Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A075801.4ON51351321680.0
YCL063W (VAC17)1.4ON4231622619e-24
Suva_3.1511.4ON4211612611e-23
Skud_3.21.4ON4261612601e-23
Smik_3.131.4ON4251562602e-23
TDEL0C069801.4ON4263072583e-23
SAKL0C00440g1.4ON4623272362e-20
ZYRO0F18502g1.4ON4501612033e-16
NDAI0A001301.4ON4781582016e-16
KNAG0C001901.4ON4421621998e-16
NCAS0B091201.4ON4334771962e-15
CAGL0B00308g1.4ON4301611935e-15
TPHA0E040201.4ON5401261892e-14
Kpol_2002.71.4ON4741651856e-14
Kwal_33.130031.4ON4491481000.001
KAFR0D001201.4ON399153980.002
KLTH0F00462g1.4ON451182860.062
Ecym_10071.4ON462170860.063
KLLA0C00462g1.4ON460110820.20
SAKL0B08712gsingletonON72160714.4
Skud_14.631.66ON108057706.1
KAFR0C047406.363ON66559706.3
NOTE: 1 genes in the same pillar as TBLA0A07580 were not hit in these BLAST results
LIST: AFR746C

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07580
         (513 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...   839   0.0  
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...   105   9e-24
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...   105   1e-23
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)      104   1e-23
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)   104   2e-23
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...   103   3e-23
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...    96   2e-20
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...    83   3e-16
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...    82   6e-16
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...    81   8e-16
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...    80   2e-15
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...    79   5e-15
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...    77   2e-14
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....    76   6e-14
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...    43   0.001
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...    42   0.002
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...    38   0.062
Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to ...    38   0.063
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...    36   0.20 
SAKL0B08712g Chr2 (741051..743216) [2166 bp, 721 aa] {ON} conser...    32   4.4  
Skud_14.63 Chr14 (101862..105104) [3243 bp, 1080 aa] {ON} YNL278...    32   6.1  
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    32   6.3  

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/513 (83%), Positives = 428/513 (83%)

Query: 1   MALQEEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMFQL 60
           MALQEEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMFQL
Sbjct: 1   MALQEEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMFQL 60

Query: 61  NSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQE 120
           NSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQE
Sbjct: 61  NSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQE 120

Query: 121 NVTNGXXXXXXXXXXXXXXXXXITDGFQPRPLKILQRQKHNNNQNTHPQPDLESPLKLKH 180
           NVTNG                 ITDGFQPRPLKILQRQKHNNNQNTHPQPDLESPLKLKH
Sbjct: 121 NVTNGSSPLSNKSSHSNDSLSKITDGFQPRPLKILQRQKHNNNQNTHPQPDLESPLKLKH 180

Query: 181 RXXXXXXXXXXXXXXXPYXXXXXXXXXXXELLSDISPVKIQSFEEPTFSVANTRNKNSMD 240
           R               PY           ELLSDISPVKIQSFEEPTFSVANTRNKNSMD
Sbjct: 181 RSSYNKLLSSNKKESKPYKNFNSKKSKNNELLSDISPVKIQSFEEPTFSVANTRNKNSMD 240

Query: 241 PLHYSLFKTNNRLSIQFPXXXXXXXXXXXPTCISDQDTIFVSTPKIASSIKNTSEPLRKF 300
           PLHYSLFKTNNRLSIQFP           PTCISDQDTIFVSTPKIASSIKNTSEPLRKF
Sbjct: 241 PLHYSLFKTNNRLSIQFPDGYDNDDEYDDPTCISDQDTIFVSTPKIASSIKNTSEPLRKF 300

Query: 301 NSHESILSVEKSNMKFIQXXXXXXXXXXXXXXXXXXXXRXXXXXXXXXXXLTYNPMISKL 360
           NSHESILSVEKSNMKFIQ                    R           LTYNPMISKL
Sbjct: 301 NSHESILSVEKSNMKFIQPLPALKPPSSLLNLTLKKNLRSVSSVSSNNVSLTYNPMISKL 360

