Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A070401.120ON2012019791e-136
TBLA0A075901.1ON2012019791e-136
Kpol_2002.21.1ON2092083854e-46
ZYRO0F18590g1.1ON2001923566e-42
ZYRO0F15840g1.120ON2001923566e-42
TDEL0C070101.1ON2051613402e-39
TPHA0E036201.120ON1951983295e-38
TPHA0E040801.1ON1951983295e-38
Smik_92.1singletonON1561902319e-24
Suva_3.1481.1ON175682277e-23
YCR040W (MATALPHA1)1.120ON1751892242e-22
YCL066W (HMLALPHA1)1.1ON1751892242e-22
Skud_71.1singletonON155612213e-22
Skud_3.1191.120ON174652223e-22
CAGL0B00242g1.1ON1841492209e-22
CAGL0B01243g1.120ON1431462091e-20
Suva_69.2singletonON145561933e-18
KLTH0F00374g1.1ON2491941493e-11
Ecym_10031.1ON263661504e-11
Ecym_11141.120ON263661504e-11
NCAS0B091501.1ON1501901411e-10
KNAG0C001501.1ON145481366e-10
KAFR0D007101.120ON172491244e-08
Kwal_33.matalpha1singletonOFF2441831124e-06
Kwal_33.12992singletonOFF2441831124e-06
Kwal_YGOB_matalpha11.120ON2441831124e-06
Kwal_YGOB_HMalpha11.1ON2441831124e-06
KLLA0C00352g1.1ON2611771029e-05
NDAI0A001001.1ON13561890.002
Smik_88.1singletonON3518730.047
Smik_3.1441.120ON5424740.048
Skud_80.1singletonON3218720.056
Suva_3.791.120ON3517690.13
Suva_3.140singletonON3120660.36
Suva_14.2082.137ON15148700.81
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07590
         (201 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {...   381   e-136
TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {...   381   e-136
Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON} c...   152   4e-46
ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} simil...   141   6e-42
ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} simil...   141   6e-42
TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1....   135   2e-39
TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.12...   131   5e-38
TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenc...   131   5e-38
Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W...    94   9e-24
Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W (...    92   7e-23
YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}  MATALPHA1Tr...    91   2e-22
YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}  HMLALPHA1Sile...    91   2e-22
Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W...    90   3e-22
Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W (...    90   3e-22
CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}...    89   9e-22
CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {O...    85   1e-20
Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)        79   3e-18
KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}...    62   3e-11
Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to Sac...    62   4e-11
Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON} ...    62   4e-11
NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1      59   1e-10
KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON} ...    57   6e-10
KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON...    52   4e-08
Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa...    48   4e-06
Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF...    48   4e-06
Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 ...    48   4e-06
Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]...    48   4e-06
KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}...    44   9e-05
NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON} Anc...    39   0.002
Smik_88.1 Chr88 complement(3..72,501..535) [105 bp, 35 aa] {ON} ...    33   0.047
Smik_3.144 Chr3 (198300..198334,198763..198892) [165 bp, 54 aa] ...    33   0.048
Skud_80.1 Chr80 complement(3..98) [96 bp, 32 aa] {ON} YCR040W (R...    32   0.056
Suva_3.79 Chr3 (114117..114221) [105 bp, 35 aa] {ON} YCR040W (REAL)    31   0.13 
Suva_3.140 Chr3 (212396..212488) [93 bp, 31 aa] {ON} YCR040W (REAL)    30   0.36 
Suva_14.208 Chr14 (375224..375679) [456 bp, 151 aa] {ON} YNL131W...    32   0.81 

>TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {ON}
            MATalpha1 gene at MAT locus
          Length = 201

 Score =  381 bits (979), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 188/201 (93%), Positives = 188/201 (93%)

Query: 1   MSNKTMNHTKKALFKVNLKLNKNIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPT 60
           MSNKTMNHTKKALFKVNLKLNKNIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPT
Sbjct: 1   MSNKTMNHTKKALFKVNLKLNKNIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPT 60

Query: 61  TLLYNIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFXXXXXXXX 120
           TLLYNIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGF        
Sbjct: 61  TLLYNIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFPNNVNSNP 120

Query: 121 XXXXXERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVK 180
                ERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVK
Sbjct: 121 NPVNSERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVK 180

