK 360

Query: 361 FVDEIMRALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELHGLPNDFFQAIDSIALIVF 420
           FVDEIMRALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELHGLPNDFFQAIDSIALIVF
Sbjct: 361 FVDEIMRALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELHGLPNDFFQAIDSIALIVF 420

Query: 421 IPICERFVYPFIRKYTPFKPITKIFWGFTFGALSMTWACVLQHFIYKAAPCYDHPSKCDN 480
           IPICERFVYPFIRKYTPFKPITKIFWGFTFGALSMTWACVLQHFIYKAAPCYDHPSKCDN
Sbjct: 421 IPICERFVYPFIRKYTPFKPITKIFWGFTFGALSMTWACVLQHFIYKAAPCYDHPSKCDN 480

Query: 481 GPNHIHVALQVPAYCLLALSEIFASITGLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGC 540
           GPNHIHVALQVPAYCLLALSEIFASITGLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGC
Sbjct: 481 GPNHIHVALQVPAYCLLALSEIFASITGLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGC 540

Query: 541 ALSPVSKDPKYVWLYGGLAVACFVGGCLFWIIFKKYNDMEEELNNLDFEEGDDMLETKHA 600
           ALSPVSKDPKYVWLYGGLAVACFVGGCLFWIIFKKYNDMEEELNNLDFEEGDDMLETKHA
Sbjct: 541 ALSPVSKDPKYVWLYGGLAVACFVGGCLFWIIFKKYNDMEEELNNLDFEEGDDMLETKHA 600

Query: 601 GDIEMIQPISSRRSSLKSNELVDEGSIHSTNRS 633
           GDIEMIQPISSRRSSLKSNELVDEGSIHSTNRS
Sbjct: 601 GDIEMIQPISSRRSSLKSNELVDEGSIHSTNRS 633

>KNAG0C06570 Chr3 (1273605..1275377) [1773 bp, 590 aa] {ON}
           Anc_5.698 YKR093W
          Length = 590

 Score =  819 bits (2115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/554 (70%), Positives = 452/554 (81%), Gaps = 10/554 (1%)

Query: 52  DEKRD-----QKFETFQEDSSIINDENXXXX----XXXXXXXXXXXXXLKHVGGKIPLRC 102
           D+K D     +   T +EDS I++D                       LKHVGG IP+RC
Sbjct: 16  DKKNDLVLTKENSHTIEEDSRIVDDLASQYEDDIPEGYEVPTEEELRTLKHVGGHIPMRC 75

Query: 103 WLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPV 162
           WL+AV+EL+ERFSYYGLSAPFQNYM NGP+D PPG L L+S GATGLSYFFQFWCY+TP+
Sbjct: 76  WLIAVVELSERFSYYGLSAPFQNYMANGPHDKPPGLLQLNSDGATGLSYFFQFWCYVTPI 135

Query: 163 FAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGFIVTLILVGIATG 222
           F GYMADT+WGK+ TI +GTGIYI GIFILF+TS+PSIT+ N  +GGFIV +IL+GIATG
Sbjct: 136 FGGYMADTHWGKYNTIAVGTGIYICGIFILFMTSIPSITTKNAGLGGFIVAIILIGIATG 195

Query: 223 MIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFMINIGSLSVIATT 282
           MIK+NLSV+IA+Q+PKRK  V TKKNG RVIED ++T+QNVFM FY MINIGSLSVIAT+
Sbjct: 196 MIKSNLSVLIADQLPKRKPLVKTKKNGERVIEDTNLTLQNVFMFFYLMINIGSLSVIATS 255

Query: 283 ELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFKVLRILMRNRFNP 342
           ELE H+GFWAAYLLPFCFFW+AV+VL++G   Y+K P+GDKVISKCFKVL IL +NRFN 
Sbjct: 256 ELELHRGFWAAYLLPFCFFWIAVVVLVLGKNQYVKPPIGDKVISKCFKVLWILTKNRFNF 315

Query: 343 DSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELH 402
           D+ KP+ NP KNYPWSDKFVDEI RAL ACKVF+FYPIYW CYGQM++ FV+QG  MELH
Sbjct: 316 DAPKPSLNPTKNYPWSDKFVDEIQRALGACKVFLFYPIYWTCYGQMMSGFVTQGSMMELH 375

Query: 403 GLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTFGALSMTWACVLQ 462
           GLPNDFFQ IDSIA+IVFIP+CE  +YPFIRKYTPF+PITKI++GF F +  M WA VLQ
Sbjct: 376 GLPNDFFQCIDSIAIIVFIPVCEHLLYPFIRKYTPFRPITKIYFGFMFASGCMIWAAVLQ 435

Query: 463 HFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGLEYAYSKAPASMKA 522
            +IYKA P Y  P + D GPN IHVALQVPAY LLA SEIFASITGLEYAYSKAPASMK+
Sbjct: 436 SYIYKAGPHYKWPLEHD-GPNRIHVALQVPAYVLLAFSEIFASITGLEYAYSKAPASMKS 494

Query: 523 FIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFWIIFKKYNDMEEE 582
           FIMSIFLVTNAFG+AIGCALSPVSKDP + WLY GLAVACF+ GCLFW+ F+KYND+EEE
Sbjct: 495 FIMSIFLVTNAFGSAIGCALSPVSKDPDWTWLYTGLAVACFISGCLFWVCFRKYNDIEEE 554

Query: 583 LNNLDFEEGDDMLE 596
           +N +D+E    ML+
Sbjct: 555 MNAMDYEVDATMLK 568

>TBLA0E01140 Chr5 complement(250628..252463) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/528 (71%), Positives = 450/528 (85%), Gaps = 2/528 (0%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLS 150
           LK VGG IP RCWLMAVIEL+ERFSYYGLSAPFQNYMQNGP D+PPGALSL++ GATGLS
Sbjct: 79  LKRVGGYIPARCWLMAVIELSERFSYYGLSAPFQNYMQNGPYDTPPGALSLNTQGATGLS 138

Query: 151 YFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGF 210
           YFFQFWCY+TP+F GYMADTYWGK+ TI +G   YI GIFILF+TSLP +TS++ AMGGF
Sbjct: 139 YFFQFWCYITPIFGGYMADTYWGKYNTIWVGVISYICGIFILFMTSLPKLTSYSAAMGGF 198

Query: 211 IVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFM 270
           IV++I++G+ TGMIKANLSVMIAEQ+PKRKRR+IT+K+GTRVIEDPDIT+QNVFM FYFM
Sbjct: 199 IVSIIIIGLGTGMIKANLSVMIAEQVPKRKRRIITRKDGTRVIEDPDITLQNVFMAFYFM 258

Query: 271 INIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFK 330
           IN+GSLSV+ATTELEA KGFWAAYLLPFCFFWVAV+VL++GNK +IK P+GDK ISK FK
Sbjct: 259 INVGSLSVMATTELEARKGFWAAYLLPFCFFWVAVVVLMIGNKRFIKVPIGDKTISKSFK 318

Query: 331 VLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLN 390
           V+ IL++N+FN +SAKP+ +P+ NYPW+DKFV+EI RA++AC VF FYPIYWVCYGQMLN
Sbjct: 319 VVGILIKNKFNYESAKPSIHPECNYPWTDKFVEEIRRAIKACNVFYFYPIYWVCYGQMLN 378

Query: 391 NFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTF 450
           NFV+QGG MELH LPNDF Q IDSIALIVFIPICER +YPF+R++TP +PITKI  GF F
Sbjct: 379 NFVTQGGQMELHDLPNDFLQVIDSIALIVFIPICERLIYPFVRRFTPLRPITKITIGFFF 438

Query: 451 GALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGLE 510
           G+ SM WA VLQ F+Y+  PCY HP+ C NGPNHIHV  QVPAYCL+ALSEIFASITGLE
Sbjct: 439 GSFSMVWAAVLQWFVYQKPPCYYHPTNCPNGPNHIHVCWQVPAYCLIALSEIFASITGLE 498

Query: 511 YAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFW 570
           YAYSKAPASMK+FIMSIFL T A G+A+G ALSPVS DPK+ W Y GLAV+CF+ G  FW
Sbjct: 499 YAYSKAPASMKSFIMSIFLFTTAIGSALGAALSPVSIDPKFTWQYVGLAVSCFIAGIAFW 558

Query: 571 IIFKKYNDMEEELNNLDFEEGDDMLETKHAGDIEMIQPISSRRSSLKS 618
           + F +YND E+ELNN+D  +  D+++     + + ++  +S RS + S
Sbjct: 559 LCFSRYNDEEDELNNID--DQPDVIQISSENENDDLEAKNSIRSRVIS 604

>TBLA0B04710 Chr2 (1104183..1106030) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  816 bits (2107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/540 (73%), Positives = 461/540 (85%), Gaps = 3/540 (0%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLS 150
           L    G IP  CWL+A+IELAERFSYYGLSAPFQNYMQN P+D+PPGALSL+S+GATGLS
Sbjct: 75  LPREAGHIPFNCWLLAIIELAERFSYYGLSAPFQNYMQNNPSDNPPGALSLNSTGATGLS 134

Query: 151 YFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGF 210
           YFFQFWCY+TP+FAG+MADTYWGKF T+CIGT IYI+GIFILFITSLP+ITS+NTA+GGF
Sbjct: 135 YFFQFWCYVTPIFAGFMADTYWGKFNTLCIGTIIYIIGIFILFITSLPAITSYNTALGGF 194

Query: 211 IVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKK-NGTRVIEDPDITIQNVFMTFYF 269
           IV +IL+GIATGMIKANLSVMIA+Q+PK+K RV+TKK +G RVIEDP +TIQNVFM FYF
Sbjct: 195 IVAIILIGIATGMIKANLSVMIADQLPKKKLRVVTKKKSGKRVIEDPQLTIQNVFMAFYF 254

Query: 270 MINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCF 329
           MIN+GSLSVIATTELE H GFWAAYLLPFCFFW+AV+VL  GN+ ++K P+GD+VISKCF
Sbjct: 255 MINVGSLSVIATTELELHVGFWAAYLLPFCFFWIAVLVLAFGNRKFVKKPIGDRVISKCF 314

Query: 330 KVLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQML 389
            ++ IL++N FN   AKP +NP+KNYPWSDKFVDEI R+L+ACKVF+FYPIYWVCYGQML
Sbjct: 315 TIIGILIKNNFNFQKAKPTYNPEKNYPWSDKFVDEIQRSLKACKVFLFYPIYWVCYGQML 374

Query: 390 NNFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFT 449
           NNFV+QG TM+LHGLPNDFFQAI+SIALIVFIPI E+FVYPFIRK+TP KPITK+  GF 
Sbjct: 375 NNFVTQGSTMQLHGLPNDFFQAINSIALIVFIPIVEKFVYPFIRKFTPLKPITKVTIGFV 434

Query: 450 FGALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGL 509
           FG+L+M WA VLQHFIY+A PCYDHP KC NGPNH+HVA QVPAYCL++LSEIFASITGL
Sbjct: 435 FGSLAMVWAAVLQHFIYQAGPCYDHPVKCPNGPNHVHVAWQVPAYCLISLSEIFASITGL 494

Query: 510 EYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLF 569
           E AYSKAP SMK+FIMS+FLVTNAFGAAIGCALS VS+DPKYVWLY GLAV CF  G  F
Sbjct: 495 EIAYSKAPESMKSFIMSMFLVTNAFGAAIGCALSSVSEDPKYVWLYTGLAVTCFCAGIAF 554

Query: 570 WIIFKKYNDMEEELNNLDFEEGDDMLETKHAGDIEMIQPISSRRSSLKSNELVDEGSIHS 629
           W  FK YND E+ +NN+DF E D+  E      IE ++ +S  +++ K +   D   I S
Sbjct: 555 WFTFKHYNDEEDAMNNIDF-ESDNENEKNEYSQIENLE-LSQTKTTDKDDVHTDIERISS 612