Query: 361 NTTTIIPSEHTRNQMRVNSVDLLNLYVQQPTPKKLKTESQSPNPPSTDTLPSSNKESSVF 420
           NTTTIIPSEHTRNQMRVNSVDLLNLYVQQPTPKKLKTESQSPNPPSTDTLPSSNKESSVF
Sbjct: 361 NTTTIIPSEHTRNQMRVNSVDLLNLYVQQPTPKKLKTESQSPNPPSTDTLPSSNKESSVF 420

Query: 421 SNWNILNLISTPRLSISSSVTNTQAASTKAPKPIKNKPNYGDLLNHSNEFHYEPPLHYQS 480
           SNWNILNLISTPRLSISSSVTNTQAASTKAPKPIKNKPNYGDLLNHSNEFHYEPPLHYQS
Sbjct: 421 SNWNILNLISTPRLSISSSVTNTQAASTKAPKPIKNKPNYGDLLNHSNEFHYEPPLHYQS 480

Query: 481 NLQTHNQNTDAAVISRGISVSDLEHALNTNLKL 513
           NLQTHNQNTDAAVISRGISVSDLEHALNTNLKL
Sbjct: 481 NLQTHNQNTDAAVISRGISVSDLEHALNTNLKL 513

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score =  105 bits (261), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 61/162 (37%), Positives = 92/162 (56%), Gaps = 21/162 (12%)

Query: 1   MALQ--EEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTS-ESLEQAERDYNRYM 57
           MA Q  E+++ RLL ++QEA+LQLDLWI+ QQ    R  +  +T  ESL++  + YN+YM
Sbjct: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQ----RSSICQTTDQESLDKLSQQYNQYM 56

Query: 58  FQLNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSA 117
            QLNSLY+R++ +RDK+ K+    L   D      N H  ++ LV EF  +++++NEL+ 
Sbjct: 57  SQLNSLYVRSESVRDKLSKEQQRRLITED------NEHQRIEDLVREFQDITLRLNELAT 110

Query: 118 IQENVTNGXXXXXXXXXXXXXXXXXITDGFQPRPLKILQRQK 159
           +     N                      FQPRPLKI++RQ+
Sbjct: 111 VPNEAPNDSPQSQSTRSSL--------GSFQPRPLKIIERQR 144

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score =  105 bits (261), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 92/161 (57%), Gaps = 19/161 (11%)

Query: 1   MALQ--EEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMF 58
           MA Q  E+++ RLLT+++EA+LQLDLWI+ QQ          S  +SL++  + YN+YM 
Sbjct: 1   MATQALEDITERLLTRSEEAILQLDLWIQRQQ---RSSVCEPSDRDSLDKLSQQYNQYMS 57

Query: 59  QLNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAI 118
           QLNSLY+R++ +RDK+ K+    L        + N H  ++ LV EF  +++++N+L+ +
Sbjct: 58  QLNSLYVRSESVRDKLSKEQWRRL------NTEENEHKRIEDLVHEFQDITVRLNDLATV 111

Query: 119 QENVTNGXXXXXXXXXXXXXXXXXITDGFQPRPLKILQRQK 159
               +N                    D FQPRPLKI++RQ+
Sbjct: 112 PNKASNDSPQSQSTRSS--------LDSFQPRPLKIIERQR 144

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score =  104 bits (260), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 91/161 (56%), Gaps = 19/161 (11%)

Query: 1   MALQ--EEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMF 58
           MA Q  E+++ RLL ++QEA+LQLDLWI+ QQ        + S  ESL++  + YN+YM 
Sbjct: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQ---RSSVCQTSDQESLDKLSQQYNQYMS 57

Query: 59  QLNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAI 118
           QLNSLY+R++ +RDK+ K+    L   D      N H  ++ LV EF  ++ ++NEL+ +
Sbjct: 58  QLNSLYVRSESVRDKLSKEQQRRLITED------NEHQRIEDLVHEFQDITSRLNELATV 111