Query: 181 PKCGFVEWLGQTYEREMHLLL 201
           PKCGFVEWLGQTYEREMHLLL
Sbjct: 181 PKCGFVEWLGQTYEREMHLLL 201

>TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {ON}
           Anc_1.1 YCL066W silenced copy of alpha1 gene at HML
           locus
          Length = 201

 Score =  381 bits (979), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 188/201 (93%), Positives = 188/201 (93%)

Query: 1   MSNKTMNHTKKALFKVNLKLNKNIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPT 60
           MSNKTMNHTKKALFKVNLKLNKNIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPT
Sbjct: 1   MSNKTMNHTKKALFKVNLKLNKNIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPT 60

Query: 61  TLLYNIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFXXXXXXXX 120
           TLLYNIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGF        
Sbjct: 61  TLLYNIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFPNNVNSNP 120

Query: 121 XXXXXERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVK 180
                ERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVK
Sbjct: 121 NPVNSERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVK 180

Query: 181 PKCGFVEWLGQTYEREMHLLL 201
           PKCGFVEWLGQTYEREMHLLL
Sbjct: 181 PKCGFVEWLGQTYEREMHLLL 201

>Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON}
           complement(3611..4240) [630 nt, 210 aa]
          Length = 209

 Score =  152 bits (385), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 121/208 (58%), Gaps = 14/208 (6%)

Query: 1   MSNKTMNHTKKALFKVNLKLNKNIRMKTNSKSMRNKFNETRG-------ISILLYKNHNI 53
           MS K+ + T + LFKV L  +  I  +       NK   + G       +++ +  +   
Sbjct: 1   MSTKSRSWTSQPLFKVKLNKSNKIEKQKKKGIAINKLANSAGKLSQKANVNVFITNSLVT 60

Query: 54  KIPFPPTTLLYNIEVEKQKIISTQHMLNEYTMDNDDNYL--SDLFYEDEY--NDNNSLFD 109
           KIPFPP++LL  I+ E +K+ S +  +N   + ND N L  S  + ED+   +D  + +D
Sbjct: 61  KIPFPPSSLLLGIDEETKKMKSKKTSIN---IQNDTNILNFSSSWDEDDLFLSDTETEYD 117

Query: 110 NGFXXXXXXXXXXXXXERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVW 169
                           ++ LNGF+AFRAYNSQFGYGLKQ ILSSLLS AWH +P QQ  W
Sbjct: 118 LLSTSPNSVIEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKW 177

Query: 170 NFFSQEYNFVKPKCGFVEWLGQTYEREM 197
              SQ++NFVKPKCGFVEW+GQTYEREM
Sbjct: 178 TVLSQQFNFVKPKCGFVEWVGQTYEREM 205

>ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score =  141 bits (356), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 111/192 (57%), Gaps = 13/192 (6%)

Query: 11  KALFKVNLKLNKNIRMKT------NSKSMRNKFNETRGISILLYKNHNIKIPFPPTTLLY 64
           + LFKV ++     +  T       SK +  K  E + +++ +  +  IKIP PP  LL 
Sbjct: 13  QPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVLLR 72

Query: 65  NIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFXXXXXXXXXXXX 124
            IE EK K+       +++ MDN   +   +++ + Y    S+ D+              
Sbjct: 73  KIEEEKHKLKK-----DDFNMDNILLWDPYVYWGEGYF--FSIADSSLNNLSTKGSRKGC 125

Query: 125 XERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCG 184
            E+ LN F+AFRAYNSQFG GLKQNILSSLL+ AWH +P QQ +W+ F+Q++NFVKPKCG
Sbjct: 126 SEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCG 185

Query: 185 FVEWLGQTYERE 196
           FVEW+ Q YERE
Sbjct: 186 FVEWVDQRYERE 197

>ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score =  141 bits (356), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 111/192 (57%), Gaps = 13/192 (6%)

Query: 11  KALFKVNLKLNKNIRMKT------NSKSMRNKFNETRGISILLYKNHNIKIPFPPTTLLY 64
           + LFKV ++     +  T       SK +  K  E + +++ +  +  IKIP PP  LL 
Sbjct: 13  QPLFKVKVEKKGRSKRPTLQDTTQTSKCIAGKCIEDQQVNVFMTVSKLIKIPSPPEVLLR 72

Query: 65  NIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFXXXXXXXXXXXX 124
            IE EK K+       +++ MDN   +   +++ + Y    S+ D+              
Sbjct: 73  KIEEEKHKLKK-----DDFNMDNILLWDPYVYWGEGYF--FSIADSSLNNLSTKGSRKGC 125