>ZYRO0G06688g Chr7 complement(535282..537123) [1842 bp, 613 aa] {ON}
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 613

 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/550 (68%), Positives = 452/550 (82%), Gaps = 13/550 (2%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLS 150
           L+HVGG IP RCWL+A++EL+ERFSYYGLSAPFQNYMQNG +D+P G L L S GATGL+
Sbjct: 55  LRHVGGHIPFRCWLIAIVELSERFSYYGLSAPFQNYMQNGKHDNPAGVLDLKSQGATGLA 114

Query: 151 YFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGF 210
           YFFQFWCY+TPVF G++ADTYWGK+ TIC+GTG+Y+VGIFILFITSLPS+ S NTA+GGF
Sbjct: 115 YFFQFWCYVTPVFGGWLADTYWGKYETICVGTGVYVVGIFILFITSLPSVDSKNTALGGF 174

Query: 211 IVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFM 270
           I  ++L+GIATGMIKANLSV+IA+Q PKRK R+ T K G RVIEDP+ITIQNVFM FY M
Sbjct: 175 ITAIVLIGIATGMIKANLSVLIADQFPKRKPRIKTTKRGERVIEDPNITIQNVFMFFYLM 234

Query: 271 INIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFK 330
           INIGSLSVIATTELE HKGFWAAYLLPFCFFW+AVIVL VG K+Y++ PVGDKVI+K F+
Sbjct: 235 INIGSLSVIATTELEEHKGFWAAYLLPFCFFWIAVIVLFVGRKSYVRPPVGDKVIAKSFR 294

Query: 331 VLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLN 390
           VL  L+++RF+ ++ KP+ +P+++YPW+D FV+EI RAL+ACKVF+FYPIYWV YGQM +
Sbjct: 295 VLGQLIKHRFDYEAVKPSVHPERDYPWNDHFVEEIKRALKACKVFMFYPIYWVPYGQMTS 354

Query: 391 NFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTF 450
            FVS GG M+LHGLPNDFFQAIDSIALIVFIPICE ++YPFIR+YTPFKPITKIF+GF +
Sbjct: 355 TFVSVGGEMQLHGLPNDFFQAIDSIALIVFIPICEYWLYPFIRRYTPFKPITKIFFGFMW 414

Query: 451 GALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGLE 510
            + SM WA VLQHFIYK  PCYDHP  C NGPN+IH+  QVPAY L+A SEIFASITGLE
Sbjct: 415 CSASMIWAAVLQHFIYKTGPCYDHPMDCPNGPNNIHIGWQVPAYVLIAFSEIFASITGLE 474

Query: 511 YAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFW 570
           YAYSKAP SMK+FIMSIFL+TNAFG+AIGCALSPV  DPKY+W++ GLAVA F+ GCLFW
Sbjct: 475 YAYSKAPTSMKSFIMSIFLLTNAFGSAIGCALSPVDTDPKYLWMFTGLAVASFISGCLFW 534

Query: 571 IIFKKYNDMEEELNNLDFEE-----------GDDMLETKHAGDIEMIQPISSRRSS--LK 617
           + F   ND EEE+N +D+EE           G   LE + AG  + +  I S  ++    
Sbjct: 535 LTFHHLNDTEEEMNAMDYEENQEKIDDGLQKGTSDLEFEPAGADDKLDHIGSHGATGFRH 594

Query: 618 SNELVDEGSI 627
             EL +EG +
Sbjct: 595 DGELGEEGEL 604

>Kpol_529.28 s529 complement(82303..84135) [1833 bp, 610 aa] {ON}
           complement(82303..84135) [1833 nt, 611 aa]
          Length = 610

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/531 (70%), Positives = 450/531 (84%), Gaps = 7/531 (1%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLS 150
           LKHV GKIP+RCWL+AV+EL+ERFSYYGL+APFQNYM NGPND+P G L LD+ GA+ LS
Sbjct: 76  LKHVSGKIPMRCWLIAVVELSERFSYYGLAAPFQNYMANGPNDTPKGVLMLDTQGASALS 135

Query: 151 YFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGF 210
           YFFQFWCY+TP+F GYMADTYWGK+ TIC GTGIY+VGIF+LFITSLPSI +  TA+GG+
Sbjct: 136 YFFQFWCYITPIFGGYMADTYWGKYNTICAGTGIYVVGIFLLFITSLPSIDTRETALGGY 195

Query: 211 IVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFM 270
           +  +IL+GIATGMIKAN+SV+IAEQIP+ K RVIT+K G RVIEDP+IT QNVFM FY M
Sbjct: 196 VTAIILIGIATGMIKANISVLIAEQIPRTKPRVITQKGGKRVIEDPNITTQNVFMFFYMM 255

Query: 271 INIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFK 330
           IN+GSLS++ATTELE+HKGFWAAYLLPFCFFW+AV+VL++G   YI  PVGDK+ISK FK
Sbjct: 256 INVGSLSLMATTELESHKGFWAAYLLPFCFFWIAVVVLVIGRNQYIMVPVGDKMISKSFK 315

Query: 331 VLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLN 390
           V+ IL++N+ N D+AKP+ NP+KNYPW+DKFV+EI RAL+ACKVFVFYPIYW  YGQM+N
Sbjct: 316 VMWILVKNKLNFDAAKPSMNPEKNYPWNDKFVEEIRRALRACKVFVFYPIYWCVYGQMIN 375

Query: 391 NFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTF 450
           NFV+Q GTMELH LPNDF QA DSIA+IVFIPI ERF+YPF+R++TPF+PITKIFWGF F
Sbjct: 376 NFVTQAGTMELHNLPNDFLQAFDSIAIIVFIPIFERFIYPFVRRFTPFRPITKIFWGFMF 435

Query: 451 GALSMTWACVLQHFIYKAAPCYDHPSKC----DNGPNHIHVALQVPAYCLLALSEIFASI 506
           G+ +M WA VLQ FIYKA PCY+ P KC     N PN +HVA QVPAY L+A+SEI AS+
Sbjct: 436 GSGAMIWAAVLQSFIYKAGPCYNMPMKCAPEYANTPNQVHVAWQVPAYVLIAISEILASV 495

Query: 507 TGLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGG 566
           TGLEYAYS APASMK+FIMSIFLVTNAFG+AIG A+SP ++DPKY W + GLAVACF+ G
Sbjct: 496 TGLEYAYSNAPASMKSFIMSIFLVTNAFGSAIGIAISPTAQDPKYTWTFTGLAVACFIAG 555

Query: 567 CLFWIIFKKYNDMEEELNNLDFEEGDDMLETKHAGD---IEMIQPISSRRS 614
           CLFWI F+ YN+ E+ +N++DF + DD      AG+   IE+++PI+S RS
Sbjct: 556 CLFWICFRSYNNTEDAMNDIDFMDDDDDKIMPTAGEKTSIEVMEPITSFRS 606

>TDEL0B02230 Chr2 complement(402022..403746) [1725 bp, 574 aa] {ON}
           Anc_5.698 YKR093W
          Length = 574

 Score =  800 bits (2066), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/512 (73%), Positives = 443/512 (86%), Gaps = 3/512 (0%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLS 150
           LKHV G IP RCWL+AV+EL+ERF+YYGLS PFQNYMQNGP+D+P G L+L S GATGLS
Sbjct: 55  LKHVAGTIPFRCWLIAVVELSERFAYYGLSTPFQNYMQNGPDDTPAGLLNLKSQGATGLS 114

Query: 151 YFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGF 210
           YFFQFWCY+TP+F G+++DTY GK+ TIC GTG+Y++GI ILF+TS+PSIT+ N A GGF
Sbjct: 115 YFFQFWCYVTPIFGGWLSDTYIGKYNTICWGTGVYVIGILILFVTSIPSITTQNAATGGF 174

Query: 211 IVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFM 270
           I  +IL+GIATGMIK+N+SV+IA+Q PK++ RVITKK+GTRVIEDP+IT+QNVFM FY M
Sbjct: 175 IAAIILIGIATGMIKSNISVLIADQFPKQRHRVITKKDGTRVIEDPNITLQNVFMIFYLM 234

Query: 271 INIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFK 330
           INIGSLSVIATTELEAH GFWAAYLLPFCFFW+AVIVL VG  +Y+K PVGDKVISKCFK
Sbjct: 235 INIGSLSVIATTELEAHVGFWAAYLLPFCFFWIAVIVLAVGKNSYVKPPVGDKVISKCFK 294

Query: 331 VLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLN 390
           V+ I ++N+FN ++AKP+ +PD+ +PW+DKFVDEI+R+L ACKVF+FYP+YWVCYGQMLN
Sbjct: 295 VVGIAIKNKFNFEAAKPSVSPDRAFPWTDKFVDEIVRSLSACKVFLFYPVYWVCYGQMLN 354

Query: 391 NFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTF 450
            FVS GGTMELHGLPNDFFQAIDSIALIVFIPICE F+YP+IRK+TPF+PITKIFWGF F
Sbjct: 355 TFVSVGGTMELHGLPNDFFQAIDSIALIVFIPICEYFLYPYIRKFTPFRPITKIFWGFMF 414

Query: 451 GALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGLE 510
           GA +M WA VLQHFIYK+ P Y +P   +N PNHIH+A QVPAY L+A SEIFASITGLE
Sbjct: 415 GAAAMVWAAVLQHFIYKSGPWYKYP-MAENTPNHIHIAWQVPAYVLIAFSEIFASITGLE 473

Query: 511 YAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFW 570
           YAYSKAP +MK+FIM+IFL+TNAFG+AIGCALSPV+KDP YVWLY GL VACF  G LFW
Sbjct: 474 YAYSKAPVTMKSFIMAIFLLTNAFGSAIGCALSPVTKDPDYVWLYVGLGVACFAAGWLFW 533

Query: 571 IIFKKYNDMEEELNNLDFEEGDDMLETKHAGD 602
             FK YND EE +N LD++E   ML  KH+ D
Sbjct: 534 FCFKHYNDTEEAMNALDYDEDPTML--KHSKD 563

>Suva_11.329 Chr11 (600372..602177) [1806 bp, 601 aa] {ON} YKR093W
           (REAL)
          Length = 601

 Score =  793 bits (2048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/531 (68%), Positives = 450/531 (84%), Gaps = 5/531 (0%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLS 150
           L+HVGGKIP+RCWL+A++EL+ERFSYYGLSAPFQNYM+ GPND+P G LSL+SSGATGLS
Sbjct: 71  LRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDTPKGMLSLNSSGATGLS 130

Query: 151 YFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGF 210
           YFFQFWCY+TPVF GY+ADT+WGK+ TIC GT IYI GIFILFITS+PS+ + ++A+GGF
Sbjct: 131 YFFQFWCYVTPVFGGYIADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSALGGF 190

Query: 211 IVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFM 270
           I ++IL+GIATGMIKANLSV+IA+Q+PKRK  +   K+G RVIED +IT+QNVFM FYFM
Sbjct: 191 IASIILIGIATGMIKANLSVLIADQLPKRKPFIKVLKSGERVIEDGNITLQNVFMFFYFM 250

Query: 271 INIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFK 330
           IN+GSLS++ATTELE HKGFWAAYLLPFCFFWVAV+ L+ G K YI+ P+GDKVI+K FK
Sbjct: 251 INVGSLSLMATTELEYHKGFWAAYLLPFCFFWVAVVTLVFGKKQYIQRPIGDKVIAKSFK 310

Query: 331 VLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLN 390
           V  IL +N+F+ ++AKP+ +P+K+YPW+DKFVDEI RAL ACKVFVFYPIYW  YG M++
Sbjct: 311 VCWILTKNKFDFNAAKPSVHPEKDYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMIS 370