Query: 119 QENVTNGXXXXXXXXXXXXXXXXXITDGFQPRPLKILQRQK 159
              V+N                      FQPRPLKI++RQ+
Sbjct: 112 PHGVSNDSPQSQSTRSSSGS--------FQPRPLKIIERQR 144

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score =  104 bits (260), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 89/156 (57%), Gaps = 19/156 (12%)

Query: 5   EEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTS-ESLEQAERDYNRYMFQLNSL 63
           E+++ RLL ++QEA+LQLDLWI+ QQ    R  +  +T  E L++  + YN+YM QLNSL
Sbjct: 7   EDITERLLIRSQEAILQLDLWIQRQQ----RSSVCQTTDQELLDKVSKQYNQYMSQLNSL 62

Query: 64  YLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQENVT 123
           Y+R++ +RDK+ K+    L   D      N H  ++ LV EF  +++++NEL+     V 
Sbjct: 63  YVRSESVRDKLSKEQQRRLITED------NEHQRIEDLVREFQDITLRLNELATAPNEVA 116

Query: 124 NGXXXXXXXXXXXXXXXXXITDGFQPRPLKILQRQK 159
           N                    + FQPRPLKI++RQ+
Sbjct: 117 NDSPQSQSTRSSL--------ESFQPRPLKIIERQR 144

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score =  103 bits (258), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 91/307 (29%), Positives = 133/307 (43%), Gaps = 39/307 (12%)

Query: 5   EEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMFQLNSLY 64
           E++S RLLT++QEA+LQL+LWI+ QQ       LR     S+++    YN Y+ QLNSL 
Sbjct: 4   EDLSERLLTRSQEAILQLELWIQRQQH------LRELEDSSIDKLGNQYNVYIAQLNSLC 57

Query: 65  LRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQENVTN 124
           +R++Y+RDK+ K+    ++         N   Y++ LV EF  +++K+NEL+  Q     
Sbjct: 58  VRSEYVRDKLNKERERRMS-------IINDRKYIEDLVFEFQDITVKLNELAQSQ----- 105

Query: 125 GXXXXXXXXXXXXXXXXXITDGFQPRPLKILQRQKHNNNQNTHPQPDLESPLKLKHRXXX 184
                                 FQPRPLK+ +R  H  N         ESPLK K     
Sbjct: 106 -----SIDSTPSSKSTRSSLGSFQPRPLKLTER--HGPNVKAL----RESPLKNKSVIKS 154

Query: 185 XXXXXXXXXXXXPYXXXXXXXXXXXELLSDISPVKIQSFEEPTFSVANT-RNKNSMDPLH 243
                                     +      +++    +   +  NT ++K S D   
Sbjct: 155 VKFSGLHDSKEEAVSKCLSLPGSPVRVTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDV 214

Query: 244 YSLFKTNNRLSIQFPXXXXXXXXXXXPTCISDQDTIFVSTPKIASSIKNTSEPLRKFNSH 303
            S+F+ N RLSI                  SDQDT+    P    +      PLR+FNSH
Sbjct: 215 PSIFRENQRLSI-----TVFDDFDEDADSTSDQDTVISLVP----ADDGKGLPLRRFNSH 265

Query: 304 ESILSVE 310
           ESILS +
Sbjct: 266 ESILSTK 272

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 91/327 (27%), Positives = 140/327 (42%), Gaps = 74/327 (22%)

Query: 6   EVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAE-------RDYNRYMF 58
           E+S +LL ++QEA+LQLDL+I+ QQ        R    E+L+Q +       ++Y   + 
Sbjct: 6   EISQKLLVRSQEAILQLDLYIQRQQ--------RLYEYETLDQPDNGLLTKLQEYQTCLA 57

Query: 59  QLNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAI 118
           QLNSL++R++++RD+I   +     D D  G+          LVTEF  ++ K+NEL+A 
Sbjct: 58  QLNSLHIRSEHLRDRIASTDHRASQDGDSIGH----------LVTEFQKITTKLNELAAT 107

