Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A076001.2ON2302307521e-101
TBLA0A070501.121ON2612297372e-98
Kpol_2002.31.2ON2232482814e-30
Suva_3.1471.2ON2102362291e-22
YCR039C (MATALPHA2)1.121ON2102362291e-22
YCL067C (HMLALPHA2)1.2ON2102362291e-22
Skud_3.1181.121ON2102362291e-22
KAFR0D007201.121ON2062361941e-17
TPHA0E040701.2ON231591812e-15
TPHA0E036101.121ON231591812e-15
ZYRO0F15818g1.121ON225591794e-15
ZYRO0F18568g1.2ON225591794e-15
Skud_102.1singletonON1852111756e-15
Smik_95.1singletonON1852111756e-15
Smik_3.1421.121ON2282111761e-14
NDAI0A001101.2ON211581732e-14
Suva_3.135singletonON119631645e-14
Suva_3.74singletonON119631645e-14
Suva_3.751.121ON119631645e-14
YCR096C (HMRA2)singletonOFF119631645e-14
NCAS0B091401.2ON205571662e-13
Ecym_11151.121ON230621662e-13
Ecym_10021.2ON230621662e-13
TDEL0C070001.2ON237581602e-12
KLLA0C00374g1.2ON223571503e-11
CAGL0B00264g1.2ON210621461e-10
CAGL0B01265g1.121ON186621442e-10
KNAG0C001601.2ON203571345e-09
Kwal_YGOB_matalpha21.121ON110541181e-07
Kwal_33.12995singletonOFF110541181e-07
Kwal_YGOB_HMalpha21.2ON110541181e-07
Kwal_33.matalpha2singletonOFF110541181e-07
KLTH0F00396g1.2ON108451102e-06
Skud_71.2singletonON4537931e-04
KNAG0M005006.170ON29856950.001
ZYRO0G22044g6.170ON20165930.001
Suva_69.1singletonON3434840.001
Smik_7.1816.170ON27454930.002
Kwal_27.110926.170ON22954900.003
CAGL0C01551g6.170ON22160900.004
Suva_16.1326.170ON29260900.004
Skud_16.1036.170ON29560900.005
KLTH0H05236g6.170ON23454880.007
Smik_6.3746.170ON29460890.007
YPL177C (CUP9)6.170ON30660880.008
Skud_7.1816.170ON27454870.009
Suva_7.1726.170ON27063870.010
TPHA0B025806.170ON26459870.010
NDAI0F021706.170ON38358870.012
NDAI0I013206.170ON40963870.013
AFL049C6.170ON25760850.016
KAFR0G036506.170ON17754840.016
Kpol_1036.566.170ON26554840.022
Ecym_22476.170ON34960850.023
YGL096W (TOS8)6.170ON27654840.028
NCAS0D035706.170ON25757820.045
NCAS0H011306.170ON28060820.047
SAKL0A05610g6.170ON32068820.050
KLLA0B10450g6.170ON38961820.058
TDEL0F018106.170ON25658810.058
KAFR0A043706.170ON40954810.070
CAGL0H02959g6.170ON25954800.070
TBLA0C037406.170ON29354790.12
KNAG0F022106.170ON32454740.42
Kpol_2002.481.122ON9059680.85
Kpol_408.2singletonON9059680.85
Kpol_1058.2na 1ON9059680.85
TPHA0E04055singletonON8459671.0
TPHA0E035951.122ON8459671.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07600
         (230 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07600 Chr1 (1882710..1882771,1882865..1882958,1883018..188...   294   e-101
TBLA0A07050 Chr1 (1728941..1729002,1729096..1729189,1729249..172...   288   2e-98
Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353...   112   4e-30
Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}...    93   1e-22
YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}  M...    93   1e-22
YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}  HML...    93   1e-22
Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}...    93   1e-22
KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating ...    79   1e-17
TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 ...    74   2e-15
TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 ...    74   2e-15
ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa] ...    74   4e-15
ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa] ...    74   4e-15
Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)        72   6e-15
Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)          72   6e-15
Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}...    72   1e-14
NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  sil...    71   2e-14
Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}...    68   5e-14
Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...    68   5e-14
Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...    68   5e-14
YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}  ...    68   5e-14
NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {...    69   2e-13
Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa] ...    69   2e-13
Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa...    69   2e-13
TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {...    66   2e-12
KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON} uniprot|Q...    62   3e-11
CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly si...    61   1e-10
CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar...    60   2e-10
KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2 YC...    56   5e-09
Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON} (...    50   1e-07
Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C ...    50   1e-07
Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON} ANNO...    50   1e-07
Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF} (m...    50   1e-07
KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {...    47   2e-06
Skud_71.2 Chr71 (734..868) [135 bp, 45 aa] {ON} YCL067C (REAL)         40   1e-04
KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}...    41   0.001
ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some ...    40   0.001
Suva_69.1 Chr69 complement(1..102) [102 bp, 34 aa] {ON} YCR039C ...    37   0.001
Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W (...    40   0.002
Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C...    39   0.003
CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {O...    39   0.004
Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {O...    39   0.004
Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {O...    39   0.005
KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {O...    39   0.007
Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C (...    39   0.007
YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}  ...    39   0.008
Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W (...    38   0.009
Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W (...    38   0.010
TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.17...    38   0.010
NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.1...    38   0.012
NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {O...    38   0.013
AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON} Sy...    37   0.016
KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.17...    37   0.016
Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON} (15399...    37   0.022
Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}...    37   0.023
YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}  TOS8Homeodo...    37   0.028
NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.17...    36   0.045
NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON...    36   0.047
SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {O...    36   0.050
KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some s...    36   0.058
TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON...    36   0.058
KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {O...    36   0.070
CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some si...    35   0.070
TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON...    35   0.12 
KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON...    33   0.42 
Kpol_2002.48 s2002 complement(103569..103598,103652..103813,1038...    31   0.85 
Kpol_408.2 s408 complement(1157..1186,1240..1401,1457..1537) [27...    31   0.85 
Kpol_1058.2 s1058 (4720..4800,4856..5017,5071..5100) [273 bp, 90...    31   0.85 
TPHA0E04055 Chr5 (848518..848580,848636..848797,848896..848925) ...    30   1.0  
TPHA0E03595 Chr5 (764541..764603,764659..764820,764919..764948) ...    30   1.0  