Query: 391 NFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTF 450
           +F++Q   MELHG+PNDF QA DSIALI+FIPI E+F YPFIR+YTPFKPITKIF+GF F
Sbjct: 371 SFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFGYPFIRRYTPFKPITKIFFGFMF 430

Query: 451 GALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGLE 510
           G+ +MTWA VLQ F+YKA P Y  P    N PNH+HV  Q+PAY L++ SEIFASITGLE
Sbjct: 431 GSFAMTWAAVLQSFVYKAGPWYSEPLG-HNTPNHVHVCWQIPAYVLISFSEIFASITGLE 489

Query: 511 YAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFW 570
           YAYSKAPA+MK+FIMSIFL+TNAFG+AIGCALSPV+ DPK+ WL+ GLAVACF+ GCLFW
Sbjct: 490 YAYSKAPANMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFW 549

Query: 571 IIFKKYNDMEEELNNLDFEEGDDM----LETKHAGDIEMIQPISSRRSSLK 617
           + F+KYND EEE+N +D+EE D+     +    A DIE+++P+ S +S+ K
Sbjct: 550 LCFRKYNDTEEEMNAMDYEEEDEFDLNPISQPKANDIEILEPMGSLKSTTK 600

>CAGL0G02453g Chr7 (218003..219796) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093w PTR2
          Length = 597

 Score =  791 bits (2042), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/525 (71%), Positives = 439/525 (83%), Gaps = 2/525 (0%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLS 150
           L+HV G IPLRCWL+A++EL+ERFSYYGLSAPFQNYMQNGPND+P G L L S GATGLS
Sbjct: 73  LRHVAGHIPLRCWLIAIVELSERFSYYGLSAPFQNYMQNGPNDNPKGLLGLKSQGATGLS 132

Query: 151 YFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGF 210
           YFFQFWCY+TPVF G+++DTYWGK+ TIC+GT IY+ GIFILFITS+P +T+ + A+GGF
Sbjct: 133 YFFQFWCYVTPVFGGWVSDTYWGKYNTICVGTFIYVCGIFILFITSIPGVTNSDGALGGF 192

Query: 211 IVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFM 270
           I  +IL+GIATGMIK+NLSV+IA+Q+P +K RV+  K G RVIEDP++T+QNVFM FYF 
Sbjct: 193 IAAIILIGIATGMIKSNLSVLIADQLPNKKPRVVITKKGERVIEDPNLTLQNVFMFFYFT 252

Query: 271 INIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFK 330
           IN+GSLSV+ATTELE HKGFWAAYLLPFCFFWVAV VL+ G   YIK PVGDKVISK FK
Sbjct: 253 INVGSLSVMATTELEYHKGFWAAYLLPFCFFWVAVAVLVFGRNQYIKPPVGDKVISKSFK 312

Query: 331 VLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLN 390
           VL IL +N+FN ++AKP+FNPDKN+PWSDKFVDEI RALQACKVFVFYP+YWVCYG MLN
Sbjct: 313 VLYILSKNKFNAEAAKPSFNPDKNFPWSDKFVDEIKRALQACKVFVFYPVYWVCYGTMLN 372

Query: 391 NFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTF 450
           NFV+QGGTMELH LPNDF QA DSIALI+FIPI ERFVYPFIR+YTP +PITKIF+GF  
Sbjct: 373 NFVTQGGTMELHNLPNDFLQAFDSIALIIFIPIFERFVYPFIRRYTPLRPITKIFFGFMV 432

Query: 451 GALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGLE 510
           G+ +M WA VLQHFIY   P YDHP   D  PNHIHVA Q+PAY L+A+SEIFASITGLE
Sbjct: 433 GSGAMVWAAVLQHFIYTKGPWYDHPLDHDT-PNHIHVAWQIPAYVLIAISEIFASITGLE 491

Query: 511 YAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFW 570
           YAYSKAP SMK+FIMSIFL+TNAFG+AIGCALSPVS DPK+VW Y GLA ACF+ G +FW
Sbjct: 492 YAYSKAPESMKSFIMSIFLLTNAFGSAIGCALSPVSVDPKFVWFYTGLACACFIAGWVFW 551

Query: 571 IIFKKYNDMEEELNNLDFEEGDDMLETKHAGDIEMIQPISSRRSS 615
            I+   ND EE +N LD+E  D+ +   H+ D E  + + S +S 
Sbjct: 552 FIYSGLNDEEEAMNALDYEH-DEFMYKHHSDDEEAAEHVRSIKSE 595

>NCAS0A03220 Chr1 complement(635016..636851) [1836 bp, 611 aa] {ON}
           Anc_5.698
          Length = 611

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/534 (69%), Positives = 446/534 (83%), Gaps = 5/534 (0%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLS 150
           L+HV GKIPLRCWL+A++ELAERFSYYGLSAPFQNYM+NGPND+P G L L+SSGATGLS
Sbjct: 76  LRHVSGKIPLRCWLIALVELAERFSYYGLSAPFQNYMENGPNDTPAGVLELNSSGATGLS 135

Query: 151 YFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGF 210
           YFFQFWCY+TPVF G+MADTYWGK+ TIC+GTGIY+ GIFILFITS+PSI S +T++GGF
Sbjct: 136 YFFQFWCYVTPVFGGFMADTYWGKYNTICVGTGIYLAGIFILFITSIPSIASKDTSLGGF 195

Query: 211 IVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFM 270
           I  +IL+GIATGMIKANLSV+IA+Q+PKRK RV T K+G RV+EDP+IT+QNVFM FY M
Sbjct: 196 IAAIILIGIATGMIKANLSVLIADQLPKRKPRVKTLKSGERVVEDPNITLQNVFMWFYLM 255

Query: 271 INIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFK 330
           +N+GSLSVIATTELE HK FWAA+LLPFCFFW+AV+VL+ G   Y+K    +K I K FK
Sbjct: 256 VNVGSLSVIATTELEEHKNFWAAFLLPFCFFWIAVVVLVGGRNQYVKEGKREKSIQKSFK 315

Query: 331 VLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLN 390
           +L I+ +N+F+  SAKP+++P+KNYPW+DKFVDE  RAL ACKVF+FYPIYWV YG M++
Sbjct: 316 ILWIVSKNKFDLTSAKPSYHPEKNYPWTDKFVDECSRALSACKVFLFYPIYWVIYGTMIS 375

Query: 391 NFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTF 450
            FV+QG  MELHGLPND FQAIDS ALI+FIPICERF+YPFIR++TPFKPITKIF+GF F
Sbjct: 376 TFVTQGSMMELHGLPNDIFQAIDSFALIIFIPICERFIYPFIRRFTPFKPITKIFFGFMF 435

Query: 451 GALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGLE 510
              +M W+CVLQ FIYKA P YDHP     GPN IHV  QVPAY L+A SEI ASITGLE
Sbjct: 436 ATGAMVWSCVLQSFIYKAGPYYDHPLN-GGGPNRIHVGWQVPAYVLIAFSEILASITGLE 494

Query: 511 YAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFW 570
           YAYSKAP SMK+FIMS+FL +NA G+ +G ALSPVS DPK+ WL+GGL VACF+GGC+FW
Sbjct: 495 YAYSKAPMSMKSFIMSLFLFSNAGGSILGIALSPVSVDPKFTWLFGGLGVACFIGGCIFW 554

Query: 571 IIFKKYNDMEEELNNLDFEEGDDMLETKHAG--DIEM--IQPISSRRSSLKSNE 620
           IIF+KYND EEE+N +D+E+ +D+ E + AG  D+E+   Q ++ RR+   S E
Sbjct: 555 IIFRKYNDTEEEMNAMDYEDEEDLREMESAGANDLELNSTQSLTQRRTGESSEE 608

>TPHA0O02000 Chr15 complement(404570..406432) [1863 bp, 620 aa] {ON}
           
          Length = 620

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/537 (68%), Positives = 436/537 (81%), Gaps = 15/537 (2%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLS 150
           LKHV G IP RCWL+AV+EL+ERFSYYGLSAPFQNYM NGPND+P G L L+++GATGLS
Sbjct: 84  LKHVAGHIPYRCWLIAVVELSERFSYYGLSAPFQNYMANGPNDTPKGILQLNTNGATGLS 143

Query: 151 YFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGF 210
           YFFQFWCY+TP+F GYMADTYW K+ TI +GT IYI+GIFILFIT++PSI +  TA GGF
Sbjct: 144 YFFQFWCYITPIFGGYMADTYWNKYNTIAVGTVIYIIGIFILFITAIPSIATKETATGGF 203

Query: 211 IVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFM 270
           +  +IL+GI TGMIKANLSV++AEQIPKRK RVIT K G RVIEDPDIT+QNVFM FY M
Sbjct: 204 VTAIILIGIGTGMIKANLSVLVAEQIPKRKHRVITTKKGERVIEDPDITMQNVFMFFYLM 263

Query: 271 INIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFK 330
           INIG+LSV+ATTELE+HKGFWAAYLLPFCFFW+AV++L++G  +YI  PVGDKVISKCFK
Sbjct: 264 INIGALSVLATTELESHKGFWAAYLLPFCFFWIAVVILVMGRNSYIIKPVGDKVISKCFK 323

Query: 331 VLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLN 390
           V  I+ +N+FN DSAKP+ NP+  YPWSDKFVDEI R+++ACKVF+FYPIYW  YGQM+N
Sbjct: 324 VTFIVCKNKFNFDSAKPSLNPEMQYPWSDKFVDEINRSIKACKVFIFYPIYWCVYGQMIN 383

Query: 391 NFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTF 450
           NF++Q GTMELH +PNDF Q  DSI +IVFIPI ERFVYP IR++TP KPITKIF GF  
Sbjct: 384 NFITQAGTMELHNIPNDFLQVFDSIGIIVFIPIFERFVYPTIRRFTPLKPITKIFLGFMC 443

Query: 451 GALSMTWACVLQHFIYKAAPCYDHPSKC----DNGPNHIHVALQVPAYCLLALSEIFASI 506
           G+ +M WA VLQ FIYKA PCYDHP  C     N PN +HVA Q+PAY ++A SEIFAS+
Sbjct: 444 GSCAMVWAAVLQSFIYKAGPCYDHPMACGPEYTNIPNRVHVAWQIPAYVIIAWSEIFASV 503

Query: 507 TGLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGG 566
           TGLE+AYS AP SMKAFIMSIFL TNA GAA+G A+SP S DPKY W++ GLAV+CFV G
Sbjct: 504 TGLEFAYSNAPDSMKAFIMSIFLFTNAIGAALGVAISPTSVDPKYTWVFTGLAVSCFVAG 563

Query: 567 CLFWIIFKKYNDMEEELNNLDFEEGDDMLETKHAGDIE--------MIQPISSRRSS 615
           CLFWI F  YND++ ++  +DF E DDM+    +GD+E         ++PI S RS+
Sbjct: 564 CLFWICFHHYNDIDADMKAIDFVE-DDMINA--SGDVEKTASSGFSTVEPIISMRSA 617

>YKR093W Chr11 (615730..617535) [1806 bp, 601 aa] {ON}  PTR2Integral
           membrane peptide transporter, mediates transport of di-
           and tri-peptides; conserved protein that contains 12
           transmembrane domains; PTR2 expression is regulated by
           the N-end rule pathway via repression by Cup9p
          Length = 601

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/531 (68%), Positives = 448/531 (84%), Gaps = 5/531 (0%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLS 150
           L+HVGGKIP+RCWL+A++EL+ERFSYYGLSAPFQNYM+ GPNDSP G LSL+S GATGLS
Sbjct: 71  LRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLSLNSQGATGLS 130