Query: 119 QENVTNGXXXXXXXXXXXXXXXXXITDGFQPRPLKILQRQKHNNNQNTHPQPDLESPLKL 178
           Q+                          F+P+PLKIL+R K            L+ P   
Sbjct: 108 QDRAYQSPGSQSTKS----------VSSFEPKPLKILERTK------------LQHPTSP 145

Query: 179 KHRXXXXXXXXXXXXXXXPYXXXXXXXXXXXEL-------LSDISPVKIQSFEEPTFSVA 231
             R               P+                    ++  SPV IQ    P  + +
Sbjct: 146 TKRVATPPKKIAPLRKNPPFDKKVMFSGHSKSTSLPGSPSMAASSPVSIQQERFPRHAKS 205

Query: 232 --------NTRNKNSMDPLHYSLFKTNNRLSIQFPXXXXXXXXXXXPTCISDQDTIFVST 283
                     R ++S + L++  FK N RLSI F                SD+DT+   +
Sbjct: 206 CDAGLNKQQRRRQDSDNRLNF--FKENQRLSISFFDDEIDYS--------SDEDTVISVS 255

Query: 284 PKIASSIKN--TSEPLRKFNSHESILS 308
           P   +S K    +EPLR++NSHES+LS
Sbjct: 256 PPETTSFKGFPKAEPLRRYNSHESVLS 282

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 81/161 (50%), Gaps = 33/161 (20%)

Query: 5   EEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERD-----YNRYMFQ 59
           +++S RL  ++QEAVLQL+LWI+ QQ            SE   +  RD     YN YM Q
Sbjct: 5   DDISERLFIRSQEAVLQLELWIRRQQHL----------SEIEHEHARDKIADQYNLYMAQ 54

Query: 60  LNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQ 119
           LNSL +R++Y+RDK+      N    +      N   Y++ LV EF  +++K+NEL+  Q
Sbjct: 55  LNSLCVRSEYVRDKL------NAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQNQ 108

Query: 120 -ENVTNGXXXXXXXXXXXXXXXXXITDGFQPRPLKILQRQK 159
            E VT                     + FQPRPLKI +R +
Sbjct: 109 KEQVTPSSKHSNGS-----------VNSFQPRPLKITERYR 138

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 10/71 (14%)

Query: 245 SLFKTNNRLSIQFPXXXXXXXXXXXPTCISDQDTIFVSTP-----KIASSIKNTSEPLRK 299
           S+FK N RLSI F                SDQ+T+  ++P      I   +++   PLR+
Sbjct: 223 SVFKENQRLSITFCDDIDEGSDSA-----SDQNTVISTSPIPPSHPIQYDVQSEKPPLRR 277

Query: 300 FNSHESILSVE 310
           +NSH+S+LS +
Sbjct: 278 YNSHDSVLSTK 288

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 88/158 (55%), Gaps = 14/158 (8%)

Query: 5   EEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAE-RDYNRYMFQLNSL 63
           ++++ RLL ++QEA+LQLDLWI+ ++  Q    L  S + + +  + + YN Y+ QLNSL
Sbjct: 6   QDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQLNSL 65

Query: 64  YLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQENVT 123
            +R QYIRDK      +N+   D   ++     Y++ LV EF  +++K+N+LS   +  +
Sbjct: 66  IVRVQYIRDKF----LHNINQLDSTQDE---QKYIENLVYEFKQITLKLNDLSKKNKTTS 118

Query: 124 NGXXXXXXXXXXXXXXXXXITDGFQPRPLKILQRQKHN 161
           +                    + F+P+PLKI++R K++
Sbjct: 119 SSENSSKTASSKSSM------ESFEPKPLKIIKRTKND 150

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 90/246 (36%), Gaps = 85/246 (34%)

Query: 296 PLRKFNSHESILSVEKSNMKFIQXXXXXXXXXXXXXXXXXXXXRXXXXXXXXXXXLTYN- 354
           PLR++NSHESILS + S+   I                                 LT+N 
Sbjct: 290 PLRRYNSHESILSQKISSTPLIDNNNN----------------------------LTFNS 321