>TBLA0A07600 Chr1
           (1882710..1882771,1882865..1882958,1883018..1883554)
           [693 bp, 230 aa] {ON} Anc_1.2 YCL067C silenced copy of
           alpha2 gene at HML locus
          Length = 230

 Score =  294 bits (752), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 161/230 (70%)

Query: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQLSEILKFLTKTIKH 60
           MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQLSEILKFLTKTIKH
Sbjct: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQLSEILKFLTKTIKH 60

Query: 61  EPLGKXXXXXXXXXXXXXXXXXXXXKEARQLHRLHHSQSTHNPRVFNVLTQHMMXXXXXX 120
           EPLGK                    KEARQLHRLHHSQSTHNPRVFNVLTQHMM      
Sbjct: 61  EPLGKEETELVTTTVQLSTVLSSLVKEARQLHRLHHSQSTHNPRVFNVLTQHMMSNSNST 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQHTPSHRGHRLPKHTLI 180
                                                      QHTPSHRGHRLPKHTLI
Sbjct: 121 STSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPSHRGHRLPKHTLI 180

Query: 181 PLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERYKLN 230
           PLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERYKLN
Sbjct: 181 PLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERYKLN 230

>TBLA0A07050 Chr1
           (1728941..1729002,1729096..1729189,1729249..1729878)
           [786 bp, 261 aa] {ON}  MATalpha2 gene at MAT locus
          Length = 261

 Score =  288 bits (737), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 158/229 (68%), Positives = 159/229 (69%)

Query: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQLSEILKFLTKTIKH 60
           MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQLSEILKFLTKTIKH
Sbjct: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQLSEILKFLTKTIKH 60

Query: 61  EPLGKXXXXXXXXXXXXXXXXXXXXKEARQLHRLHHSQSTHNPRVFNVLTQHMMXXXXXX 120
           EPLGK                    KEARQLHRLHHSQSTHNPRVFNVLTQHMM      
Sbjct: 61  EPLGKEETELVTTTVQLSTVLSSLVKEARQLHRLHHSQSTHNPRVFNVLTQHMMSNSNST 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQHTPSHRGHRLPKHTLI 180
                                                      QHTPSHRGHRLPKHTLI
Sbjct: 121 STSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPSHRGHRLPKHTLI 180

Query: 181 PLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERYKL 229
           PLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER+ L
Sbjct: 181 PLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERHSL 229

>Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353)
           [672 nt, 224 aa]
          Length = 223

 Score =  112 bits (281), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 108/248 (43%), Gaps = 67/248 (27%)

Query: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQ----LSEILKFLTK 56
           MNKIPI+ LLNP++ EN+K++LQ +N +L S+CS++P   S  E +    L  IL FLT 
Sbjct: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60

Query: 57  TIKHEPLGKXXXXXXXXXXXXXXXXXXXXKEARQLHRLHHSQST---------------- 100
            +K+E L                      K  R  +  + SQ++                
Sbjct: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSDS 120

Query: 101 --HNPRVFNVLTQHMMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 158
              N  VFN++TQ MM                                            
Sbjct: 121 NDRNEFVFNIVTQDMMNKKKM--------------------------------------- 141

Query: 159 XXXXXQHTPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWI 218
                 +  S+RGHRLPK  +  LE+W++ N  +PYL +  +  L   +SLSK Q+KNW+
Sbjct: 142 ------NIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWV 195

Query: 219 SNRRRKER 226
           SNRRRKE+
Sbjct: 196 SNRRRKEK 203

>Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}
           (REAL)
          Length = 210

 Score = 92.8 bits (229), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 99/236 (41%), Gaps = 58/236 (24%)

Query: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLP----SAKSMEETQLSEILKFLTK 56
           MNKIPI  LLNP  ++  K  + ++NK+L S+C  LP    S  + EE +L +IL FL++
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 57  TIKHEPLGKXXXXXXXXXXXXXXXXXXXXKEARQL------HRLHHSQSTHNPRVFNVLT 110
             K+  +                      KE R +      ++L     + +  VFNV+T
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120

Query: 111 QHMMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQHTPSHR 170
           Q M+                                                 + T  +R
Sbjct: 121 QDMIN------------------------------------------------KSTKPYR 132

Query: 171 GHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           GHR  K  +  LE WF  N  +PYL    L+ L   +SLS+ Q+KNW+SNRRRKE+
Sbjct: 133 GHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188

>YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}
           MATALPHA2Homeobox-domain protein that, with Mcm1p,
           represses a-specific genes in haploids; acts with A1p to
           repress transcription of haploid-specific genes in
           diploids; one of two genes encoded by the MATalpha
           mating type cassette
          Length = 210

 Score = 92.8 bits (229), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 99/236 (41%), Gaps = 58/236 (24%)

Query: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLP----SAKSMEETQLSEILKFLTK 56
           MNKIPI  LLNP  ++  K  + ++NK+L S+C  LP    S  + EE +L +IL FL++
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 57  TIKHEPLGKXXXXXXXXXXXXXXXXXXXXKEARQL------HRLHHSQSTHNPRVFNVLT 110
             K+  +                      KE R +      ++L     + +  VFNV+T
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120