Query: 151 YFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGF 210
           YFFQFWCY+TPVF GY+ADT+WGK+ TIC GT IYI GIFILFITS+PS+ + ++A+GGF
Sbjct: 131 YFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGF 190

Query: 211 IVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFM 270
           I  +IL+GIATGMIKANLSV+IA+Q+PKRK  +   K+G RVI D +IT+QNVFM FYFM
Sbjct: 191 IAAIILIGIATGMIKANLSVLIADQLPKRKPSIKVLKSGERVIVDSNITLQNVFMFFYFM 250

Query: 271 INIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFK 330
           IN+GSLS++ATTELE HKGFWAAYLLPFCFFW+AV+ LI G K YI+ P+GDKVI+K FK
Sbjct: 251 INVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVIAKSFK 310

Query: 331 VLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLN 390
           V  IL +N+F+ ++AKP+ +P+KNYPW+DKFVDEI RAL ACKVF+FYPIYW  YG M++
Sbjct: 311 VCWILTKNKFDFNAAKPSVHPEKNYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMIS 370

Query: 391 NFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTF 450
           +F++Q   MELHG+PNDF QA DSIALI+FIPI E+FVYPFIR+YTP KPITKIF+GF F
Sbjct: 371 SFITQASMMELHGIPNDFLQAFDSIALIIFIPIFEKFVYPFIRRYTPLKPITKIFFGFMF 430

Query: 451 GALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGLE 510
           G+ +MTWA VLQ F+YKA P Y+ P    N PNH+HV  Q+PAY L++ SEIFASITGLE
Sbjct: 431 GSFAMTWAAVLQSFVYKAGPWYNEPLG-HNTPNHVHVCWQIPAYVLISFSEIFASITGLE 489

Query: 511 YAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFW 570
           YAYSKAPASMK+FIMSIFL+TNAFG+AIGCALSPV+ DPK+ WL+ GLAVACF+ GCLFW
Sbjct: 490 YAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFW 549

Query: 571 IIFKKYNDMEEELNNLDFEEGDDM----LETKHAGDIEMIQPISSRRSSLK 617
           + F+KYND EEE+N +D+EE D+     +    A DIE+++P+ S RS+ K
Sbjct: 550 LCFRKYNDTEEEMNAMDYEEEDEFDLNPISAPKANDIEILEPMESLRSTTK 600

>TPHA0N01960 Chr14 complement(418505..420280) [1776 bp, 591 aa] {ON}
           
          Length = 591

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/530 (68%), Positives = 437/530 (82%), Gaps = 10/530 (1%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLS 150
           L+HV G IPLRCWL+A++ELAERFSYYGLSAPFQNYM NGPND+P G L L+SSGAT +S
Sbjct: 65  LRHVSGYIPLRCWLIAIVELAERFSYYGLSAPFQNYMANGPNDTPKGLLQLNSSGATAIS 124

Query: 151 YFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGF 210
           YFFQFWCY+TP+F GYMADT+WGK+ TIC GTGIY+ GIFILF+TS+ SIT+ N A GG+
Sbjct: 125 YFFQFWCYVTPIFGGYMADTHWGKYNTICTGTGIYVSGIFILFMTSIESITTQNAARGGY 184

Query: 211 IVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFM 270
           I  +IL+GIATGMIK+N+SV+IAEQ+PKRK RVIT   G RVIEDP +T+QN+FM FY M
Sbjct: 185 IAAIILIGIATGMIKSNISVLIAEQVPKRKIRVITTSKGERVIEDPKLTVQNIFMFFYLM 244

Query: 271 INIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFK 330
           INIGSLSVIATTELEAHKGFWAAYLLPFCFFW+AV+VLIVG K Y++ PVGDKVISKCF 
Sbjct: 245 INIGSLSVIATTELEAHKGFWAAYLLPFCFFWIAVVVLIVGKKQYVRKPVGDKVISKCFT 304

Query: 331 VLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLN 390
           +  I  +N+ + DSAKP+ +P+ NYPW+DKFV+E+ RA++ACKVF+FYPIYW  YGQMLN
Sbjct: 305 ITWIAFKNKLDFDSAKPSCHPEANYPWTDKFVEEVRRAIRACKVFLFYPIYWCVYGQMLN 364

Query: 391 NFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTF 450
           NFV+Q GTMELHGLPNDF QAIDSIA+IVFIPICE+F+YPFIRK+TPF+ ITKIFWGF F
Sbjct: 365 NFVTQAGTMELHGLPNDFLQAIDSIAIIVFIPICEKFLYPFIRKFTPFRSITKIFWGFMF 424

Query: 451 GALSMTWACVLQHFIYKAAPCYDHPSKC----DNGPNHIHVALQVPAYCLLALSEIFASI 506
           G+ +M WA VLQ FIYKA PC+D P  C     + PN +H+A QVPAY L+A SEIFASI
Sbjct: 425 GSAAMIWAAVLQSFIYKAGPCFDKPLACAAQYAHTPNQVHIAWQVPAYVLIAFSEIFASI 484

Query: 507 TGLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGG 566
           TGLEYAYS AP SMK+FIMSIFL+T AFG+A+G A+SP S DPK+ W + GLAV+CF+ G
Sbjct: 485 TGLEYAYSNAPESMKSFIMSIFLLTTAFGSALGIAISPTSVDPKFTWAFTGLAVSCFIAG 544

Query: 567 CLFWIIFKKYNDMEEELNNLDF--EEGDDMLETKHAGDIEMIQPISSRRS 614
           CLFWI F+KYN+ E+ ++ +DF  E+  DM     +     I P+ S +S
Sbjct: 545 CLFWICFRKYNNTEDSMDEIDFIDEKVTDMANKASS----FISPVLSTKS 590

>SAKL0E14828g Chr5 (1226652..1228430) [1779 bp, 592 aa] {ON} similar
           to uniprot|P32901 Saccharomyces cerevisiae YKR093W PTR2
           Functions in transport of small peptides into the cell
           Peptide transporter
          Length = 592

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/531 (70%), Positives = 446/531 (83%), Gaps = 6/531 (1%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLS 150
           L+HV  +IP+RCWL+AV+ELAERFSYYGLSAPFQNYMQNGPND+P G L+L + GAT LS
Sbjct: 62  LRHVSEQIPVRCWLVAVVELAERFSYYGLSAPFQNYMQNGPNDTPKGILNLKNQGATALS 121

Query: 151 YFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGF 210
           YFFQFWCY++P+  G++ADTYWGK+ TIC+GTGIY+VGIFILFITS+PSIT ++ ++GGF
Sbjct: 122 YFFQFWCYVSPLLGGFVADTYWGKYKTICVGTGIYVVGIFILFITSVPSITYYSASLGGF 181

Query: 211 IVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFM 270
           I +LIL+G+ATGMIKAN+SV+IA+QIPK +  V   K+G RVIEDP+IT+QN+FM FY M
Sbjct: 182 ITSLILIGLATGMIKANISVLIADQIPKSRPTVKVLKSGERVIEDPNITVQNIFMFFYLM 241

Query: 271 INIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFK 330
           INIGSLSVIATTE+EAH GFWAAYLLPFCFF+VAV VLI+G   Y+K PVGDKVISK FK
Sbjct: 242 INIGSLSVIATTEMEAHIGFWAAYLLPFCFFFVAVFVLILGRNQYVKLPVGDKVISKSFK 301

Query: 331 VLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLN 390
           V  I+MRN+F  D+A+P+ NP+  YPWSDKF+DEI RA+ ACKVFVFYPIYWVCYGQML+
Sbjct: 302 VCWIVMRNKFRFDAARPSLNPELGYPWSDKFIDEIKRAIAACKVFVFYPIYWVCYGQMLS 361

Query: 391 NFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTF 450
           NFVSQ G MELHGLPNDF QAIDSIALIVFIPICERF+YPFIR++TPF+PITKIF+GF F
Sbjct: 362 NFVSQAGMMELHGLPNDFLQAIDSIALIVFIPICERFLYPFIRRFTPFRPITKIFYGFIF 421

Query: 451 GALSMTWACVLQHFIYKAAPCYDHPSKC----DNGPNHIHVALQVPAYCLLALSEIFASI 506
           GAL+M WA VLQHFIYKA PCY +P  C     N PN IH+A QVPAY L+A SEIFASI
Sbjct: 422 GALAMAWAAVLQHFIYKAGPCYYYPMACAPEYKNTPNRIHIAWQVPAYVLIAFSEIFASI 481

Query: 507 TGLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGG 566
           TGLEYAYSKAP SM++FIMSIFL+T AFG+A+G ALS VS +PK+VW + GLAV+CF+ G
Sbjct: 482 TGLEYAYSKAPVSMRSFIMSIFLLTTAFGSALGIALSSVSVNPKFVWTFSGLAVSCFIAG 541

Query: 567 CLFWIIFKKYNDMEEELNNLDFEEGDDMLETKHAGDIEMIQPISSRRSSLK 617
           CLFW  F KYND EE +N +D+EE DD+L    +   ++ +PI+S  S  +
Sbjct: 542 CLFWAFFHKYNDTEEAMNAIDYEE-DDVLNYGVSIHYDL-EPIASVNSDKR 590

>Smik_11.356 Chr11 (605836..607644) [1809 bp, 602 aa] {ON} YKR093W
           (REAL)
          Length = 602

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/531 (68%), Positives = 446/531 (83%), Gaps = 5/531 (0%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLS 150
           L+HVGGKIP+RCWL+A++EL+ERFSYYGLSAPFQNYM+ GPNDSP G L L+S GATGLS
Sbjct: 71  LRHVGGKIPMRCWLIAIVELSERFSYYGLSAPFQNYMEYGPNDSPKGVLGLNSQGATGLS 130

Query: 151 YFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGF 210
           YFFQFWCY+TPVF GY+ADT+WGK+ TIC GT IYI GIFILFITS+PS+ + ++A+GGF
Sbjct: 131 YFFQFWCYVTPVFGGYVADTFWGKYNTICCGTAIYIAGIFILFITSIPSVGNRDSAIGGF 190

Query: 211 IVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFM 270
           I  +IL+GIATGMIKAN+SV+IA+Q+PKRK  +   K+G RVI D +IT+QNVFM FYFM
Sbjct: 191 IAAIILIGIATGMIKANISVLIADQLPKRKPFIKVLKSGERVIVDSNITLQNVFMFFYFM 250

Query: 271 INIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFK 330
           IN+GSLS++ATTELE HKGFWAAYLLPFCFFW+AV+ LI G K YI+ P+GDKV++K F+
Sbjct: 251 INVGSLSLMATTELEYHKGFWAAYLLPFCFFWIAVVTLIFGKKQYIQRPIGDKVVAKSFR 310

Query: 331 VLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLN 390
           V  IL +N+F+ ++AKP+ +P++NYPW+DKFVDEI RAL ACKVFVFYPIYW  YG M++
Sbjct: 311 VCWILTKNKFDFNAAKPSVHPEENYPWNDKFVDEIKRALAACKVFVFYPIYWTQYGTMIS 370

Query: 391 NFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTF 450
           +F++Q   MELHG+PNDF QA DSIALIVFIPI E+FVYPFIR+YTP KPITKIF+GF F
Sbjct: 371 SFITQASMMELHGIPNDFLQAFDSIALIVFIPIFEKFVYPFIRRYTPLKPITKIFFGFMF 430

Query: 451 GALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGLE 510
           G+ +MTWA VLQ F+YKA P Y+ P    N PNHIHV  Q+PAY L++ SEIFASITGLE
Sbjct: 431 GSFAMTWAAVLQSFVYKAGPWYNEPLG-HNTPNHIHVCWQIPAYVLISFSEIFASITGLE 489

Query: 511 YAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFW 570
           YAYSKAPASMK+FIMSIFL+TNAFG+AIGCALSPV+ DPK+ WL+ GLAVACF+ GCLFW
Sbjct: 490 YAYSKAPASMKSFIMSIFLLTNAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFW 549