Query: 355 --PMISKLNTTTIIPSEHT-------RNQMRVNSVDLLNLYVQQPTPK--------KLKT 397
             P+ S +   ++  S H        R+     S DLL+ +V    P+        + KT
Sbjct: 322 KLPLYSSIRRPSM-QSIHVTSNPIFARSSQGKTSKDLLSSFVTSSIPRNNNRNIQTRTKT 380

Query: 398 ESQSP-NPPSTDTLPSSNKESSVFSNWNILNLISTPRLSISSSVTNTQAASTKAPKPIKN 456
            +QS  N    D   +    SS F NWN LN     R ++ +S TNT     +       
Sbjct: 381 RTQSRRNNQLRDHTINQTSTSSFFGNWNFLN-----RFNMITSETNTTTNRKR------- 428

Query: 457 KPNYGDLLNHSNEFHYEPPLHYQSNLQTHNQNTDAA---------VISRGISVSDLEHAL 507
                         +Y  PL  QS  + HN + +           V    IS+ DLE AL
Sbjct: 429 --------------NYNIPLVNQS--RAHNIDVNDTMDSISIKEPVYDNTISLDDLEDAL 472

Query: 508 NTNLKL 513
           NT L L
Sbjct: 473 NTELLL 478

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score = 81.3 bits (199), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 86/162 (53%), Gaps = 18/162 (11%)

Query: 1   MALQEEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMFQL 60
           M   E+V+ RLL ++Q+A+LQL+LW++ Q+     D       +  E   +  N ++ QL
Sbjct: 1   MDCLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVD-RKKFEAIAQQRNLHLSQL 59

Query: 61  NSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQE 120
           NSL LR++YI++K+        ++ ++        +Y++ LV EF  +++ +NELS  + 
Sbjct: 60  NSLCLRSRYIKEKLA-------SERNICSIRKGRRSYIENLVYEFQDIAMSLNELS--ET 110

Query: 121 NVTNGXXXXXXXXXXXXXXXXXITDGFQPRPLKILQRQKHNN 162
           N  NG                  +D F+P+PL+IL+RQ+  N
Sbjct: 111 NRKNGSPVSQATTNS--------SDSFEPKPLRILERQRTCN 144

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%), Gaps = 2/38 (5%)

Query: 274 SDQDTIFVSTPKIASSIKNTSEPLRKFNSHESILSVEK 311
           SDQ+T+  ++P ++       EPLR++NSHESILSV K
Sbjct: 246 SDQETVMYNSPVVSKGA--AFEPLRRYNSHESILSVAK 281

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 110/477 (23%), Positives = 181/477 (37%), Gaps = 128/477 (26%)

Query: 1   MALQEEVSIRLLTKAQEAVLQLDLWIKDQQGFQ-----------------NRDGLRASTS 43
           M+L +++S RLL ++QEA+LQLD+WI+ Q+  Q                 N D +R +  
Sbjct: 1   MSLLQDISERLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMD-IRGTLP 59

Query: 44  ESLEQAERDYNRYMFQLNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDT-NSHAYVQQLV 102
           + LEQ    YN YM QLNSL +R ++IRD +  +    + +  +  N++ +   Y+Q LV
Sbjct: 60  QFLEQ----YNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLV 115

Query: 103 TEFYSLSIKMNELSAIQENVTNGXXXXXXXXXXXXXXXXXITDGFQPRPLKILQRQKHNN 162
            EF  ++ K++ELS ++                         + F+P+PL+I+ R   N 
Sbjct: 116 HEFQDITQKLSELSTVRN---------PSTASSRSTSTKSSIESFKPKPLRIISRS--NT 164

Query: 163 NQNTHPQPDLESPLKLKHRXXXXXXXXXXXXXXXPYXXXXXXXXXXXELLSDISPVKIQS 222
           + + H Q  L+  +                                           ++S
Sbjct: 165 HSHLHQQTSLDKKVSFNEDESNSSISHS---------------------------RSMES 197

Query: 223 FEEPTFSVANTRNKNSMDPLHYSLFKTNNRLSIQFPXXXXXXXXXXXPTCISDQD----- 277
             E + S+ NT+   SMD L  S FK ++  S                  I+++D     
Sbjct: 198 LHENSKSLRNTK---SMDVLKRSTFKNHSDFSKLLNSRQRLSINIFDDDLIANEDGNEFY 254