Query: 111 QHMMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQHTPSHR 170
           Q M+                                                 + T  +R
Sbjct: 121 QDMIN------------------------------------------------KSTKPYR 132

Query: 171 GHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           GHR  K  +  LE WF  N  +PYL    L+ L   +SLS+ Q+KNW+SNRRRKE+
Sbjct: 133 GHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188

>YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}
           HMLALPHA2Silenced copy of ALPHA2 at HML; homeobox-domain
           protein that associates with Mcm1p in haploid cells to
           repress a-specific gene expression and interacts with
           a1p in diploid cells to repress haploid-specific gene
           expression
          Length = 210

 Score = 92.8 bits (229), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 99/236 (41%), Gaps = 58/236 (24%)

Query: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLP----SAKSMEETQLSEILKFLTK 56
           MNKIPI  LLNP  ++  K  + ++NK+L S+C  LP    S  + EE +L +IL FL++
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 57  TIKHEPLGKXXXXXXXXXXXXXXXXXXXXKEARQL------HRLHHSQSTHNPRVFNVLT 110
             K+  +                      KE R +      ++L     + +  VFNV+T
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120

Query: 111 QHMMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQHTPSHR 170
           Q M+                                                 + T  +R
Sbjct: 121 QDMIN------------------------------------------------KSTKPYR 132

Query: 171 GHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           GHR  K  +  LE WF  N  +PYL    L+ L   +SLS+ Q+KNW+SNRRRKE+
Sbjct: 133 GHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188

>Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}
           YCR039C (REAL)
          Length = 210

 Score = 92.8 bits (229), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/236 (28%), Positives = 99/236 (41%), Gaps = 58/236 (24%)

Query: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLP----SAKSMEETQLSEILKFLTK 56
           MNKIPI  LLNP  ++  K  + ++NK+L S+C  LP    S  + EE +L +IL FL++
Sbjct: 1   MNKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 57  TIKHEPLGKXXXXXXXXXXXXXXXXXXXXKEARQL------HRLHHSQSTHNPRVFNVLT 110
             K+  +                      KE R +      ++L     + +  VFNV+T
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVT 120

Query: 111 QHMMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQHTPSHR 170
           Q M+                                                 + T  +R
Sbjct: 121 QDMIN------------------------------------------------KSTKPYR 132

Query: 171 GHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           GHR  K  +  LE WF  N  +PYL    L+ L   +SLS+ Q+KNW+SNRRRKE+
Sbjct: 133 GHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 188

>KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating
           type gene MATalpha2
          Length = 206

 Score = 79.3 bits (194), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 96/236 (40%), Gaps = 56/236 (23%)

Query: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQ----LSEILKFLTK 56
           MNKI I  LLN     + K++L+++N +L ++CS+LPS++++ E +    L +I+  L+K
Sbjct: 1   MNKIQIQDLLNSPRDVDTKQELRDINDKLFALCSKLPSSEALLEAEFHLELRDIMLNLSK 60

Query: 57  TIKHEPLGKXXXXXXXXXXXXXXXXXXXXKEARQLH------RLHHSQSTHNPRVFNVLT 110
                 +G                     K  +  H             + +  VFNV+T
Sbjct: 61  LQDTSRMGSEEKHLAYTAHQLTCTMITLIKGMKNFHGTGGHSYSSSKSESDDKTVFNVVT 120

Query: 111 QHMMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQHTPSHR 170
           Q MM                                                     S+R
Sbjct: 121 QDMMNLNRTGI----------------------------------------------SYR 134

Query: 171 GHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           GHR  K  +  LE+W+  +   PYL+    + L +++ LS+ Q+KNW+SNRRRKE+
Sbjct: 135 GHRFSKENVKVLERWYTAHIDRPYLNRQSTEYLISKTGLSRVQIKNWVSNRRRKEK 190

>TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 bp,
           231 aa] {ON}   silenced copy of alpha2 at HMLalpha locus
          Length = 231

 Score = 74.3 bits (181), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 47/59 (79%)

Query: 168 SHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           S+RGHRLPK  +  LE W++ ++ +PYL+  +++ L +++SLS+ QVKNWISNRRRKE+
Sbjct: 153 SYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEK 211

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 4/69 (5%)

Query: 1  MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKS----MEETQLSEILKFLTK 56
          MNKIPI+ LLNP+   N+ E+LQ +N  L ++C++LP   +     +  +L +IL +LT 
Sbjct: 1  MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60

Query: 57 TIKHEPLGK 65
           +K + L K
Sbjct: 61 VVKQQELKK 69

>TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 bp,
           231 aa] {ON} Anc_1.122 YCR039C MATalpha2 gene at MAT
           locus
          Length = 231

 Score = 74.3 bits (181), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 47/59 (79%)

Query: 168 SHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           S+RGHRLPK  +  LE W++ ++ +PYL+  +++ L +++SLS+ QVKNWISNRRRKE+
Sbjct: 153 SYRGHRLPKKNVQYLEDWYMDHRKNPYLNEINIKLLMSKTSLSRIQVKNWISNRRRKEK 211

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 4/69 (5%)

Query: 1  MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKS----MEETQLSEILKFLTK 56
          MNKIPI+ LLNP+   N+ E+LQ +N  L ++C++LP   +     +  +L +IL +LT 
Sbjct: 1  MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60

Query: 57 TIKHEPLGK 65
           +K + L K
Sbjct: 61 VVKQQELKK 69

>ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score = 73.6 bits (179), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 168 SHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           ++RGHRLPKH    LE WF  N  HPYL  S ++ L  ++ LS  Q+KNW+SNRRRKE+
Sbjct: 143 TYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEK 201

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (68%)

Query: 1  MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQLSEILKFL 54
          MNKIPI+ LLNP + E   E+L+N+N +LL++CS+LPS     E   +E+ K L
Sbjct: 1  MNKIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPSENEQFEKDKAELEKIL 54

>ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score = 73.6 bits (179), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 41/59 (69%)

Query: 168 SHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           ++RGHRLPKH    LE WF  N  HPYL  S ++ L  ++ LS  Q+KNW+SNRRRKE+
Sbjct: 143 TYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKELMVETKLSGPQIKNWVSNRRRKEK 201

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (68%)

Query: 1  MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQLSEILKFL 54
          MNKIPI+ LLNP + E   E+L+N+N +LL++CS+LPS     E   +E+ K L
Sbjct: 1  MNKIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPSENEQFEKDKAELEKIL 54

>Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score = 72.0 bits (175), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 83/211 (39%), Gaps = 58/211 (27%)

Query: 26  NKELLSMCSRLP----SAKSMEETQLSEILKFLTKTIKHEPLGKXXXXXXXXXXXXXXXX 81
           NK+L S+C  LP    S  + EE +L +IL FL++  K+  +                  
Sbjct: 1   NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 60

Query: 82  XXXXKEARQL------HRLHHSQSTHNPRVFNVLTQHMMXXXXXXXXXXXXXXXXXXXXX 135
               KE R +      ++L     + +  VFNV+TQ M+                     
Sbjct: 61  TVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMIN-------------------- 100

Query: 136 XXXXXXXXXXXXXXXXXXXXXXXXXXXXQHTPSHRGHRLPKHTLIPLEKWFLHNKSHPYL 195
                                       + T  +RGHR  K  +  LE WF  N  +PYL
Sbjct: 101 ----------------------------KSTKPYRGHRFTKENVRILESWFAKNIENPYL 132

Query: 196 HNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
               L+ L   +SLS+ Q+KNW+SNRRRKE+
Sbjct: 133 DTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 163

>Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score = 72.0 bits (175), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 83/211 (39%), Gaps = 58/211 (27%)

Query: 26  NKELLSMCSRLP----SAKSMEETQLSEILKFLTKTIKHEPLGKXXXXXXXXXXXXXXXX 81
           NK+L S+C  LP    S  + EE +L +IL FL++  K+  +                  
Sbjct: 1   NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 60

Query: 82  XXXXKEARQL------HRLHHSQSTHNPRVFNVLTQHMMXXXXXXXXXXXXXXXXXXXXX 135
               KE R +      ++L     + +  VFNV+TQ M+                     
Sbjct: 61  TVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMIN-------------------- 100

Query: 136 XXXXXXXXXXXXXXXXXXXXXXXXXXXXQHTPSHRGHRLPKHTLIPLEKWFLHNKSHPYL 195
                                       + T  +RGHR  K  +  LE WF  N  +PYL
Sbjct: 101 ----------------------------KSTKPYRGHRFTKENVRILESWFAKNIENPYL 132

Query: 196 HNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
               L+ L   +SLS+ Q+KNW+SNRRRKE+
Sbjct: 133 DTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 163

>Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}
           YCL067C (REAL)
          Length = 228

 Score = 72.4 bits (176), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 83/211 (39%), Gaps = 58/211 (27%)

Query: 26  NKELLSMCSRLP----SAKSMEETQLSEILKFLTKTIKHEPLGKXXXXXXXXXXXXXXXX 81
           NK+L S+C  LP    S  + EE +L +IL FL++  K+  +                  
Sbjct: 44  NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 103

Query: 82  XXXXKEARQL------HRLHHSQSTHNPRVFNVLTQHMMXXXXXXXXXXXXXXXXXXXXX 135
               KE R +      ++L     + +  VFNV+TQ M+                     
Sbjct: 104 TVLLKEMRSIENDRSNYQLTQKNKSADGLVFNVVTQDMIN-------------------- 143

Query: 136 XXXXXXXXXXXXXXXXXXXXXXXXXXXXQHTPSHRGHRLPKHTLIPLEKWFLHNKSHPYL 195
                                       + T  +RGHR  K  +  LE WF  N  +PYL
Sbjct: 144 ----------------------------KSTKPYRGHRFTKENVRILESWFAKNIENPYL 175

Query: 196 HNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
               L+ L   +SLS+ Q+KNW+SNRRRKE+
Sbjct: 176 DTKGLENLMKNTSLSRIQIKNWVSNRRRKEK 206

>NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  silent
           copy of MATalpha2 gene at HMLalpha
          Length = 211

 Score = 71.2 bits (173), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 42/58 (72%)

Query: 169 HRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           HRGHRLPK  +  LE W+L +   PYL + +L+ L  ++ LSK Q+KNWISNRRRKE+
Sbjct: 136 HRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVLMEETKLSKVQIKNWISNRRRKEK 193

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 54/128 (42%), Gaps = 14/128 (10%)

Query: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAK----SMEETQLSEILKFLTK 56
           MNKI I  LLNP  +  +   L ++N +L+++CS+ P+AK       + QL  I+ FL+ 
Sbjct: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVSFLST 60

Query: 57  TIKHEPLGKXXXXXXXXXXXXXXXXXXXXKEARQLHRLHHSQS----------THNPRVF 106
             +   L                      K+   L+     +           T++  VF
Sbjct: 61  LTQSTNLTSKDCSNIQLTYELSSMLGKVLKDMVLLNGTEEVEKKKVKEEEELETNSKYVF 120

Query: 107 NVLTQHMM 114
           NV+TQ MM
Sbjct: 121 NVITQDMM 128

>Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}
           YCR096C (REAL)
          Length = 119

 Score = 67.8 bits (164), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 40/63 (63%)

Query: 164 QHTPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRR 223
           + T  +RGHR  K  +  LE WF  N  +PYL    L+ L   +SLS+ Q+KNW+SNRRR
Sbjct: 35  KSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRR 94