Query: 125 XERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCG 184
            E+ LN F+AFRAYNSQFG GLKQNILSSLL+ AWH +P QQ +W+ F+Q++NFVKPKCG
Sbjct: 126 SEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQQKIWDTFAQQFNFVKPKCG 185

Query: 185 FVEWLGQTYERE 196
           FVEW+ Q YERE
Sbjct: 186 FVEWVDQRYERE 197

>TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1.121
           YCR040W silenced copy of alpha1 gene at T. delbrueckii
           HML locus
          Length = 205

 Score =  135 bits (340), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 98/161 (60%), Gaps = 13/161 (8%)

Query: 39  ETRGISILLYKNHNIKIPFPPTTLLYNIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYE 98
           E R +   +     IKIP PP  LL  IE EK+K+ S      E + +    + S + ++
Sbjct: 54  EERHVKTFVVILRPIKIPLPPNILLEKIEQEKRKVYS------ETSPEIGSLWDSPIAWD 107

Query: 99  DE---YNDNNSLFDNGFXXXXXXXXXXXXXERVLNGFIAFRAYNSQFGYGLKQNILSSLL 155
           +E   ++  + +  N +              + LN F+AFRAYNSQFGYGLKQNILSSLL
Sbjct: 108 NEDLLFSIASDVLGNIYKKPARETASN----KPLNSFMAFRAYNSQFGYGLKQNILSSLL 163

Query: 156 STAWHENPNQQNVWNFFSQEYNFVKPKCGFVEWLGQTYERE 196
           ++AWH +P QQ +W+ F+Q++NFVKPKCGFVEW+ Q YERE
Sbjct: 164 ASAWHSHPEQQGIWDTFAQQFNFVKPKCGFVEWVDQRYERE 204

>TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.121
           YCR040W MATalpha1 gene at MAT locus
          Length = 195

 Score =  131 bits (329), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 124/198 (62%), Gaps = 24/198 (12%)

Query: 9   TKKALFKVNL--KLNKNIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPTTLLYNI 66
           +K+ LFKV+L  K  ++I++KT+  +++ K   +      + +N  +KIP+PPT LL +I
Sbjct: 8   SKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQ---FIAENFKLKIPYPPTCLLRSI 64

Query: 67  EVEKQKI-----ISTQHMLNEYTMD---NDDNYLSDLFYEDEYNDNNSLFDNGFXXXXXX 118
           + E ++I     I  Q + + + ++   ++DN LSD    D+ ND+ +  +         
Sbjct: 65  DAELRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSD----DDINDDIAYIN-------YS 113

Query: 119 XXXXXXXERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNF 178
                  ++ LN FIAFRAYN+QFG GL Q++LS LLS AWH  P Q +VW+ F+Q++NF
Sbjct: 114 SEEELLFKKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNF 173

Query: 179 VKPKCGFVEWLGQTYERE 196
           VKPKCGFVEW+GQTYERE
Sbjct: 174 VKPKCGFVEWVGQTYERE 191

>TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenced
           copy of alpha1 at HMLalpha locus
          Length = 195

 Score =  131 bits (329), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 124/198 (62%), Gaps = 24/198 (12%)

Query: 9   TKKALFKVNL--KLNKNIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPTTLLYNI 66
           +K+ LFKV+L  K  ++I++KT+  +++ K   +      + +N  +KIP+PPT LL +I
Sbjct: 8   SKQPLFKVSLNKKRIRSIKIKTHKNNVQLKKQRSHQ---FIAENFKLKIPYPPTCLLRSI 64

Query: 67  EVEKQKI-----ISTQHMLNEYTMD---NDDNYLSDLFYEDEYNDNNSLFDNGFXXXXXX 118
           + E ++I     I  Q + + + ++   ++DN LSD    D+ ND+ +  +         
Sbjct: 65  DAELRRIEIKKSIVAQDVNSLFNVELTWDEDNVLSD----DDINDDIAYIN-------YS 113

Query: 119 XXXXXXXERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNF 178
                  ++ LN FIAFRAYN+QFG GL Q++LS LLS AWH  P Q +VW+ F+Q++NF
Sbjct: 114 SEEELLFKKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNF 173