Query: 278 ----------TIFVSTPKIASSIKNTSEP-LRKFNSHESILSVEKSNMKFIQXXXXXXXX 326
                      I   TP     I+    P LR++NSHESILS                  
Sbjct: 255 NQYSDSDQATVISHGTP-----IRGADTPLLRRYNSHESILSF----------------- 292

Query: 327 XXXXXXXXXXXXRXXXXXXXXXXXLTYNPMISKLNTTTIIPSEHTRNQMRVN--SVDLLN 384
                       R           L Y+ +      +  + S    ++MR N  S DLL+
Sbjct: 293 ------------RKPTQSRQPNQILPYSSVRQPSMQSVAVNSNPIFSRMRPNATSKDLLS 340

Query: 385 LYVQQPTPKKLKTESQSPNPPSTDTLPSSNKESSVFSNWNILNLISTPRLSISSSVT 441
            ++ +P P +L  +   PN             +S+F  WN  N  ++    I ++ T
Sbjct: 341 SFINKPQPNRLHQQKPKPN------------SNSLFGKWNFFNKFNSVTSEIGTTTT 385

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score = 79.0 bits (193), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 90/161 (55%), Gaps = 19/161 (11%)

Query: 1   MALQEEVSIRLLTKAQEAVLQLDLWI----KDQQGFQNRDGLRASTSESLEQAERDYNRY 56
           MA  EE++ RLL ++ EA+ QLD WI    K++   +N+ GL     +S+E+ +  Y  +
Sbjct: 1   MASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGL-----DSIERLDDKYTEF 55

Query: 57  MFQLNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELS 116
           + +LNSLY+R+QYI+DKI  +     A +    ++ N+ + +Q+L+ EF  +++ +NE+ 
Sbjct: 56  LEKLNSLYIRSQYIKDKIRTEKN---AKATKRKSELNT-SRIQELMLEFKEITLSLNEI- 110

Query: 117 AIQENVTNGXXXXXXXXXXXXXXXXXITDGFQPRPLKILQR 157
           A Q++ TN                    + F P+PLKIL R
Sbjct: 111 AQQDDETNSKQLSPASTSTKSSL-----ESFTPKPLKILNR 146

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 40/78 (51%), Gaps = 7/78 (8%)

Query: 235 NKNSMDPLHYSLFKTNNRLSIQ-FPXXXXXXXXXXXPTCISDQDT-IFVSTPKIAS-SIK 291
           +KN +D      FK   RLS+  F                SD++T IF S+  I + +I 
Sbjct: 216 DKNQLD----KYFKDKQRLSLTLFGSADADDGESLNNNDYSDEETVIFTSSSNIETDAIT 271

Query: 292 NTSEPLRKFNSHESILSV 309
           +  +P+R+ NSHES+LSV
Sbjct: 272 DDMKPIRRCNSHESVLSV 289

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/126 (38%), Positives = 71/126 (56%), Gaps = 24/126 (19%)

Query: 5   EEVSIRLLTKAQEAVLQLDLWIKDQQGFQN--RDGLRASTS-------ESLEQAERDYNR 55
           EE+S +LL ++QEA+LQLDLWI  QQ   N  R G    T        E+L      Y+ 
Sbjct: 9   EELSEKLLIRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYDL 68

Query: 56  YMFQLNSLYLRAQYIRDKIEKQ----NAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIK 111
           YM QLNSLY+R+++IRDK+  +    N +NL            H  +++LV EF ++  K
Sbjct: 69  YMSQLNSLYVRSEFIRDKLNSEKNNVNKFNL-----------DHRNIEELVFEFQNIREK 117

Query: 112 MNELSA 117
           +N+L+A
Sbjct: 118 LNQLAA 123

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 84/165 (50%), Gaps = 15/165 (9%)