Query: 571 IIFKKYNDMEEELNNLDFEEGDDM----LETKHAGDIEMIQPISSRRSSLK 617
           + F+KYND EEE+N +D+EE D+     +    A DIE+++P  S RS+ K
Sbjct: 550 LCFRKYNDTEEEMNAMDYEEDDEFDLNSISAPKANDIEILEPTESLRSTAK 600

>NDAI0E05020 Chr5 (1146336..1148195) [1860 bp, 619 aa] {ON}
           Anc_5.698
          Length = 619

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/538 (66%), Positives = 437/538 (81%), Gaps = 8/538 (1%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLS 150
           LK VGGKIPLRCWL+ V+ELAERFSYYGLSAPFQNYMQNGPNDSP G L L+SSGATGLS
Sbjct: 83  LKRVGGKIPLRCWLIGVVELAERFSYYGLSAPFQNYMQNGPNDSPKGVLMLNSSGATGLS 142

Query: 151 YFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGF 210
           YFFQFWCY+TPVF G++ADTYWGK+ +I +GTG YIVGIFILFIT++PSI S N ++GGF
Sbjct: 143 YFFQFWCYVTPVFGGFVADTYWGKYNSISVGTGFYIVGIFILFITAIPSIASQNASLGGF 202

Query: 211 IVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFM 270
           IV++IL+GI TG IKANLSV+IA+Q+PKRK RV   K+G RVIEDP+IT+QNVFM FY M
Sbjct: 203 IVSIILIGIGTGFIKANLSVLIADQLPKRKPRVKILKSGERVIEDPNITLQNVFMVFYLM 262

Query: 271 INIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFK 330
           INIGS+SV+ATTELE+HKGFWAAYLLPFCFFW+AV++L+ G K Y+K  +GD V+ K FK
Sbjct: 263 INIGSMSVMATTELESHKGFWAAYLLPFCFFWIAVVILVFGRKYYVKEKMGDNVVQKSFK 322

Query: 331 VLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLN 390
           V  I+ +N+ + ++AKP+++P++NYPW+D+FVDE+ R + ACKVFVFYPIYWV YG M++
Sbjct: 323 VCWIVAKNKLDYNAAKPSYHPERNYPWNDRFVDEMKRTIAACKVFVFYPIYWVQYGSMIS 382

Query: 391 NFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTF 450
            FV+QG TMELHG+PNDF Q  DSIALI+FIPI E FVYPFIR++TP +PITKI  GF  
Sbjct: 383 TFVTQGSTMELHGIPNDFLQVFDSIALIIFIPIFENFVYPFIRRFTPIRPITKITIGFFV 442

Query: 451 GALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGLE 510
           G  +MTWA VLQHFIY   PCYDHP  CD  PN IHVA Q+PAY L+A SEIFASITGLE
Sbjct: 443 GGCAMTWAAVLQHFIYNTGPCYDHPLSCDT-PNKIHVAWQIPAYVLIAFSEIFASITGLE 501

Query: 511 YAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFW 570
           YAYSKAP SMK+F+MSIFL+TNAFG+ +G ALS V+ DPK+VWL+GGLAV+C V G LFW
Sbjct: 502 YAYSKAPPSMKSFVMSIFLLTNAFGSILGIALSSVTVDPKFVWLFGGLAVSCGVTGILFW 561

Query: 571 IIFKKYNDMEEELNNLDFEEGDDMLETKH----AGDIEMIQPISS---RRSSLKSNEL 621
           + F+  N  EEE+N +D++   D    +H    A D+E++    +   R SSL  +++
Sbjct: 562 LCFRGLNATEEEMNAMDYDAEIDEQSKRHLSSGADDLEILPGPDNNNWRTSSLSHSDM 619

>KAFR0H00230 Chr8 complement(33231..35021) [1791 bp, 596 aa] {ON} 
          Length = 596

 Score =  758 bits (1956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/567 (63%), Positives = 431/567 (76%), Gaps = 4/567 (0%)

Query: 48  IPTQDEKRDQKFETFQEDSSIINDENXXXXXXXXXXXXXXXXXLKHVGGKIPLRCWLMAV 107
           + ++D+  D +    Q D+    +                   L+HV G+IP RC+L+AV
Sbjct: 30  VSSEDQILDTESYKLQNDNEFDPEHPDYQEEGYEMPTEEELRTLRHVSGRIPFRCFLIAV 89

Query: 108 IELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPVFAGYM 167
           +EL+ERFSYYGLSAPFQNYM N P+DSPPG L L+S GATGLSYFFQFWCY+TPV  GY+
Sbjct: 90  VELSERFSYYGLSAPFQNYMANTPSDSPPGVLQLNSDGATGLSYFFQFWCYITPVLGGYL 149

Query: 168 ADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGFIVTLILVGIATGMIKAN 227
           ADT WG++ TI +GTGIYIVGIF+LFITS  SI   N A+GGFIV LIL+GI TG IKAN
Sbjct: 150 ADTNWGRYNTIAVGTGIYIVGIFVLFITSFKSIAGKNGALGGFIVALILIGIGTGFIKAN 209

Query: 228 LSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFMINIGSLSVIATTELEAH 287
           LSV+IA+QIP ++ RV T K+G RVIED DITIQNVFM FY MINIGSLSVIATTELE H
Sbjct: 210 LSVLIADQIPAKRPRVKTLKSGERVIEDHDITIQNVFMFFYLMINIGSLSVIATTELEQH 269

Query: 288 KGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFKVLRILMRNRFNPDSAKP 347
            GFWAAYLLPFCFFW+AVIVL++G ++Y   P  D+VI K FK    L +N+FN  +  P
Sbjct: 270 VGFWAAYLLPFCFFWIAVIVLVLGRRSYTLKPTSDRVIEKSFKFCWALTKNKFNWSAVTP 329

Query: 348 AFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELHGLPND 407
           A NP+  + W DKFV+EI  AL ACKVF+FYPIYW CYGQM NNFV+ G  ++LHGLPND
Sbjct: 330 AENPEVTFSWDDKFVEEIRVALAACKVFLFYPIYWTCYGQMTNNFVTMGSMLQLHGLPND 389

Query: 408 FFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTFGALSMTWACVLQHFIYK 467
            FQAIDSIALIVFIPICE+F YPFIR++TPF+PITKI +GF   + SM WACVLQ+FIYK
Sbjct: 390 IFQAIDSIALIVFIPICEKFFYPFIRRFTPFRPITKITYGFWLASASMVWACVLQYFIYK 449

Query: 468 AAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGLEYAYSKAPASMKAFIMSI 527
             P Y HP    +GPN++HVA QVPAY L+A SEIFASITGLEYAYSKAPASMK+FIM++
Sbjct: 450 TGPNYKHP--LADGPNNVHVAWQVPAYVLIAFSEIFASITGLEYAYSKAPASMKSFIMAL 507

Query: 528 FLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFWIIFKKYNDMEEELNNLD 587
           FL  NAFG+AIGCALSPVSKDP Y WLY GLAV  F+ GC FW  F+ YND+E+E+N L+
Sbjct: 508 FLFMNAFGSAIGCALSPVSKDPDYTWLYCGLAVTAFITGCAFWFCFRHYNDIEDEMNALN 567

Query: 588 FEEGDDMLETKHAGDIEMIQPISSRRS 614
           +E+ D + E     DIEM+ P+S+  S
Sbjct: 568 YEDEDIITENNQ--DIEMVHPLSAYTS 592

>KAFR0H00240 Chr8 complement(36393..38168) [1776 bp, 591 aa] {ON}
           Anc_5.698 YKR093W
          Length = 591

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/554 (63%), Positives = 434/554 (78%), Gaps = 4/554 (0%)

Query: 50  TQDEKRDQKFETFQEDSSIINDENXXXXXXXXXXXXXXXXXLKHVGGKIPLRCWLMAVIE 109
           +  E +D +  T Q D SI  D                   L+ VGG+IP RC+L+A++E
Sbjct: 33  SDGEHKDTEAYTLQ-DGSIEPDHEDYQEEGYEIPTQDEMKTLRRVGGRIPFRCFLVALVE 91

Query: 110 LAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPVFAGYMAD 169
           LAERFSYYGLSAPFQNYMQNGP DSPPG L L+SSGATGLSYFFQFWCY+TP+F GY+AD
Sbjct: 92  LAERFSYYGLSAPFQNYMQNGPTDSPPGVLQLNSSGATGLSYFFQFWCYITPIFGGYLAD 151

Query: 170 TYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGFIVTLILVGIATGMIKANLS 229
           T WG++ TI +GT IYI+GIFILFITS  ++   + A+ GFI+ LIL+G ATG+IK+NLS
Sbjct: 152 TKWGRYNTIGVGTVIYIIGIFILFITSFKTVAGRDGALAGFILALILIGFATGLIKSNLS 211

Query: 230 VMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFMINIGSLSVIATTELEAHKG 289
           V+IA+QIP ++ RV T K+G RVIED D+TIQNVFM FY MINIGSLSVIATTELE + G
Sbjct: 212 VLIADQIPAKRPRVKTLKSGERVIEDHDVTIQNVFMFFYLMINIGSLSVIATTELELNVG 271

Query: 290 FWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFKVLRILMRNRFNPDSAKPAF 349
           FWAAYLLPFCFFW+AVIV++ G + YI  P GD+VI+K FKV  IL +N+F+  SAKP++
Sbjct: 272 FWAAYLLPFCFFWIAVIVIVAGKRQYIIKPTGDRVIAKSFKVCWILCKNKFDITSAKPSY 331

Query: 350 NPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELHGLPNDFF 409
           +P+  +PW DKFVDEI RAL ACKVF+FYPIYW CYGQM+NNF++ G  M+LHGLPND F
Sbjct: 332 HPESEFPWEDKFVDEIQRALAACKVFLFYPIYWTCYGQMVNNFITMGSMMQLHGLPNDIF 391

Query: 410 QAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTFGALSMTWACVLQHFIYKAA 469
           QAI+SI+LI+FIPICE+F+YPFIR++TP +P+T+IF GF F A++M W+CVLQHFIY   
Sbjct: 392 QAINSISLIIFIPICEKFLYPFIRRFTPLRPVTRIFCGFIFAAMAMVWSCVLQHFIYSTG 451

Query: 470 PCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGLEYAYSKAPASMKAFIMSIFL 529
           P Y+ P +   G N IHV  QVPAY  +A SEIFASITGLEYAYSKAPA+MK+FIM++FL
Sbjct: 452 PNYNRPLEL--GANDIHVGWQVPAYVFIAFSEIFASITGLEYAYSKAPANMKSFIMALFL 509

Query: 530 VTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFWIIFKKYNDMEEELNNLDFE 589
             NAFG+AIGCALSPVSKDP Y WLYG LAVACF+ G +FW+ F+KYN +E+E+N LDF 
Sbjct: 510 FMNAFGSAIGCALSPVSKDPDYTWLYGSLAVACFLSGLIFWLCFRKYNKIEDEMNALDFT 569

Query: 590 EG-DDMLETKHAGD 602
           +  +D +  + A D
Sbjct: 570 DSEEDEILIRRAED 583

>KLLA0E12915g Chr5 complement(1142167..1144131) [1965 bp, 654 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 654

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/533 (65%), Positives = 426/533 (79%), Gaps = 7/533 (1%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLS 150
           L+HV  +IP  CWL+A++ELAERFSYYGLSAPFQNYMQNGPND+P G L L S GAT LS
Sbjct: 105 LRHVSERIPFTCWLIAIVELAERFSYYGLSAPFQNYMQNGPNDTPKGVLQLKSQGATALS 164