Query: 179 VKPKCGFVEWLGQTYERE 196
           VKPKCGFVEW+GQTYERE
Sbjct: 174 VKPKCGFVEWVGQTYERE 191

>Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W
           (REAL)
          Length = 156

 Score = 93.6 bits (231), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 62/190 (32%), Positives = 93/190 (48%), Gaps = 48/190 (25%)

Query: 9   TKKALFKVNLKLNKNIRMKTNSKSMR----NKFNETRGISILLYKNHNIKIPFPPTTLLY 64
           T K  F++N K++K+ R    SK ++     K  +    +++     +I+IP P +  L 
Sbjct: 3   TSKPAFRINNKISKSHRNPVVSKKIKERRITKHVKPNCFNVIRPLKKDIQIPIPSSRFLK 62

Query: 65  NIEVEKQKIIST-QHM----LNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFXXXXXXX 119
            I++ +  I S  QH+    LN+ ++ +   YL                           
Sbjct: 63  KIQIHR--IASGNQHIQCRQLNKTSIKSTKKYL--------------------------- 93

Query: 120 XXXXXXERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFV 179
                     N F+AFRAY SQFG G+KQNILSSLLS  WH +  Q  +W++F+Q+YNF+
Sbjct: 94  ----------NSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKTQHGIWDYFAQQYNFI 143

Query: 180 KPKCGFVEWL 189
            P  GFVEWL
Sbjct: 144 NPGFGFVEWL 153

>Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W
           (REAL)
          Length = 175

 Score = 92.0 bits (227), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 40/68 (58%), Positives = 51/68 (75%)

Query: 126 ERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGF 185
           ++ LN F+AFRAY SQFG G+KQNILSSLLS  WH +  Q  +W++F+Q+YNF+ P  GF
Sbjct: 90  KKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGF 149

Query: 186 VEWLGQTY 193
           VEWL   Y
Sbjct: 150 VEWLTNNY 157

>YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}
           MATALPHA1Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression;
           targets the transcription factor Mcm1p to the promoters
           of alpha-specific genes; one of two genes encoded by the
           MATalpha mating type cassette
          Length = 175

 Score = 90.9 bits (224), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 89/189 (47%), Gaps = 38/189 (20%)

Query: 9   TKKALFKVNLKLNKNIRMKTNSKSMRNK----FNETRGISILLYKNHNIKIPFPPTTLLY 64
           T K  FK+  K +K+ R    SK ++ K           +I+     +I+IP P +  L 
Sbjct: 3   TSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFLN 62

Query: 65  NIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFXXXXXXXXXXXX 124
            I++ +   I++     ++   N  +  S                               
Sbjct: 63  KIQIHR---IASGSQNTQFRQFNKTSIKSS------------------------------ 89

Query: 125 XERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCG 184
            ++ LN F+AFRAY SQFG G+KQN+LSSLL+  WH +  Q  +W++F+Q+YNF+ P  G
Sbjct: 90  -KKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFG 148

Query: 185 FVEWLGQTY 193
           FVEWL   Y
Sbjct: 149 FVEWLTNNY 157

>YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}
           HMLALPHA1Silenced copy of ALPHA1 at HML, encoding a
           transcriptional coactivator involved in the regulation
           of mating-type alpha-specific gene expression
          Length = 175

 Score = 90.9 bits (224), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/189 (30%), Positives = 89/189 (47%), Gaps = 38/189 (20%)

Query: 9   TKKALFKVNLKLNKNIRMKTNSKSMRNK----FNETRGISILLYKNHNIKIPFPPTTLLY 64
           T K  FK+  K +K+ R    SK ++ K           +I+     +I+IP P +  L 
Sbjct: 3   TSKPAFKIKNKASKSYRNTAVSKKLKEKRLAEHVRPSCFNIIRPLKKDIQIPVPSSRFLN 62

Query: 65  NIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFXXXXXXXXXXXX 124
            I++ +   I++     ++   N  +  S                               
Sbjct: 63  KIQIHR---IASGSQNTQFRQFNKTSIKSS------------------------------ 89

Query: 125 XERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCG 184
            ++ LN F+AFRAY SQFG G+KQN+LSSLL+  WH +  Q  +W++F+Q+YNF+ P  G
Sbjct: 90  -KKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGFG 148

Query: 185 FVEWLGQTY 193
           FVEWL   Y
Sbjct: 149 FVEWLTNNY 157

>Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W
           (REAL)
          Length = 155

 Score = 89.7 bits (221), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (78%)