Query: 224 KER 226
           KE+
Sbjct: 95  KEK 97

>Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCR039C (REAL)
          Length = 119

 Score = 67.8 bits (164), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 40/63 (63%)

Query: 164 QHTPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRR 223
           + T  +RGHR  K  +  LE WF  N  +PYL    L+ L   +SLS+ Q+KNW+SNRRR
Sbjct: 35  KSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRR 94

Query: 224 KER 226
           KE+
Sbjct: 95  KEK 97

>Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCL067C (REAL)
          Length = 119

 Score = 67.8 bits (164), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 40/63 (63%)

Query: 164 QHTPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRR 223
           + T  +RGHR  K  +  LE WF  N  +PYL    L+ L   +SLS+ Q+KNW+SNRRR
Sbjct: 35  KSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRR 94

Query: 224 KER 226
           KE+
Sbjct: 95  KEK 97

>YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}
           HMRA2Silenced copy of a2 at HMR; similarity to Alpha2p;
           required along with a1p for inhibiting expression of the
           HO endonuclease in a/alpha HO/HO diploid cells with an
           active mating-type interconversion system
          Length = 119

 Score = 67.8 bits (164), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 40/63 (63%)

Query: 164 QHTPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRR 223
           + T  +RGHR  K  +  LE WF  N  +PYL    L+ L   +SLS+ Q+KNW+SNRRR
Sbjct: 35  KSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRR 94

Query: 224 KER 226
           KE+
Sbjct: 95  KEK 97

>NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {ON}
           Anc_1.2
          Length = 205

 Score = 68.6 bits (166), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 42/57 (73%)

Query: 170 RGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           RGHRL K  +  LE W++ +  +PYL+ + LQ L  ++SLSK Q+KNW+SNRRRKE+
Sbjct: 133 RGHRLAKEKVDLLEHWYIQHMDNPYLNKASLQMLMQETSLSKMQIKNWVSNRRRKEK 189

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 36/58 (62%)

Query: 1  MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQLSEILKFLTKTI 58
          MNKI I  LLNP N+    EQL+++N +L ++CS  P+ ++++     E L+ +  T+
Sbjct: 1  MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPTTENLDFKTYQEQLRNIAVTL 58

>Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa]
           {ON} similar to YCL067C HMLALPHA2, 1-intron
          Length = 230

 Score = 68.6 bits (166), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 48/62 (77%)

Query: 166 TPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKE 225
           + S++GHRLPK  +  LE W+ +N  +PYL+++D++ L  ++  S++QVKNW++N+RRK+
Sbjct: 156 SSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKD 215

Query: 226 RY 227
           ++
Sbjct: 216 KH 217

>Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa]
           {ON} similar to Saccharomyces cerevisiae YCL067C
           HMLALPHA2; 1-intron
          Length = 230

 Score = 68.6 bits (166), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 48/62 (77%)

Query: 166 TPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKE 225
           + S++GHRLPK  +  LE W+ +N  +PYL+++D++ L  ++  S++QVKNW++N+RRK+
Sbjct: 156 SSSYKGHRLPKKHVQLLESWYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKD 215

Query: 226 RY 227
           ++
Sbjct: 216 KH 217

>TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {ON}
           Anc_1.122 YCR039C silenced copy of alpha2 gene at T.
           delbrueckii HML locus
          Length = 237

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (68%)

Query: 169 HRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           HRGHRLP   +  LE WF  N S PYL+   L+ L  ++SLS  Q+KNW+SNRRRK++
Sbjct: 156 HRGHRLPSEKVEKLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKK 213

>KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON}
           uniprot|Q9HDS5 Kluyveromyces lactis HMLALPHA2 Mating-
           type protein ALPHA2
          Length = 223

 Score = 62.4 bits (150), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 41/57 (71%)

Query: 170 RGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           +G R PK  +  LE W+  N+ +PYL  +DL  ++  ++L+KTQ+KNW++NRRRK++
Sbjct: 154 KGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKTQIKNWLANRRRKDK 210

>CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly
           similar to uniprot|P01367 Saccharomyces cerevisiae
           YCR039c or uniprot|P01367 Saccharomyces cerevisiae
           YCL067c HMLALP 2 mating type regulatory protein
          Length = 210

 Score = 60.8 bits (146), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 43/62 (69%)

Query: 165 HTPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRK 224
           +  S+RGHR  +  +  LE W+ ++  +PYL ++  Q L  +++LSK Q+KNW++NRRRK
Sbjct: 106 YAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRK 165

Query: 225 ER 226
           ++
Sbjct: 166 QK 167

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 39/55 (70%), Gaps = 1/55 (1%)

Query: 2  NKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQLSEILKFLTK 56
          ++I I  LLNP   EN+KE+LQ +N +L+S+CS LP  +S+     S+IL+FL++
Sbjct: 5  SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPS-SDILRFLSR 58

>CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar to
           uniprot|P01367 Saccharomyces cerevisiae YCR039c or
           uniprot|P01367 Saccharomyces cerevisiae YCL067c HMLALP2
           mating type regulatory protein
          Length = 186

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 43/62 (69%)

Query: 165 HTPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRK 224
           +  S+RGHR  +  +  LE W+ ++  +PYL ++  Q L  +++LSK Q+KNW++NRRRK
Sbjct: 106 YAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQQYLAQKTNLSKIQIKNWVANRRRK 165

Query: 225 ER 226
           ++
Sbjct: 166 QK 167

 Score = 50.1 bits (118), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 1/54 (1%)

Query: 3  KIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQLSEILKFLTK 56
          +I I  LLNP   EN+KE+LQ +N +L+S+CS LP  +S+     S+IL+FL++
Sbjct: 6  RISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPS-SDILRFLSR 58

>KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2
           YCL067C silent copy of mating type alpha2 gene at HML
           locus
          Length = 203