Query: 151 YFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGF 210
           YFFQFWCY+TP+  GY+ADT+WGK+ TIC+G   Y+VGI ILF+T++PSI   N+++GGF
Sbjct: 165 YFFQFWCYVTPLLGGYLADTFWGKYNTICVGASFYVVGILILFMTAIPSINDKNSSLGGF 224

Query: 211 IVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFM 270
           IV+LI++GI TG IKANLSV+IA+QIPK + R+   KNG +VIEDP++T+QNVFM FY M
Sbjct: 225 IVSLIIIGIGTGFIKANLSVLIADQIPKTRPRIKVLKNGEKVIEDPNVTMQNVFMFFYLM 284

Query: 271 INIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFK 330
           INIGSLSV+ATT LEA  GFWAAYLL FCFFWV ++VL+ G K Y++ P+GD VI++CFK
Sbjct: 285 INIGSLSVMATTHLEASYGFWAAYLLTFCFFWVGIVVLVFGRKKYVRRPIGDHVIARCFK 344

Query: 331 VLRILMRNRFNPDSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLN 390
           +  I + N FN + A P+ NP+K YPW+D F+DEI RA +ACKVF FYPIYWV YGQMLN
Sbjct: 345 ICWIGLCNGFNLNRAVPSLNPEKEYPWNDLFIDEIRRAFKACKVFAFYPIYWVVYGQMLN 404

Query: 391 NFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTF 450
           NFV+Q GTMELHGLPNDF QAI+SIALIVFIPI E+F+YPFIR++TPF+P+TKIF GF F
Sbjct: 405 NFVTQAGTMELHGLPNDFLQAINSIALIVFIPIMEQFIYPFIRRFTPFRPVTKIFIGFCF 464

Query: 451 GALSMTWACVLQHFIYKAAPCYDHPSKC----DNGPNHIHVALQVPAYCLLALSEIFASI 506
           G+ +M +A VLQHFIYKA PCYD P  C     N PN +H+  QVPAY L++LSEIFASI
Sbjct: 465 GSSAMVYAAVLQHFIYKAGPCYDFPMSCAPEYANTPNRVHIGWQVPAYVLISLSEIFASI 524

Query: 507 TGLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGG 566
           TGLEYAYSKAPA+MKAFIMSIFLVTNA G+A+G ALSP +++PKYVW + GLAVACF+ G
Sbjct: 525 TGLEYAYSKAPATMKAFIMSIFLVTNAVGSALGIALSPTAENPKYVWTFSGLAVACFIAG 584

Query: 567 CLFWIIFKKYNDMEEELNNLDF--EEGDDMLE-TKHAGDIEMIQPISSRRSSL 616
           CLFW+ F  YN  EE LN LD+  EE + ML      G+   +  +SS RS +
Sbjct: 585 CLFWLCFHHYNKDEEALNALDYKTEEQEQMLSGVGVTGEGAALYSVSSVRSRV 637

>Skud_11.331 Chr11 (597847..599046) [1200 bp, 399 aa] {ON} YKR093W
           (REAL)
          Length = 399

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/399 (66%), Positives = 329/399 (82%), Gaps = 5/399 (1%)

Query: 223 MIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFYFMINIGSLSVIATT 282
           MIKANLSV+IA+Q+PKRK  +   K+G RV+ DP+IT+QNVFM FYFMIN+GSLS++ATT
Sbjct: 1   MIKANLSVLIADQLPKRKPSIKVLKSGERVVLDPNITLQNVFMFFYFMINVGSLSLMATT 60

Query: 283 ELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKTPVGDKVISKCFKVLRILMRNRFNP 342
           ELE HKGFWAAYLLPFCFFW+AV+ LI+G K YI+ P+GDKVI+K F+V  IL +N+F+ 
Sbjct: 61  ELEYHKGFWAAYLLPFCFFWIAVVTLILGKKQYIQRPIGDKVIAKSFRVCWILAKNKFDF 120

Query: 343 DSAKPAFNPDKNYPWSDKFVDEIMRALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELH 402
           ++AKP+ +P+++YPW+DKFVDEI RAL ACKVF+FYPIYW  YG M+++F++Q   MELH
Sbjct: 121 NAAKPSIHPERDYPWNDKFVDEIKRALAACKVFIFYPIYWTQYGTMISSFITQASMMELH 180

Query: 403 GLPNDFFQAIDSIALIVFIPICERFVYPFIRKYTPFKPITKIFWGFTFGALSMTWACVLQ 462
           G+PNDF QA DSIALI+FIPI E+F+YPFIR+YTPFKPITKIF+GF FG+ +MTWA VLQ
Sbjct: 181 GIPNDFLQAFDSIALIIFIPIFEKFIYPFIRRYTPFKPITKIFFGFMFGSFAMTWAAVLQ 240

Query: 463 HFIYKAAPCYDHPSKCDNGPNHIHVALQVPAYCLLALSEIFASITGLEYAYSKAPASMKA 522
            FIYKA P YD P    N PN +HV  Q+PAY L++ SEIFASITGLEYAYSKAPASMK+
Sbjct: 241 SFIYKAGPWYDEPLG-HNTPNRVHVCWQIPAYVLISFSEIFASITGLEYAYSKAPASMKS 299

Query: 523 FIMSIFLVTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFWIIFKKYNDMEEE 582
           FIMSIFL+T AFG+AIGCALSPV+ DPK+ WL+ GLAVACF+ GCLFW  F+KYND EEE
Sbjct: 300 FIMSIFLLTTAFGSAIGCALSPVTVDPKFTWLFTGLAVACFISGCLFWFCFRKYNDTEEE 359

Query: 583 LNNLDFEEGDDM----LETKHAGDIEMIQPISSRRSSLK 617
           +N +D+EE D+     +    A DIE+++P+ S RS+ K
Sbjct: 360 MNAMDYEEEDEFDLNPISAPKANDIEILEPMESLRSTAK 398

>Kwal_47.16930 s47 (176926..178761) [1836 bp, 611 aa] {ON} YKR093W
           (PTR2) - Peptide transporter [contig 219] FULL
          Length = 611

 Score =  263 bits (673), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 168/527 (31%), Positives = 266/527 (50%), Gaps = 36/527 (6%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQN-------------GPNDSPPG 137
           L+ V G      + + +IE +ER SYYG      N++Q                +++  G
Sbjct: 40  LRRVLGHPKWYVYFICLIEFSERASYYGTGDRLNNFIQKPLPAGGNGAGAPAPGSEATAG 99

Query: 138 ALSLDSSGATGLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSL 197
           AL +    AT L+    F  Y  P+  GY+AD YWG+   + IG  + IV   +  I SL
Sbjct: 100 ALGMGLQVATALNLLLTFLAYCFPLITGYVADRYWGRMRMLWIGVFVGIVSHVVFIIGSL 159

Query: 198 PSITSHNTA-MGGFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDP 256
           P +  H +A +   I+ +I + IAT  +K  L   +  Q P     V T  +G RVI D 
Sbjct: 160 PVVLGHGSAALAPCIIGIITLAIATAFVKPILLPTLLSQYPHATDVVKTLPSGERVIIDR 219

Query: 257 DITIQNVFMTFYFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYI 316
           D ++Q + MTFY+ IN+GS   +AT+      G+W A+L+P   F +   VL+V  + YI
Sbjct: 220 DASLQRMTMTFYWSINVGSFLSVATSYSARDVGYWLAFLIPLALFMIMPAVLLVLRR-YI 278

Query: 317 KT--PVGDKVISKCFKVLRILM-RN---RFNP----DSAKPA---------FNPDKNYPW 357
           K   P G  +I+ C KVL++   RN   R+      D AKP+         +   K   +
Sbjct: 279 KDEPPSGRSLIADCLKVLKVCFERNWWSRYRAGTFWDYAKPSNLRSLGRQGWRKSKPGFY 338

Query: 358 SDKFVDEIMRALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELHGLPNDFFQAIDSIAL 417
            +  V +    + AC +F++Y IY +  G + +   SQ  ++   G+PND     + + +
Sbjct: 339 PESLVQDARVTISACTIFLYYVIYNINDGGIGSIMNSQTASLTSKGVPNDLMSNFNPLCI 398

Query: 418 IVFIPICERFVYPFIRKYT-PFKPITKIFWGFTFGALSMTWACVLQHFIYKAAPCYDHPS 476
           IVF+PI +R VYP +RK    F+P+ +IF GF   AL+     ++QH IY+ +PC ++ +
Sbjct: 399 IVFMPILDRVVYPLLRKLRWNFRPVFRIFAGFMVAALASAVGAIIQHAIYQTSPCGNYAT 458

Query: 477 KCDNGPNHIHVALQVPAYCLLALSEIFASITGLEYAYSKAPASMKAFIMSIFLVTNAFGA 536
           +C+ G + I + +    Y L   SE  A  TG E A+ ++P  MK F+M++FL  +A  A
Sbjct: 459 ECEKGVSPISMWVVAIEYALTGFSECLAMTTGYEIAFERSPPHMKTFVMALFLFMSALSA 518

Query: 537 AIGCALSPVSKDPKYVWLYGGLA-VACFVGGCLFWIIFKKYNDMEEE 582
           A+G  ++P   DP  V  +G LA +   V     W  +  ++ ME+E
Sbjct: 519 ALGEIVTPSLVDPHLVIPFGVLAGLGAAVAFAFLWRYWNLHHVMEQE 565

>KLTH0D16544g Chr4 complement(1366262..1368142) [1881 bp, 626 aa]
           {ON} similar to uniprot|P32901 Saccharomyces cerevisiae
           YKR093W PTR2 Functions in transport of small peptides
           into the cell Peptide transporter
          Length = 626

 Score =  246 bits (628), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 167/569 (29%), Positives = 270/569 (47%), Gaps = 56/569 (9%)

Query: 103 WLMAVIELAERFSYYGLSAPFQNYMQN----------------GPNDSPPGALSLDSSGA 146
           + + +IE +ER SYYG      N++Q                   + +  GAL +    A
Sbjct: 57  YFICLIEFSERASYYGTGDRLNNFIQQPLPAGGNGAGAPAHGAAGDSATAGALGMGLQTA 116

Query: 147 TGLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSH-NT 205
           T L+    F  Y  P+  GY+AD YW +   + IG  + I+   I  I +LP +  +   
Sbjct: 117 TALNLLLTFLAYCFPLVTGYIADRYWSRMRMLWIGVFVGIISHVIFIIGALPPVLGNGQA 176

Query: 206 AMGGFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFM 265
           A+   ++ +I + IAT  +K  L   +  Q P     V T  +G RV+ D D ++Q + M
Sbjct: 177 ALAPCVIGIITLAIATSFVKPVLLPTLLSQYPHETDVVRTLASGERVLVDRDASLQRMTM 236

Query: 266 TFYFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVA-VIVLIVGNKTYIKTPVGDKV 324
           TFY+ INIGS   +AT+      G+W A+L+P   + +   ++L++G     + P G  +
Sbjct: 237 TFYWSINIGSFLSVATSYAARDIGYWLAFLIPLILYLIMPAVLLVLGRYLRDEPPSGRSM 296

Query: 325 ISKCFKVLRILMR----NRFNP----DSAKPA-FNPDKNYPWSDK---------FVDEIM 366
           ++ C KVLR+        R+      + A+P+         W  K          V +  
Sbjct: 297 LADCCKVLRVCFERGWWRRYRSGDFWNYARPSRLRQAGRAGWRRKGAGGFYAESLVQDTR 356

Query: 367 RALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICER 426
             L A  +F++Y IY +  G + +   SQ  ++  +G+PND     + + +IVF+P+ + 
Sbjct: 357 VTLSASAIFLYYVIYNINDGGIGSIMNSQTASLTSNGVPNDLISNFNPLCIIVFMPVLDH 416