Query: 129 LNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFVEW 188
           +N F+AFRAY SQFG G+KQNILSSLLS  WH +  Q  +W++F+Q+YNF+ P  GFVEW
Sbjct: 92  INSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVEW 151

Query: 189 L 189
           L
Sbjct: 152 L 152

>Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W
           (REAL)
          Length = 174

 Score = 90.1 bits (222), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%)

Query: 129 LNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFVEW 188
           +N F+AFRAY SQFG G+KQNILSSLLS  WH +  Q  +W++F+Q+YNF+ P  GFVEW
Sbjct: 92  INSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVEW 151

Query: 189 LGQTY 193
           L   Y
Sbjct: 152 LTNNY 156

>CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 mating type regulatory
           protein or uniprot|P01365 Saccharomyces cerevisiae
           YCL066w HMLALPHA1
          Length = 184

 Score = 89.4 bits (220), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 80/149 (53%), Gaps = 12/149 (8%)

Query: 42  GISILLYKNHNIKIPFPPTTLLYNIEVEKQKIIST-QHMLNEYTMDNDDNYLSDLFYEDE 100
           G+++LL K +  +IP P   LL  I  E+ K+ S+ +  +N   +D + ++  D F    
Sbjct: 39  GLNMLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGIN--IIDIETSWEIDKFISHH 96

Query: 101 YNDNNSLFDNGFXXXXXXXXXXXXXERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWH 160
           +N +                     +R +N F+AFR Y +Q G GLKQN LS +LS AW+
Sbjct: 97  FNTS---------IGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWN 147

Query: 161 ENPNQQNVWNFFSQEYNFVKPKCGFVEWL 189
                QN+W+ F+Q++NF  P+CGFV ++
Sbjct: 148 APETDQNIWDIFAQQFNFASPRCGFVNYI 176

>CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 expressed copy at MAT locus
           or uniprot|P01365 Saccharomyces cerevisiae YCL066w
           HMLALPHA1 silenced copy at HML
          Length = 143

 Score = 85.1 bits (209), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 77/146 (52%), Gaps = 12/146 (8%)

Query: 45  ILLYKNHNIKIPFPPTTLLYNIEVEKQKIIST-QHMLNEYTMDNDDNYLSDLFYEDEYND 103
           +LL K +  +IP P   LL  I  E+ K+ S+ +  +N   +D + ++  D F    +N 
Sbjct: 1   MLLTKPNKFQIPPPHPVLLKRIREERMKLTSSFESGIN--IIDIETSWEIDKFISHHFNT 58

Query: 104 NNSLFDNGFXXXXXXXXXXXXXERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENP 163
           +                     +R +N F+AFR Y +Q G GLKQN LS +LS AW+   
Sbjct: 59  S---------IGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNAPE 109

Query: 164 NQQNVWNFFSQEYNFVKPKCGFVEWL 189
             QN+W+ F+Q++NF  P+CGFV ++
Sbjct: 110 TDQNIWDIFAQQFNFASPRCGFVNYI 135

>Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)
          Length = 145

 Score = 79.0 bits (193), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 33/56 (58%), Positives = 44/56 (78%)

Query: 126 ERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKP 181
           ++ LN F+AFRAY SQFG G+KQNILSSLLS  WH +  Q  +W++F+Q+YNF+ P
Sbjct: 90  KKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINP 145

>KLTH0F00374g Chr6 complement(30927..31676) [750 bp, 249 aa] {ON}
           weakly similar to uniprot|P01365 Saccharomyces
           cerevisiae YCR040W MATALPHA1 Transcriptional
           co-activator involved in regulation of
           mating-type-specific gene expression targets the
           transcription factor Mcm1p to the promoters of
           alpha-specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 249

 Score = 62.0 bits (149), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 89/194 (45%), Gaps = 33/194 (17%)

Query: 6   MNHTKKALFKVNLKLNK---NIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPTTL 62
           MN TK + FKV +K      N R+K +SKS R       G ++ +  +    IP PP TL
Sbjct: 1   MNSTKPS-FKVLIKKKGKTLNRRLKNSSKSYRE-----NGANLYMSYSKPQAIPKPPNTL 54

Query: 63  LYNIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFXXXXXXXXXX 122
           +  +  +K    S + + N+Y +   D     ++       NN++               
Sbjct: 55  INLVRSKKTSQSSRKCLKNDYILKELDVKKLSIY------SNNTVL-------------- 94