 Score = 56.2 bits (134), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%)

Query: 170 RGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           RGHR   ++   LE W+  +   PYL    L  L  ++ LSK Q++NW+SNRRRKE+
Sbjct: 133 RGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHELEFKTKLSKMQIRNWVSNRRRKEK 189

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 49/122 (40%), Gaps = 8/122 (6%)

Query: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLP----SAKSMEETQLSEILKFLTK 56
           MN+I I  LLN  +  ++ +  +N+N +LL +CS  P    S     + QL  IL FLTK
Sbjct: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60

Query: 57  TIKHEPLGKXXXXXXXXXXXXXXXXXXXXKEARQLH----RLHHSQSTHNPRVFNVLTQH 112
            +    L                      K            +   ++ N  VF+V+TQ 
Sbjct: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSFEDFFFERKEYNDPATSENEFVFSVVTQD 120

Query: 113 MM 114
           MM
Sbjct: 121 MM 122

>Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 173 RLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           + P +  + LE WF  N SHPYL    +  L+ +++LS  Q++NW+SNRRRK +
Sbjct: 38  KYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C
           (HMRA2) - Regulatory protein MATa2p (no known function);
           sequence is the same as the last 119 residues of
           MATalpha2p [contig 123] FULL
          Length = 110

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 173 RLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           + P +  + LE WF  N SHPYL    +  L+ +++LS  Q++NW+SNRRRK +
Sbjct: 38  KYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON}
           ANNOTATED BY YGOB - This is Kwal_33.12995
          Length = 110

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 173 RLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           + P +  + LE WF  N SHPYL    +  L+ +++LS  Q++NW+SNRRRK +
Sbjct: 38  KYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 173 RLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           + P +  + LE WF  N SHPYL    +  L+ +++LS  Q++NW+SNRRRK +
Sbjct: 38  KYPHNISMHLENWFHLNSSHPYLTRKQISLLSERTNLSSKQIRNWMSNRRRKSK 91

>KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {ON}
           conserved hypothetical protein
          Length = 108

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 31/45 (68%)

Query: 182 LEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226
           LE+WF  N  +PY +   + +L+  ++LS  Q++NW+SNRRRK R
Sbjct: 50  LERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSR 94

>Skud_71.2 Chr71 (734..868) [135 bp, 45 aa] {ON} YCL067C (REAL)
          Length = 45

 Score = 40.4 bits (93), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%)

Query: 1  MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLP 37
          MNKIPI  LLNP  ++  K  + ++NK+L S+C  LP
Sbjct: 1  MNKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLP 37

>KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}
           Anc_6.170 YPL177C
          Length = 298

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 34/56 (60%)

Query: 172 HRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           + LPK T++ L +W L +  +PY  + + + L  ++ LSK Q+ NW  N RR++ +
Sbjct: 181 YNLPKDTVLILNRWLLDHLHNPYPTSQEKRELLIKTGLSKIQLSNWFINVRRRKVF 236

>ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 201

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 165 HTPSHRGHR--LPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRR 222
           H  S  G R  LPK T+  L +W L +  +PY    + + L  ++ L+K Q+ NW  N R
Sbjct: 73  HKGSRSGRRSNLPKETVQILNRWLLDHLGNPYPTPQEKRDLLIKTGLTKIQLSNWFINVR 132

Query: 223 RKERY 227
           R++ +
Sbjct: 133 RRKIF 137

>Suva_69.1 Chr69 complement(1..102) [102 bp, 34 aa] {ON} YCR039C
          (REAL)
          Length = 34

 Score = 37.0 bits (84), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (67%)

Query: 1  MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCS 34
          MNKIPI  LLNP  ++  K  + ++NK+L S+C 
Sbjct: 1  MNKIPIKDLLNPQITDEFKSSILDINKKLFSICC 34

>Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 32/54 (59%)

Query: 174 LPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           LPK T+  L KW L + ++PY    + + L  ++ L+K Q+ NW  N RR++ +
Sbjct: 199 LPKATVSILNKWLLEHINNPYPTVQEKRELLAKTGLTKLQISNWFINARRRKIF 252

>Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C
           (CUP9) - putative DNA binding protein which shows
           similarity in homeobox domain to human proto-oncogene
           PBX1 [contig 31] FULL
          Length = 229

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%)

Query: 174 LPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           LPK T+  L  W L + ++PY    + + L  ++ LSK Q+ NW  N RR++ +
Sbjct: 125 LPKETVDILNNWLLAHLNYPYPSPQEKRELLIKTGLSKVQLSNWFINVRRRKVF 178

>CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {ON}
           similar to uniprot|P41817 Saccharomyces cerevisiae
           YPL177c CUP9
          Length = 221

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%)

Query: 168 SHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           S R   LPK T+  L +W L +  +PY    + + L  ++ L+K Q+ NW  N RR++ +
Sbjct: 76  SKRRSNLPKDTIQILNQWLLDHIHNPYPTQQEKRDLLIKTGLTKIQLSNWFINVRRRKIF 135

>Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {ON}
           YPL177C (REAL)
          Length = 292

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%)

Query: 168 SHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           S R   LPK T+  L  W L++ ++PY    + + L  ++ L+K Q+ NW  N RR++ +
Sbjct: 149 SGRRSNLPKETVQVLNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRKIF 208

>Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {ON}
           YPL177C (REAL)
          Length = 295

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%)

Query: 168 SHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           S R   LPK T+  L  W L++ ++PY    + + L  ++ L+K Q+ NW  N RR++ +
Sbjct: 152 SGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRKIF 211

>KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 234

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%)

Query: 174 LPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           LPK T+  L  W   + ++PY    + + L  Q+ LSK Q+ NW  N RR++ +
Sbjct: 109 LPKETVEILNAWLASHLNNPYPSPQEKRELLVQTGLSKVQLSNWFINVRRRKVF 162

>Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C
           (REAL)
          Length = 294

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%)

Query: 168 SHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           S R   LPK T+  L  W L++ ++PY    + + L  ++ L+K Q+ NW  N RR++ +
Sbjct: 151 SGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRKIF 210

>YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}
           CUP9Homeodomain-containing transcriptional repressor of
           PTR2, which encodes a major peptide transporter;
           imported peptides activate ubiquitin-dependent
           proteolysis, resulting in degradation of Cup9p and
           de-repression of PTR2 transcription
          Length = 306

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 34/60 (56%)

Query: 168 SHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           S R   LPK T+  L  W L++ ++PY    + + L  ++ L+K Q+ NW  N RR++ +
Sbjct: 163 SGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRKIF 222

>Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%)

Query: 174 LPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           LPK T+  L +W L +  +PY    + + L  ++ L+K Q+ NW  N RR++ +
Sbjct: 199 LPKATVCILNQWLLEHIHNPYPTVQEKRDLLAKTGLTKLQISNWFINARRRKIF 252

>Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W
           (REAL)
          Length = 270

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 169 HRGH----RLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRK 224
           ++GH     LP  T+  L KW L + ++PY    + + L  Q+ L+K Q+ NW  N RR+
Sbjct: 192 NKGHGKRSNLPGATVHILNKWLLEHINNPYPTLQEKRELLAQTGLTKLQISNWFINARRR 251

Query: 225 ERY 227
           + +
Sbjct: 252 KIF 254

>TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.170
           YPL177C
          Length = 264

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 171 GHR--LPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           G R  LPK ++  L KW L++  +PY    + + L   + LSK Q+ NW  N RR++ +
Sbjct: 155 GKRSNLPKQSVDVLNKWLLNHLGNPYPTPKEKEELLELTGLSKIQLSNWFINVRRRKIF 213

>NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.170
           YGL096W
          Length = 383

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%)

Query: 170 RGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           R   LPK T+  L  W L++  +PY  + + + L  ++ L+K Q+ NW  N RR++ +
Sbjct: 266 RRSNLPKETIRILNSWLLNHLQNPYPTSQEKRDLLIKTGLTKVQLSNWFINVRRRKIF 323

>NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {ON}
           Anc_6.170 YGL096W
          Length = 409

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%)

Query: 168 SHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           S R   LP  T+  L +W L + ++PY    + + L  Q+ L+K Q+ NW  N RR++ +
Sbjct: 306 SGRRSSLPITTVQILNEWLLDHLTNPYPTTQEKKELLKQTGLTKIQLSNWFINVRRRKVF 365

Query: 228 KLN 230
             N
Sbjct: 366 NEN 368

>AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL177C
           (CUP9) and YGL096W (TOS8)
          Length = 257

 Score = 37.4 bits (85), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%)

Query: 169 HRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERYK 228
           HR   LPK T+  L +W  ++  +PY    + + L  Q+ L+  Q+ NW  N RR++ ++
Sbjct: 133 HRRSNLPKETVDILNEWLRNHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRRKIFQ 192

>KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.170
           YPL177C
          Length = 177

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 32/54 (59%)

Query: 174 LPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           LPK T+  L  W L++  +PY  + + + L  ++ L+K Q+ NW  N RR++ +
Sbjct: 76  LPKETIQILNAWLLNHLHNPYPTSQEKRDLLIKTGLTKIQLSNWFINVRRRKIF 129

>Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON}
           (153997..154794) [798 nt, 266 aa]
          Length = 265

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 33/54 (61%)

Query: 174 LPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           LPK+++  L +W L++  +PY    + + L  Q+ L+K Q+ NW  N RR++ +
Sbjct: 163 LPKNSVQILNQWLLNHLQNPYPTPQEKKELLKQTGLTKIQLSNWFINVRRRKIF 216

>Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii AFL049C
          Length = 349

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%)

Query: 169 HRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERYK 228
           HR   LPK T+  L +W   +  +PY    + + L  Q+ L+  Q+ NW  N RR++ ++
Sbjct: 225 HRRSNLPKETVDILNEWLRDHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRRKIFQ 284

>YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}
           TOS8Homeodomain-containing protein and putative
           transcription factor found associated with chromatin;
           target of SBF transcription factor; induced during
           meiosis and under cell-damaging conditions; similar to
           Cup9p transcription factor
          Length = 276

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%)

Query: 174 LPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           LPK T+  L KW   + ++PY    + + L  ++ L+K Q+ NW  N RR++ +
Sbjct: 201 LPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRRKIF 254

>NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.170
           YGL096W
          Length = 257

 Score = 36.2 bits (82), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%)

Query: 174 LPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERYKLN 230
           LP+ T+  L  W L + ++PY +  + + L   + L+K Q+ NW  N RR++ +  N
Sbjct: 187 LPRGTVEVLNGWLLEHLNNPYPNVQEKKLLLELTGLTKVQLSNWFINVRRRKVFNEN 243

>NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON}
           Anc_6.170 YGL096W
          Length = 280

 Score = 36.2 bits (82), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 34/60 (56%)

Query: 168 SHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           ++R   LPK  +  L  W L++  +PY  + + + L  ++ L+K Q+ NW  N RR++ +
Sbjct: 127 NNRRSNLPKEMVQILNTWLLNHLQNPYPTSQEKRELLIKTGLTKVQLSNWFINVRRRKIF 186

>SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 320

 Score = 36.2 bits (82), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 4/68 (5%)

Query: 166 TPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRK- 224
           +PS++   LPK T+  L  W L +  +PY    + + L  ++ L+  Q+ NW  N RR+ 
Sbjct: 205 SPSNKRTNLPKETVQILNNWLLAHLHNPYPSPQEKRELLLKTGLNPVQLSNWFINVRRRK 264