Query: 427 FVYPFIRKYT-PFKPITKIFWGFTFGALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHI 485
            +YP +RK    FKP+ +IF GF   AL+     ++Q  IY  +PC  + ++CD G + +
Sbjct: 417 VLYPVLRKMRWNFKPVYRIFCGFMIAALASAVGAIIQTVIYNTSPCGRYATECDKGVSPV 476

Query: 486 HVALQVPAYCLLALSEIFASITGLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPV 545
            + +    Y L  LSE  A  TG E A+ ++PA MK+F+M++FL T+A  AA+G  ++P 
Sbjct: 477 SMWVVAVEYALTGLSECLAMTTGYEIAFERSPAHMKSFVMALFLFTSALSAALGEIVTPS 536

Query: 546 SKDPKYVWLYGGLA-VACFVGGCLFWIIFKKYNDME---EELNNLDFEEGDDMLETKHAG 601
             DP  V  +G LA +  F+     W  +     ME    E   L+ EEG          
Sbjct: 537 LVDPHLVIPFGVLAGLGAFMAFVFLWRYWSLDKTMELERAERRALEAEEG---------- 586

Query: 602 DIEMIQPISSRRSSLKSNELVD--EGSIH 628
               +  I+S RS +   E VD  EG  H
Sbjct: 587 ---AMPAITSVRSYVSGAEDVDHPEGLEH 612

>AGL365C Chr7 complement(13929..15728) [1800 bp, 599 aa] {ON}
           NOHBY725; No homolog in Saccharomyces cerevisiae
          Length = 599

 Score =  241 bits (615), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 156/516 (30%), Positives = 249/516 (48%), Gaps = 37/516 (7%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQ-----------NGPNDSPPGAL 139
           L+HV        +++ +IELAER SYYG      N+ Q            GP+D  PGAL
Sbjct: 46  LRHVVAAPKWTVYMICLIELAERASYYGTGDRLYNFFQYPLPQGGNGAGAGPDDQNPGAL 105

Query: 140 SLDSSGATGLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPS 199
                 AT L+   +F  Y  P+  GY+AD Y G+   + +G    +V   I  I +LP+
Sbjct: 106 GRGLQVATSLNLVLKFTSYFFPLVTGYVADMYVGELKMLWLGIWTGVVSHVIFVIAALPA 165

Query: 200 ITSHNT-AMGGFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDI 258
           +  HN   M   ++ L+ + + T  +K  L  M+  Q P     V T   G RVI + D 
Sbjct: 166 VIKHNNLCMALAVLGLLTLSLCTAFVKPVLLPMLLRQYPHETNVVKTLPTGERVILNRDA 225

Query: 259 TIQNVFMTFYFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIKT 318
           ++Q + MTFY+ IN+GS   +AT       G+W ++L+P   F +   +L+      +  
Sbjct: 226 SLQRMSMTFYWCINVGSFVSLATGYSAQRVGYWLSFLIPLVLFLIMPAILLTLKNVKVTP 285

Query: 319 PVGDKVISKCFKVLRILMR----NRFNPDS----AKPA---------FNPDKNYPWSDKF 361
           P+G+ + ++C KV+++        R+   S    AKP+         +   K   + +  
Sbjct: 286 PLGESLFAECLKVIKVCFEPGWFKRYRSGSFWRYAKPSNLRALGRTGWRRSKEGFYKESL 345

Query: 362 VDEIMRALQACKVFVFYPIYWVCYGQMLNNFVSQGGTMELHGLPNDFFQAIDSIALIVFI 421
           V++    L AC +F++Y IY +   Q+ +   +Q G+M   G+PND     + +A+I+ +
Sbjct: 346 VEDTRITLAACVIFLYYVIYNMNDNQLSSIINNQAGSMTGEGVPNDVISNFNPLAIIITM 405

Query: 422 PICERFVYPFIRKYT-PFKPITKIFWGFTFGALSMTWACVLQHFIYKAAPCYDHPSKCDN 480
           PI +  + P +R+    FKP+ +IF+GF    L+     ++Q  IY  +PC  H S C  
Sbjct: 406 PIIDYGLNPLLRRLRINFKPVYRIFFGFMLAVLASVAGAIIQAAIYNTSPCGKHASTCSE 465

Query: 481 GPNHIHVA---LQVPAYCLLALSEIFASITGLEYAYSKAPASMKAFIMSIFLVTNAFGAA 537
               +      L    Y L  +SE FA  TG E A+ ++P  MKAF+MS+FLVT A  + 
Sbjct: 466 TIRQVSPLSRWLVGVEYVLSGVSECFAMPTGYEIAFERSPKDMKAFVMSLFLVTTALSSI 525

Query: 538 IGCALSPVSKDPKYVWLYGGLAVACFVGGCLFWIIF 573
           +    + +  DP  V  +   AV     G LF I+F
Sbjct: 526 LTQIFNGIMTDPYLVIPFILFAVL----GTLFAILF 557

>Ecym_2823 Chr2 (1599716..1601557) [1842 bp, 613 aa] {ON} similar to
           Ashbya gossypii AGL365C
          Length = 613

 Score =  229 bits (584), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 157/540 (29%), Positives = 259/540 (47%), Gaps = 39/540 (7%)

Query: 103 WLMAVIELAERFSYYGLSAPFQNY----MQNGPN---------DSPPGALSLDSSGATGL 149
           +L+  IELAER SYYG      NY    +  G N         ++  GAL    + AT L
Sbjct: 64  YLICFIELAERASYYGTGDRLNNYYTYPLPEGGNGAGATAHGSEANSGALGKGLATATSL 123

Query: 150 SYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSH-NTAMG 208
               +F  Y  P+  GY+ D Y G   T+  G    +    I  +++LP +  H + AM 
Sbjct: 124 GLLLKFTSYFFPLVTGYLCDMYMGHVRTLWYGIWTGVASHIIFILSALPVVLKHPDAAMA 183

Query: 209 GFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPDITIQNVFMTFY 268
             ++ LI + + T  +K  L  ++ +Q P     V T + G RVI D D ++Q + MTFY
Sbjct: 184 LSLIGLITLSVCTAFVKPVLLPLLLQQYPHETNVVKTLETGERVIIDRDASLQRMTMTFY 243

Query: 269 FMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVL-IVGNKTYIKTPVGDKVISK 327
           + INIG+   +AT+      GFW A+L+P   +    +V  +V      + P G  +++ 
Sbjct: 244 WAINIGAFMSLATSYAAKEVGFWLAFLIPLIIYMAMPVVFSLVQPHIKDRAPSGYSLLAD 303

Query: 328 CFKVLRILMRNRFNP--------DSAKPAFNPD-------KNYP-WSDKFVDEIMRALQA 371
           C KVL +     +N         D A P+           K  P + +  V +    L A
Sbjct: 304 CMKVLYVAFGKGWNARRKEGVFWDYALPSNQRQMGKVGWRKKSPFYKESLVQDTKITLSA 363

Query: 372 CKVFVFYPIYWVCYGQMLNNFVSQGGTMELHGLPNDFFQAIDSIALIVFIPICERFVYPF 431
           C +F +Y IY +   Q+     SQ G+M  +G+PND     + +++IV IPI +  +YP 
Sbjct: 364 CFIFCYYIIYNMNDNQLTTIINSQTGSMTKNGVPNDVISNFNPLSIIVLIPILDYGLYPL 423

Query: 432 IRKYT-PFKPITKIFWGFTFGALSMTWACVLQHFIYKAAPCYDHPSKCDN---GPNHIHV 487
           +R+    FKP+ +IF GF     S     ++Q  IY+ + C  H + C     G + +  
Sbjct: 424 LRRLRINFKPVYRIFTGFMLAVASSVAGALIQWRIYETSSCGYHATTCSEKGLGVSPLSS 483

Query: 488 ALQVPAYCLLALSEIFASITGLEYAYSKAPASMKAFIMSIFLVTNAFGAAIGCALSPVSK 547
            +    Y L   SE  A  T  E AY ++P  MK+F++++FL T+A  AAI   ++P+ K
Sbjct: 484 WIVAVEYTLSGASECLAMTTAYEIAYDRSPEHMKSFVLALFLFTSAVSAAITQIVNPILK 543

Query: 548 DPKYVWLYGGLAVACFVGGCLFWIIFKKYNDMEEELNNLDFEEGDDMLETKHAGDIEMIQ 607
           DP  +  +   A   F+ GC F     K+ ++++E+   +  E + + E+  + ++E+++
Sbjct: 544 DPLLIVPFALFAGIGFISGCHF---LWKFRNLDKEMLQ-EKRERELLQESSESDELEVVE 599

>AFR228W Chr6 (850893..852623) [1731 bp, 576 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YKR093W (PTR2)
          Length = 576

 Score =  206 bits (525), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 157/535 (29%), Positives = 258/535 (48%), Gaps = 50/535 (9%)

Query: 91  LKHVGGKIPLRCWLMAVIELAERFSYYGLSAPFQNYMQ------------NGPNDSPPGA 138
           L+ +     +  + + +IE AER S+YG      N+ Q             GP +  PGA
Sbjct: 39  LRRIVTSPKIHLYFICLIEFAERGSFYGTGNRMGNFYQYPLPIGGNGAGAPGPGEQDPGA 98

Query: 139 LSLDSSGATGLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLP 198
           L    + AT +    +F  Y   +  GY++D Y G+   + IG  + +    +  I +LP
Sbjct: 99  LGKGLAVATAMGLLLKFTSYTFSIITGYISDVYIGQIKMLWIGVWLGVGSHILFIIAALP 158

Query: 199 SITSH-NTAMGGFIVTLILVGIATGMIKANLSVMIAEQIPKRKRRVITKKNGTRVIEDPD 257
           S+ +H N A    +V L+ + + T  +K  L  ++ +Q P +   V T  +G RVI D D
Sbjct: 159 SVLAHTNVAYALSVVALLSLSLCTSFVKPVLLPLLLQQYPYKTNIVKTLLSGERVIVDRD 218

Query: 258 ITIQNVFMTFYFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVAVIVLIVGNKTYIK 317
            ++Q + M FY+ IN+G+   +AT       G+W A+ +P   + +  IVL    +  IK
Sbjct: 219 ASLQRMTMVFYWAINVGAFLSLATAYSAQRVGYWLAFTVPLIIYLLMPIVLWKLQED-IK 277

Query: 318 T--PVGDKVISKCFKVLRILMR----NRFNP----DSAKP---------AFNPDKNYPWS 358
           T  P  + V+++  KVL++        R+      D AKP          +   K   + 
Sbjct: 278 TNEPSRESVLAESLKVLKVCYEWGWIKRYWSGQFWDYAKPTNLIQQGRIGWRKKKAGFYD 337

Query: 359 DKFVDEIMRALQACKVFVFYPIYWVCYGQMLNNF----VSQGGTMELHGLPNDFFQAIDS 414
           +K+V +    + AC +F++Y IY     QM +N      SQ G+ME  G+PND F   + 
Sbjct: 338 EKYVYDTKLTISACTIFLYYVIY-----QMHSNLDEPMRSQAGSMEGEGVPNDLFSNFNP 392

Query: 415 IALIVFIPICERFVYPFIRKYT-PFKPITKIFWGFTFGALSMTWACVLQHFIYKAAPC-Y 472
           I++IV +PI +  +YP +R+Y   FKP+ +IF GF  G L  T   ++Q  +Y  +PC Y
Sbjct: 393 ISIIVVMPILDYVLYPLLRRYRINFKPVYRIFCGFMIGCLGSTVGAIIQWRVYNTSPCGY 452