Query: 123 XXXERVLNGFIAFRAYNSQFGYG-LKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKP 181
              ++ +N FI FR+Y ++F  G ++Q  LS +LS  W +N    +VW FF+Q YN    
Sbjct: 95  ---KKKINPFIGFRSYYAKFAKGRVRQQELSKILSEYWTKNSKIHSVWEFFTQHYNREVT 151

Query: 182 KCGFVEWLGQTYER 195
              F  WL + Y++
Sbjct: 152 SMCFTLWLEENYQQ 165

>Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to
           Saccharomyces cerevisiae YCL066W HMLALPHA1
          Length = 263

 Score = 62.4 bits (150), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 129 LNGFIAFRAYNSQFGYGLKQNI-LSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFVE 187
           +N F+AFR+Y S+F  G+   + LS +L+  WHE P  +  W  F++ YN  +P   F E
Sbjct: 113 INEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPE 172

Query: 188 WLGQTY 193
           WL +TY
Sbjct: 173 WLEKTY 178

>Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON}
           similar to YCL066W HMLALPHA1
          Length = 263

 Score = 62.4 bits (150), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 129 LNGFIAFRAYNSQFGYGLKQNI-LSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFVE 187
           +N F+AFR+Y S+F  G+   + LS +L+  WHE P  +  W  F++ YN  +P   F E
Sbjct: 113 INEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQSFPE 172

Query: 188 WLGQTY 193
           WL +TY
Sbjct: 173 WLEKTY 178

>NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1
          Length = 150

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 81/190 (42%), Gaps = 41/190 (21%)

Query: 1   MSNKTMNHTKKALFKVNLKLNKNIRMKTNSKSMRNK-FNETRGISILLYKNHNIKIPFPP 59
           MS+    +  K LFKVN+   + +R + + + ++ K        +I L    NI IP PP
Sbjct: 1   MSSTIYCNQNKPLFKVNIP--RRVRNRNSKQPLKPKPVTYDTCFNIFLKDPKNITIPQPP 58

Query: 60  TTLLYNIEVEKQKIISTQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFXXXXXXX 119
             +L  +E  +    S Q       + ++ +                             
Sbjct: 59  NWVLQELETIRIIYPSKQKPKPRKQVTSNPS----------------------------- 89

Query: 120 XXXXXXERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFV 179
                  + +NGFI FR+Y S++GYG+KQ +LS LL+  W  +   Q +W++F+ +Y+ V
Sbjct: 90  -------KPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFALQYSTV 142

Query: 180 KPKCGFVEWL 189
              C    W+
Sbjct: 143 --GCEMGVWV 150

>KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON}
           Anc_1.1 YCL066W silent copy of mating type alpha1 gene
           at HML locus
          Length = 145

 Score = 57.0 bits (136), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (68%)

Query: 129 LNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEY 176
           LN FIAFRAY SQF  G+ QN LSS+LS  W  N +QQ  W+  +++Y
Sbjct: 92  LNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139

>KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON}
           mating type gene MATalpha1
          Length = 172

 Score = 52.4 bits (124), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 33/49 (67%)

Query: 127 RVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQE 175
           R LN F+AFR+Y SQ+  GLKQ  LS +L+ AWH +  +QN W   +Q+
Sbjct: 119 RNLNPFMAFRSYYSQYAQGLKQIELSEVLAKAWHSDTKEQNYWISLTQK 167

>Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {OFF} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 80/183 (43%), Gaps = 28/183 (15%)

Query: 16  VNLKLNKNIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPTTLLYNIEVEKQKIIS 75
           VN +    ++ K + KS++  +  + G+++ +  +    IP PP  ++        KI+ 
Sbjct: 12  VNKRHGAKLKPKISKKSLKRNYV-SEGVNLYMSYSKQELIPKPPKAVM--------KILG 62

Query: 76  TQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFXXXXXXXXXXXXXERVLNGFIAF 135
           + H             LS   ++D+   + +   +G              ++ +N FI F
Sbjct: 63  SDHG------KGLSKGLSKGIHKDQ--KSQTFLGSG----------KCTSKKKINPFIGF 104

Query: 136 RAYNSQFGYG-LKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFVEWLGQTYE 194
           R+Y ++   G ++Q  LS++LS  W  +      W FF++ YN       F EWL + Y+
Sbjct: 105 RSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYK 164