Query: 225 ---ERYKL 229
              + YKL
Sbjct: 265 IFQDYYKL 272

>KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 389

 Score = 36.2 bits (82), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 174 LPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRK----ERYKL 229
           LPK  +  L  W L N  +PY      + L  ++ L+  Q+ NW  N RR+    E YKL
Sbjct: 256 LPKEVINVLNDWLLKNLHNPYPTPQVKRELLEKTGLNPVQLSNWFINVRRRKIFNEYYKL 315

Query: 230 N 230
           N
Sbjct: 316 N 316

>TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON}
           Anc_6.170 YPL177C
          Length = 256

 Score = 35.8 bits (81), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%)

Query: 170 RGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           R   LPK T+  L  W L +  +PY    + + L  ++ L+K Q+ NW  N RR++ +
Sbjct: 132 RRSNLPKETVQILNTWLLDHLRNPYPTPQEKRELLIKTGLTKIQLSNWFINVRRRKIF 189

>KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {ON}
           Anc_6.170 YPL177C
          Length = 409

 Score = 35.8 bits (81), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 174 LPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           LPK T+  L  W +++  +PY    +   L  Q+ L+K Q+ NW  N RR++ +
Sbjct: 275 LPKETVQILNNWLVNHLGNPYPTAIEKNELLKQTGLTKIQLSNWFINVRRRKVF 328

>CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some
           similarities with uniprot|P53147 Saccharomyces
           cerevisiae YGL096w TOS8
          Length = 259

 Score = 35.4 bits (80), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%)

Query: 174 LPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           LPK T+  L +W   + ++PY    +   L+ ++ L+K Q+ NW  N RR++ +
Sbjct: 168 LPKETVKILNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRRRKVF 221

>TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON}
           Anc_6.170 YPL177C
          Length = 293

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%)

Query: 174 LPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           LPK T+  L  W L++  +PY    +   L   + L+K Q+ NW  N RR++ +
Sbjct: 182 LPKETVQILNDWLLNHLRNPYPTPKEKSELLVLTGLTKIQLSNWFINVRRRKVF 235

>KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON}
           Anc_6.170 YPL177C
          Length = 324

 Score = 33.1 bits (74), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%)

Query: 174 LPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERY 227
           LP+ T+  L  W L++   PY    +   L  Q+ L+K Q+ NW  N RR++ +
Sbjct: 246 LPRETVQMLNNWLLNHLHDPYPTPHEKLELLRQTGLTKIQLSNWFINVRRRKVF 299

>Kpol_2002.48 s2002
           complement(103569..103598,103652..103813,103869..103949)
           [273 bp, 90 aa] {ON}
           complement(103569..103598,103652..103813,103869..103949)
           [273 nt, 91 aa]
          Length = 90

 Score = 30.8 bits (68), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 164 QHTPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRR 222
           + +  HR   LPK   + LE+ F   +S   L++ +  A+  +  L+  QV+ W  N+R
Sbjct: 31  ESSSDHRKKFLPKEARLFLERVFEKKQS---LNSKERDAIAKKCGLTPLQVRVWFINKR 86

>Kpol_408.2 s408 complement(1157..1186,1240..1401,1457..1537) [273
           bp, 90 aa] {ON}
           complement(1157..1186,1240..1401,1457..1537) [273 nt, 91
           aa]
          Length = 90

 Score = 30.8 bits (68), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 164 QHTPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRR 222
           + +  HR   LPK   + LE+ F   +S   L++ +  A+  +  L+  QV+ W  N+R
Sbjct: 31  ESSSDHRKKFLPKEARLFLERVFEKKQS---LNSKERDAIAKKCGLTPLQVRVWFINKR 86

>Kpol_1058.2 s1058 (4720..4800,4856..5017,5071..5100) [273 bp, 90
           aa] {ON} (4720..4800,4856..5017,5071..5100) [273 nt, 91
           aa]
          Length = 90

 Score = 30.8 bits (68), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 164 QHTPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRR 222
           + +  HR   LPK   + LE+ F   +S   L++ +  A+  +  L+  QV+ W  N+R
Sbjct: 31  ESSSDHRKKFLPKEARLFLERVFEKKQS---LNSKERDAIAKKCGLTPLQVRVWFINKR 86

>TPHA0E04055 Chr5 (848518..848580,848636..848797,848896..848925)
           [255 bp, 84 aa] {ON} silenced copy of a1 at HMLalpha
           locus
          Length = 84

 Score = 30.4 bits (67), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 164 QHTPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRR 222
           + +  HR   LPK   + LE+ F   +S   L++ +  A+  +  L+  QV+ W  N+R
Sbjct: 25  ESSSDHRKKFLPKEARLFLERVFEKKQS---LNSKERDAIAKKCGLTPLQVRVWFINKR 80

>TPHA0E03595 Chr5 (764541..764603,764659..764820,764919..764948)
           [255 bp, 84 aa] {ON} MATa1 gene at MAT locus
          Length = 84

 Score = 30.4 bits (67), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 164 QHTPSHRGHRLPKHTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRR 222
           + +  HR   LPK   + LE+ F   +S   L++ +  A+  +  L+  QV+ W  N+R
Sbjct: 25  ESSSDHRKKFLPKEARLFLERVFEKKQS---LNSKERDAIAKKCGLTPLQVRVWFINKR 80

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.127    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,073,848
Number of extensions: 513283
Number of successful extensions: 2997
Number of sequences better than 10.0: 77
Number of HSP's gapped: 3058
Number of HSP's successfully gapped: 97
Length of query: 230
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 124
Effective length of database: 41,326,803
Effective search space: 5124523572
Effective search space used: 5124523572
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 64 (29.3 bits)