Query: 473 DHPSKC---DNGPNHIHVALQVPAYCLLALSEIFASITGLEYAYSKAPASMKAFIMSIFL 529
              + C    +  + +   L    Y L   SE  A  TG E A+ ++P  MK F++++F+
Sbjct: 453 MGATTCPELHHKKSPLSRWLVAIEYALGGTSECLAMTTGYEIAFERSPKKMKGFVLALFM 512

Query: 530 VTNAFGAAIGCALSPVSKDPKYVWLYGGLAVACFVGGCLFWIIFKKYNDMEEELN 584
            T A  +AI   ++P  KDP   +L    AV   VG     I   +Y D+++++ 
Sbjct: 513 FTVAISSAIILPITPFFKDP---YLIQPFAVCAGVGALTAIIFLWRYWDLDKQMK 564

>TBLA0F02130 Chr6 complement(522486..525128) [2643 bp, 880 aa] {ON}
           Anc_7.309 YDL194W
          Length = 880

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 44/93 (47%), Gaps = 9/93 (9%)

Query: 152 FFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGFI 211
           F     +L  + A ++AD Y  K T I   T I+ +G       SL  + SH   +G F+
Sbjct: 179 FLSLGTFLGALIAPFIADRYGRKITIILSSTLIFFLG------NSL-QVGSH--GIGLFV 229

Query: 212 VTLILVGIATGMIKANLSVMIAEQIPKRKRRVI 244
               + G+A GM+ A + +  AE  PK+ R  I
Sbjct: 230 AGRFISGVAIGMVSAVVPLYQAEAAPKQLRGTI 262

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 52/117 (44%), Gaps = 9/117 (7%)

Query: 125 NYMQNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGI 184
           +++Q     +  G L L +     L   F   C +  VF G + D Y G+   +  GT I
Sbjct: 102 DFIQRFGTKNEDGVLYLSTIRMGLLVSIFNIGCAIGSVFLGKLGDLY-GRRWGLIFGTSI 160

Query: 185 YIVGIFILFITSLPSITSHNTAMGGFIVTLILVGIATGMIKANLSVMIAEQIPKRKR 241
           ++VG+ I     + S++        + +  I+ GI  G+I     ++I+E  PK  R
Sbjct: 161 FVVGVII----QIASVSKWFQ----YFIGRIIAGIGMGVIAVLSPMLISEVAPKELR 209

>NDAI0F02920 Chr6 (715012..716226) [1215 bp, 404 aa] {ON} Anc_2.138
           YHR123W
          Length = 404

 Score = 37.4 bits (85), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 38/64 (59%), Gaps = 3/64 (4%)

Query: 283 ELEAHKGFWAAY--LLPFCFFWVAVIVLIVGNKTYIKTPVGDKV-ISKCFKVLRILMRNR 339
           ELE+ K    A   LLPF F++++VIVLI  N+ +I  P+   + ++  F V RI++ + 
Sbjct: 263 ELESQKELDIAIKGLLPFLFYFISVIVLITVNENFINLPLVLSIGLTMAFVVGRIIVAHL 322

Query: 340 FNPD 343
            N D
Sbjct: 323 TNQD 326

>NCAS0A10620 Chr1 complement(2115434..2118691) [3258 bp, 1085 aa]
           {ON} 
          Length = 1085

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 62/140 (44%), Gaps = 14/140 (10%)

Query: 189 IFILFITSLPSITSHNTAMGGFIVTLILVGIATGMI---KANLSVMIAEQIPKRKRRVIT 245
           I +LFI+ + S + H+   GG I  +++V +  G+    KA+ ++   + +      VI 
Sbjct: 69  ILVLFISMIISFSIHDWITGGVISFVVIVNVIIGLFQEYKASKTMNSLKALSSPNATVI- 127

Query: 246 KKNGTR-VIEDPDITIQNVFMTFYFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVA 304
            +NGTR  I+  D+   ++ +     +    L +I T   E  +       LP       
Sbjct: 128 -RNGTRETIDSKDVVPGDLCLVKVGDVIPADLRLIETHNFETDEALLTGESLP------- 179

Query: 305 VIVLIVGNKTYIKTPVGDKV 324
            +    GN   + TPVGD++
Sbjct: 180 -VNKEPGNVYEVDTPVGDRL 198

>NDAI0F01930 Chr6 (467932..469626) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 49/117 (41%), Gaps = 9/117 (7%)

Query: 125 NYMQNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGI 184
           +Y+    +  P G   +       L   F   C +  VF G + D+  G+   I +G  I
Sbjct: 88  DYINRFGSTHPSGTKYMSKVRTGLLVSIFNVGCAIGSVFLGRLGDSI-GRRKGIVVGASI 146

Query: 185 YIVGIFILFITSLPSITSHNTAMGGFIVTLILVGIATGMIKANLSVMIAEQIPKRKR 241
           YIVGI I     + SI         + +  I+ G+ +G I     ++I+E  PK  R
Sbjct: 147 YIVGIVI----QIASIDKWFQ----YFIGRIIGGLGSGAIAVLSPMLISEVSPKHLR 195

>TBLA0E02620 Chr5 complement(659914..663324) [3411 bp, 1136 aa] {ON}
            YDR038C
          Length = 1136

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 62/140 (44%), Gaps = 10/140 (7%)

Query: 189 IFILFITSLPSITSHNTAMGGFIVTLILVGIATGMI---KANLSVMIAEQIPKRKRRVIT 245
           + +L I+ + S+   +   GG I  ++ + ++ G+    KA+ ++   + +      VI 
Sbjct: 69  VLVLLISMIISLAIRDWITGGVIAFVVFLNVSIGIFQEYKASKTMNSLKALSSPSAHVI- 127

Query: 246 KKNG-TRVIEDPDITIQNVFMTFYFMINIGSLSVIATTELEAHKGFWAAYLLPFCFFWVA 304
            +NG T+ I   D+ I ++            L +I+    E  +       LP C     
Sbjct: 128 -RNGITQTIPTKDVVIGDLVTVKLGDTIPADLRIISQNNFETDEALLTGESLPVC----K 182

Query: 305 VIVLIVGNKTYIKTPVGDKV 324
           +   +V ++T I+ PVGD++
Sbjct: 183 ISDPLVPDETQIEIPVGDRI 202

>TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 9/93 (9%)

Query: 149 LSYFFQFWCYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMG 208
           L+  F   C +   F G + D Y G+   + I T I+IVG  I     + S+ +    M 
Sbjct: 112 LTSMFNVGCSIGSFFLGRLGDMY-GRRIGLIIATTIFIVGTII----QVASVKAWYQYMI 166

Query: 209 GFIVTLILVGIATGMIKANLSVMIAEQIPKRKR 241
           G IV     G+  G+I     ++I+E  PK  R
Sbjct: 167 GRIVA----GVGCGVIAMLSPMLISEVSPKHLR 195

>TBLA0B06260 Chr2 complement(1477173..1480907) [3735 bp, 1244 aa]
           {ON} 
          Length = 1244

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 3/71 (4%)

Query: 427 FVYPFIRKYTPFKPITKIFWGFTFGALSMTWACVLQHFIYKAAPCYDHPSKCDNGPNHIH 486
           F+Y  + K  PF+    +  GFT   L   + CVL + I   AP Y H       PN  H
Sbjct: 461 FIYNKLSKTEPFQGGGYLMQGFTV-QLRYAYGCVLLNTINTIAPFYKHSKYLPGHPNFEH 519

Query: 487 VALQVPAYCLL 497
              +  AY L+
Sbjct: 520 QNNE--AYTLM 528

>ADL156C Chr4 complement(416054..417505) [1452 bp, 483 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL119C
           (MCH4); Tandem gene duplication in this genome
          Length = 483

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 62/147 (42%), Gaps = 26/147 (17%)

Query: 101 RCWLMAVIELAERFSYYGLS---APFQNYMQNGPNDSPPGALSLDSSGATGLSYFFQFW- 156
           R WL  +      F  +G +     ++ Y+ N           L SSGA  +S+ F    
Sbjct: 77  RAWLTVLGSFVGIFPIWGTANALGAYEGYISNH---------QLASSGAGEVSWIFALHM 127

Query: 157 --CYLTPVFAGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGFIVTL 214
             C++  VF+G   D   G+   I +G+ +Y+ GIF++         S  T +  FI+  
Sbjct: 128 IACFVGCVFSGSYFDRNGGQ-KAIIVGSVLYVFGIFMM---------SECTKLWHFILAF 177

Query: 215 IL-VGIATGMIKANLSVMIAEQIPKRK 240
            L  G+  G++   L   +A    +R+
Sbjct: 178 SLSSGVGAGILTTPLISCVATWFHRRR 204

>Suva_2.730 Chr2 (1271371..1273059) [1689 bp, 562 aa] {ON} YDR536W
           (REAL)
          Length = 562

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 63/149 (42%), Gaps = 17/149 (11%)

Query: 104 LMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPVF 163
           LMA +   ++F+Y      F    +NG +D     +     GAT   Y  +  C+   +F
Sbjct: 48  LMASLITGKQFNY-----EFPATKENGDHDRHATVVQ----GATTSCY--ELGCFAGSLF 96

Query: 164 AGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGFIVTLILVGIATGM 223
             +  +   G+   I +G+ I IVG      T   S      A+G FI+  ++ G+ TG+
Sbjct: 97  VMFYGERI-GRKPLILMGSIITIVGA-----TISTSAFRDYWALGQFIIGRVVTGVGTGL 150

Query: 224 IKANLSVMIAEQIPKRKRRVITKKNGTRV 252
             + + V  +E      R ++    G+ +
Sbjct: 151 NTSTIPVWQSEMSKAENRGLLVNLEGSTI 179

>NCAS0H01890 Chr8 complement(365526..367301) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 33/70 (47%), Gaps = 8/70 (11%)

Query: 172 WGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGFIVTLILVGIATGMIKANLSVM 231
           WG+   +    GIYIVGI I        ITS N     FI   I+ G+  G I     ++
Sbjct: 161 WGRRLGLITVIGIYIVGILI-------QITSFNKWYQYFI-GRIISGLGVGGITVLAPML 212

Query: 232 IAEQIPKRKR 241
           I+E  PK+ R
Sbjct: 213 ISEVAPKKLR 222

>YDR536W Chr4 (1508005..1509714) [1710 bp, 569 aa] {ON}
           STL1Glycerol proton symporter of the plasma membrane,
           subject to glucose-induced inactivation, strongly but
           transiently induced when cells are subjected to osmotic
           shock
          Length = 569

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 65/149 (43%), Gaps = 17/149 (11%)

Query: 104 LMAVIELAERFSYYGLSAPFQNYMQNGPNDSPPGALSLDSSGATGLSYFFQFWCYLTPVF 163
           LMA +   ++F+Y      F    +NG +D     +     GAT   Y  +  C+   +F
Sbjct: 48  LMASLITGKQFNY-----EFPATKENGDHDRHATVVQ----GATTSCY--ELGCFAGSLF 96

Query: 164 AGYMADTYWGKFTTICIGTGIYIVGIFILFITSLPSITSHNTAMGGFIVTLILVGIATGM 223
             +  +   G+   I +G+ I I+G  I    S  +   +  A+G FI+  ++ G+ TG+
Sbjct: 97  VMFCGERI-GRKPLILMGSVITIIGAVI----STCAFRGY-WALGQFIIGRVVTGVGTGL 150

Query: 224 IKANLSVMIAEQIPKRKRRVITKKNGTRV 252
             + + V  +E      R ++    G+ +
Sbjct: 151 NTSTIPVWQSEMSKAENRGLLVNLEGSTI 179

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,846,711
Number of extensions: 2747879
Number of successful extensions: 8829
Number of sequences better than 10.0: 53
Number of HSP's gapped: 8980
Number of HSP's successfully gapped: 54
Length of query: 633
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 517
Effective length of database: 40,180,143
Effective search space: 20773133931
Effective search space used: 20773133931
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)