Query: 195 REM 197
            E+
Sbjct: 165 PEI 167

>Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF}
           YCR040W (MATALPHA1) - transcription factor involved in
           the regulation of alpha-specific genes [contig 123] FULL
          Length = 244

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 80/183 (43%), Gaps = 28/183 (15%)

Query: 16  VNLKLNKNIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPTTLLYNIEVEKQKIIS 75
           VN +    ++ K + KS++  +  + G+++ +  +    IP PP  ++        KI+ 
Sbjct: 12  VNKRHGAKLKPKISKKSLKRNYV-SEGVNLYMSYSKQELIPKPPKAVM--------KILG 62

Query: 76  TQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFXXXXXXXXXXXXXERVLNGFIAF 135
           + H             LS   ++D+   + +   +G              ++ +N FI F
Sbjct: 63  SDHG------KGLSKGLSKGIHKDQ--KSQTFLGSG----------KCTSKKKINPFIGF 104

Query: 136 RAYNSQFGYG-LKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFVEWLGQTYE 194
           R+Y ++   G ++Q  LS++LS  W  +      W FF++ YN       F EWL + Y+
Sbjct: 105 RSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYK 164

Query: 195 REM 197
            E+
Sbjct: 165 PEI 167

>Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {ON} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 80/183 (43%), Gaps = 28/183 (15%)

Query: 16  VNLKLNKNIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPTTLLYNIEVEKQKIIS 75
           VN +    ++ K + KS++  +  + G+++ +  +    IP PP  ++        KI+ 
Sbjct: 12  VNKRHGAKLKPKISKKSLKRNYV-SEGVNLYMSYSKQELIPKPPKAVM--------KILG 62

Query: 76  TQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFXXXXXXXXXXXXXERVLNGFIAF 135
           + H             LS   ++D+   + +   +G              ++ +N FI F
Sbjct: 63  SDHG------KGLSKGLSKGIHKDQ--KSQTFLGSG----------KCTSKKKINPFIGF 104

Query: 136 RAYNSQFGYG-LKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFVEWLGQTYE 194
           R+Y ++   G ++Q  LS++LS  W  +      W FF++ YN       F EWL + Y+
Sbjct: 105 RSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYK 164

Query: 195 REM 197
            E+
Sbjct: 165 PEI 167

>Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]
           {ON} ANNOTATED BY YGOB - This is Kwal_33.12992
          Length = 244

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 80/183 (43%), Gaps = 28/183 (15%)

Query: 16  VNLKLNKNIRMKTNSKSMRNKFNETRGISILLYKNHNIKIPFPPTTLLYNIEVEKQKIIS 75
           VN +    ++ K + KS++  +  + G+++ +  +    IP PP  ++        KI+ 
Sbjct: 12  VNKRHGAKLKPKISKKSLKRNYV-SEGVNLYMSYSKQELIPKPPKAVM--------KILG 62

Query: 76  TQHMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFXXXXXXXXXXXXXERVLNGFIAF 135
           + H             LS   ++D+   + +   +G              ++ +N FI F
Sbjct: 63  SDHG------KGLSKGLSKGIHKDQ--KSQTFLGSG----------KCTSKKKINPFIGF 104

Query: 136 RAYNSQFGYG-LKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFVEWLGQTYE 194
           R+Y ++   G ++Q  LS++LS  W  +      W FF++ YN       F EWL + Y+
Sbjct: 105 RSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTVMCFTEWLEKNYK 164

Query: 195 REM 197
            E+
Sbjct: 165 PEI 167

>KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}
           uniprot|Q08398 Kluyveromyces lactis HMLAPLHA1 Mating-
           type protein ALPHA1
          Length = 261

 Score = 43.9 bits (102), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 72/177 (40%), Gaps = 29/177 (16%)

Query: 19  KLNKNIRMKTNSK-SMRNKFNETRGISILLYKNHNIKIPFPPTTLLYNIEVEKQKIISTQ 77
           K +K IR     K S+ +++ +  G+++ + K     IP PP  L+  I+ EK K ++  
Sbjct: 22  KTSKKIRSGMIRKPSVSSRYRKHEGVNLYMSKVTPTSIPAPPQVLVAYIK-EKVKTLNKS 80