Query: 5   EEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMFQLNSLY 64
           +++S RLL ++QEA+LQLDLWI+ QQ +   D         LE+    YN YM QLNSLY
Sbjct: 7   DDLSERLLVRSQEAILQLDLWIQRQQQWAESDD--NHDENDLEKVTDTYNLYMSQLNSLY 64

Query: 65  LRAQYIRDKI---EKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQEN 121
           +R+Q +RDK+   +K     +     +  + N  + ++ L+ EF  ++ K+N L++ +  
Sbjct: 65  IRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLASSRRR 124

Query: 122 VTNGXXXXXXXXXXXXXXXXXITDGFQPRPLKI-LQRQKHNNNQN 165
            +                       FQP+PLKI L+R K    QN
Sbjct: 125 CS---------SSKSSSSRSSSIGSFQPKPLKISLKRNKSLKEQN 160

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 42/82 (51%), Gaps = 10/82 (12%)

Query: 236 KNSMDPLHYSLFKTNNRLSIQFPXXXXXXXXXXXPTCISDQDTIFVSTP-------KIAS 288
           K+ +D ++ S FK   RLSI               T ISDQ+T+  S+        +I  
Sbjct: 220 KSKIDSVYDSTFKNTQRLSISL---FDIDTNENDITNISDQETVISSSSLTMDEPLEIID 276

Query: 289 SIKNTSEPLRKFNSHESILSVE 310
             KN  +PLR++NSHESILS +
Sbjct: 277 DQKNNLKPLRRYNSHESILSTK 298

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 66/148 (44%), Gaps = 21/148 (14%)

Query: 12  LTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMFQLNSLYLRAQYIR 71
           L +++EA+++L+  +  Q+     +      SE        Y  Y+ QLN LY++AQ ++
Sbjct: 12  LERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQLNCLYIKAQSLK 71

Query: 72  DKIEKQNAYNLADSDVAGNDTNS-HAYVQQLVTEFYSLSIKMNELSAIQENVTNGXXXXX 130
           D +           +  G+  NS    +++L  ++ +L    NEL   ++N+ +      
Sbjct: 72  DMM----------GNRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNLEDSPSCLS 121

Query: 131 XXXXXXXXXXXXITDGFQPRPLKILQRQ 158
                           FQP+PLKI++R+
Sbjct: 122 PAS----------VSSFQPKPLKIIERR 139

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 68/153 (44%), Gaps = 40/153 (26%)

Query: 7   VSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMFQLNSLYLR 66
           VS  LL +++EAV QL+ W+K Q              E L Q   +Y     QLNSL  +
Sbjct: 5   VSDTLLQRSEEAVSQLESWLKQQ--------------EQLHQTTAEYK----QLNSLCAK 46

Query: 67  AQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQENVTNGX 126
           ++YI + ++  ++      D+      S   V+ L+ EF  +S K+NE+      VT+  
Sbjct: 47  SKYISNLLKDDSSS--IPHDLMEQKERSFI-VESLIHEFNEISTKLNEI------VTH-- 95

Query: 127 XXXXXXXXXXXXXXXXITDGFQPRPLKILQRQK 159
                             D F+P+PL +L++ K
Sbjct: 96  -----------TSPQSTIDSFEPKPLNLLRKNK 117

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 75/182 (41%), Gaps = 40/182 (21%)

Query: 5   EEVSIRLLTKAQEAVLQLDLWIKDQQ-----GFQNRDGLRASTSESLEQAERDYNRYMFQ 59
           +E++   L  +Q A+ +LD  ++ Q+     GF ++  L   +S ++ Q    Y  Y+ Q
Sbjct: 5   QEIAQESLALSQSALARLDSCLERQRRLYESGFPDQ-CLSDKSSTNMAQ----YYEYIGQ 59

Query: 60  LNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQ 119
           L SLY +AQ + D              V  +D+ S + VQQ   E       + E   I 
Sbjct: 60  LYSLYTKAQKLSDT-------------VILSDSKSLSSVQQRAIENL-----IQEFQEIA 101