Query: 78  HMLNEYTMDNDDNYLSDLFYEDEYNDNNSLFDNGFXXXXXXXXXXXXXERVLNGFIAFRA 137
            +L       + N LS                                ++ +N FIAFR+
Sbjct: 81  EVLMSL---GNSNQLSS-----------------------RDVKTKTKKKQINDFIAFRS 114

Query: 138 YNSQFGYG-LKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFVEWLGQTY 193
           Y S+   G L Q  LS+++S  W  +   +  W   +QEYN       F  WL   Y
Sbjct: 115 YYSRLLNGILTQTELSTIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNY 171

>NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON}
           Anc_1.1  silent copy of MATalpha1 gene at HMLalpha
           possible pseudogene; contains 2 copies of a 20 bp direct
           repeat, causing a frameshft; synthetic translation made
           by ignoring one copy.
          Length = 135

 Score = 38.9 bits (89), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 41/61 (67%)

Query: 127 RVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVWNFFSQEYNFVKPKCGFV 186
           + +NGF+ FR+Y SQ+G GLKQ++LS LLS  W+ +   Q +W+ F+Q+ N +  + G  
Sbjct: 61  KSINGFMLFRSYYSQYGKGLKQSLLSPLLSKLWNAHETDQLLWDQFAQQCNAIGHEGGIC 120

Query: 187 E 187
           E
Sbjct: 121 E 121

>Smik_88.1 Chr88 complement(3..72,501..535) [105 bp, 35 aa] {ON}
           YCL066W (REAL)
          Length = 35

 Score = 32.7 bits (73), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 12/18 (66%), Positives = 14/18 (77%)

Query: 172 FSQEYNFVKPKCGFVEWL 189
           F Q+YNF+ P  GFVEWL
Sbjct: 15  FPQQYNFINPGFGFVEWL 32

>Smik_3.144 Chr3 (198300..198334,198763..198892) [165 bp, 54 aa]
           {ON} YCR040W (REAL)
          Length = 54

 Score = 33.1 bits (74), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 15/24 (62%)

Query: 172 FSQEYNFVKPKCGFVEWLGQTYER 195
           F Q+YNF+ P  GFVEWL   Y  
Sbjct: 15  FPQQYNFINPGFGFVEWLTNNYAE 38

>Skud_80.1 Chr80 complement(3..98) [96 bp, 32 aa] {ON} YCR040W
           (REAL)
          Length = 32

 Score = 32.3 bits (72), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 12/18 (66%), Positives = 14/18 (77%)

Query: 172 FSQEYNFVKPKCGFVEWL 189
           F Q+YNF+ P  GFVEWL
Sbjct: 12  FPQQYNFINPGFGFVEWL 29

>Suva_3.79 Chr3 (114117..114221) [105 bp, 35 aa] {ON} YCR040W (REAL)
          Length = 35

 Score = 31.2 bits (69), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 11/17 (64%), Positives = 14/17 (82%)

Query: 173 SQEYNFVKPKCGFVEWL 189
           +Q+YNF+ P  GFVEWL
Sbjct: 16  AQQYNFINPGFGFVEWL 32

>Suva_3.140 Chr3 (212396..212488) [93 bp, 31 aa] {ON} YCR040W (REAL)
          Length = 31

 Score = 30.0 bits (66), Expect = 0.36,   Method: Composition-based stats.
 Identities = 12/20 (60%), Positives = 14/20 (70%)

Query: 174 QEYNFVKPKCGFVEWLGQTY 193
           Q+YNF+ P  GFVEWL   Y
Sbjct: 1   QQYNFINPGFGFVEWLTNNY 20

>Suva_14.208 Chr14 (375224..375679) [456 bp, 151 aa] {ON} YNL131W
           (REAL)
          Length = 151

 Score = 31.6 bits (70), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 4/48 (8%)

Query: 66  IEVEKQKIISTQHMLNEYTMDNDD----NYLSDLFYEDEYNDNNSLFD 109
           ++VE+ +    Q ++ E T  NDD       SD  +EDE+++N +LFD
Sbjct: 12  VQVEEPQFGENQAIIEEKTAQNDDVVDDEAESDSDFEDEFDENETLFD 59

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,798,765
Number of extensions: 1087073
Number of successful extensions: 4582
Number of sequences better than 10.0: 70
Number of HSP's gapped: 4656
Number of HSP's successfully gapped: 70
Length of query: 201
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 97
Effective length of database: 41,556,135
Effective search space: 4030945095
Effective search space used: 4030945095
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)