Query: 120 ENVTNGXXXXXXXXXXXXXXXXXITDGFQPRPLKILQRQKHNNNQNTHPQPDLESPLKLK 179
           +N  N                   +  FQP+PLKILQR+          Q  LESP K  
Sbjct: 102 KNDENFISYSMRESPNSMSVQSICS--FQPKPLKILQRR----------QAQLESPTKRS 149

Query: 180 HR 181
            R
Sbjct: 150 FR 151

>Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to
           XP_452214  K. lactis KLLA0C00462g
          Length = 462

 Score = 37.7 bits (86), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 66/170 (38%), Gaps = 42/170 (24%)

Query: 10  RLLTKAQEAVLQLDLWIK----------DQQG------------FQNRDGLRASTSESLE 47
           RLLT+ QE+++ L+L I+          D  G            +  R  ++ S  +   
Sbjct: 10  RLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAVQQSCGDQRT 69

Query: 48  QAERDYNRYMFQLNSLYLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYS 107
           +  R Y   M  L SL +RAQ++ DK  K  +    D D           V++L +EF  
Sbjct: 70  EQMRRYQSSMAHLMSLSIRAQFLIDKFHKGGSGYQIDLDT----------VKKLGSEFED 119

Query: 108 LSIKMNELSAIQENVTNGXXXXXXXXXXXXXXXXXITDGFQPRPLKILQR 157
           +S   + L  ++ N                         FQ RPLK+LQR
Sbjct: 120 IS---HNLCFLEPN-------KVFDKNHTRFRSSEYPAPFQLRPLKLLQR 159

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 59/110 (53%), Gaps = 13/110 (11%)

Query: 7   VSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMFQLNSLYLR 66
           V+ RL+ +  EAV+QL+L I+ +           + S    Q + +Y  ++ +L+SL LR
Sbjct: 7   VAERLVIRCNEAVMQLELSIQRKMC-----EFDPNNSHCFIQVQ-EYYSFLARLSSLKLR 60

Query: 67  AQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELS 116
           A+++++ +  Q       +DV       +  +++L+ EF  +++ +NE++
Sbjct: 61  AEHVQESLRHQRK---DPNDVCIE----YETLEKLIYEFQDITMSLNEVA 103

>SAKL0B08712g Chr2 (741051..743216) [2166 bp, 721 aa] {ON} conserved
           hypothetical protein
          Length = 721

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 6/60 (10%)

Query: 411 PSSNKESSVFSNWNILNLISTPRLSISSSVTNTQA------ASTKAPKPIKNKPNYGDLL 464
           P ++  S+   +WNI++  S  R  I+SS++N  A      +ST+   P++NK    +LL
Sbjct: 64  PWNSSSSTEIEDWNIISTCSEFRAPINSSLSNGHALSVSPVSSTRLSSPVRNKNKLQNLL 123

>Skud_14.63 Chr14 (101862..105104) [3243 bp, 1080 aa] {ON} YNL278W
           (REAL)
          Length = 1080

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 30/57 (52%), Gaps = 10/57 (17%)

Query: 64  YLRAQYIRDKIEKQNAYN----LADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELS 116
           YLR Q  R  +  ++AYN       SD A N  + HA +Q    EF SL+ ++NEL 
Sbjct: 664 YLRFQ--RASVHSEDAYNSRKSFTTSDFADNSQDDHAVLQ----EFNSLTQRINELG 714

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 395 LKTESQSPNPPSTDTLPSSNKESSVFSNWNILNLISTPRLSISSSVTNTQAASTKAPKP 453
           L   +QS  P +T+T  S+ ++S+  S  N+    +TP +++++++T   A S   P+P
Sbjct: 94  LSQHAQSHVPSTTNTTTSAPQDSATMSTANVAT--ATPNVAVTANITGQAAGSASLPQP 150

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.126    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,404,127
Number of extensions: 1969538
Number of successful extensions: 8357
Number of sequences better than 10.0: 161
Number of HSP's gapped: 8715
Number of HSP's successfully gapped: 179
Length of query: 513
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 399
Effective length of database: 40,409,475
Effective search space: 16123380525
Effective search space used: 16123380525
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)