Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A075701.5ON1252125248980.0
KAFR0D001401.5ON10416986193e-65
Smik_3.141.5ON11134815465e-56
KNAG0C002201.5ON11616945394e-55
YCL061C (MRC1)1.5ON10966945215e-53
NCAS0B091101.5ON10204655035e-51
Suva_3.1521.5ON11403874885e-49
TDEL0C069701.5ON9417084661e-46
Skud_3.31.5ON11523614601e-45
SAKL0C00462g1.5ON11773574601e-45
Kpol_2002.81.5ON9854384572e-45
CAGL0B00330g1.5ON11363494242e-41
Ecym_10081.5ON11183653877e-37
KLLA0C00484g1.5ON9253503857e-37
ZYRO0F18480g1.5ON9604563713e-35
TPHA0E040101.5ON9652573384e-31
AFR745W1.5ON10183642946e-26
NDAI0A001401.5ON10911502777e-24
Kwal_33.130051.5ON970742437e-20
KLTH0F00484g1.5ON993742179e-17
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07570
         (1252 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...  1891   0.0  
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   243   3e-65
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...   214   5e-56
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   212   4e-55
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...   205   5e-53
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   198   5e-51
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...   192   5e-49
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   184   1e-46
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...   181   1e-45
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   181   1e-45
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   180   2e-45
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   167   2e-41
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   153   7e-37
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   152   7e-37
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   147   3e-35
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   134   4e-31
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   117   6e-26
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   111   7e-24
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...    98   7e-20
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...    88   9e-17

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score = 1891 bits (4898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 981/1252 (78%), Positives = 981/1252 (78%)

Query: 1    MNMDAVFDSLDELKIKKRTTYKKVPEQVATELDKAATTISNPVPSFNLSEGFLFANDKLE 60
            MNMDAVFDSLDELKIKKRTTYKKVPEQVATELDKAATTISNPVPSFNLSEGFLFANDKLE
Sbjct: 1    MNMDAVFDSLDELKIKKRTTYKKVPEQVATELDKAATTISNPVPSFNLSEGFLFANDKLE 60

Query: 61   KIKNRLNLGSKSNNTTTGNVDIPTNQNKFSDQYKNSLKESDDENEEILFSQSQAFLDTYN 120
            KIKNRLNLGSKSNNTTTGNVDIPTNQNKFSDQYKNSLKESDDENEEILFSQSQAFLDTYN
Sbjct: 61   KIKNRLNLGSKSNNTTTGNVDIPTNQNKFSDQYKNSLKESDDENEEILFSQSQAFLDTYN 120

Query: 121  DTKNEDDRILNKNTEDVIDEAEKSTTFTTNYIRPATHLNFRNTPNNIHSVXXXXXXXXXX 180
            DTKNEDDRILNKNTEDVIDEAEKSTTFTTNYIRPATHLNFRNTPNNIHSV          
Sbjct: 121  DTKNEDDRILNKNTEDVIDEAEKSTTFTTNYIRPATHLNFRNTPNNIHSVTQEITQQTQL 180

Query: 181  XXXXXNIKLNSISYSHNQKSKLAYNTYPNESLPTSQSIEERYRVEDPVQTTQDSSFANTQ 240
                 NIKLNSISYSHNQKSKLAYNTYPNESLPTSQSIEERYRVEDPVQTTQDSSFANTQ
Sbjct: 181  ISSTQNIKLNSISYSHNQKSKLAYNTYPNESLPTSQSIEERYRVEDPVQTTQDSSFANTQ 240

Query: 241  LIEDSTTTSPKRTIDFSQLKTQLIDSNKTSLLFQTQKINEEYIAQRQQIDNSQTQTSGSF 300
            LIEDSTTTSPKRTIDFSQLKTQLIDSNKTSLLFQTQKINEEYIAQRQQIDNSQTQTSGSF
Sbjct: 241  LIEDSTTTSPKRTIDFSQLKTQLIDSNKTSLLFQTQKINEEYIAQRQQIDNSQTQTSGSF 300

Query: 301  HFSLSQTKELSEPQNISLGIVPLITKDDYHEQSGTQSXXXXXXXXXXXXXXXXXXXHAPM 360
            HFSLSQTKELSEPQNISLGIVPLITKDDYHEQSGTQS                   HAPM
Sbjct: 301  HFSLSQTKELSEPQNISLGIVPLITKDDYHEQSGTQSNGAEEENNNINNNSNTNNNHAPM 360

Query: 361  HISLTQNKPNKFTMPTSAISDEDRNSQRPLNELSTSRLLTLTQIVPSSPGKATADDPPKG 420
            HISLTQNKPNKFTMPTSAISDEDRNSQRPLNELSTSRLLTLTQIVPSSPGKATADDPPKG
Sbjct: 361  HISLTQNKPNKFTMPTSAISDEDRNSQRPLNELSTSRLLTLTQIVPSSPGKATADDPPKG 420

Query: 421  PLMTLPEKTQADLLNTVPNQNDALNEIPQTARDDIFQTSVKDGILDKKLRIHEIQDALLQ 480
            PLMTLPEKTQADLLNTVPNQNDALNEIPQTARDDIFQTSVKDGILDKKLRIHEIQDALLQ
Sbjct: 421  PLMTLPEKTQADLLNTVPNQNDALNEIPQTARDDIFQTSVKDGILDKKLRIHEIQDALLQ 480

Query: 481  EVKEKEKQTEHHIQDSDSLXXXXXXXXXEXXXXXXXXXXXXXVYANGENDKNEDKSERAN 540
            EVKEKEKQTEHHIQDSDSL         E             VYANGENDKNEDKSERAN
Sbjct: 481  EVKEKEKQTEHHIQDSDSLTKTKFTFTKEDFLADLDDDDSDAVYANGENDKNEDKSERAN 540

Query: 541  TSHAKLKAMPVTIPHQQIEVQFNKVQLKNVIAKPKRKVILSQYENRLKENLLYNNSIDLY 600
            TSHAKLKAMPVTIPHQQIEVQFNKVQLKNVIAKPKRKVILSQYENRLKENLLYNNSIDLY
Sbjct: 541  TSHAKLKAMPVTIPHQQIEVQFNKVQLKNVIAKPKRKVILSQYENRLKENLLYNNSIDLY 600

Query: 601  SDSEENTQSDILFSTASKAQILDIRHXXXXXXXXXXXXTIQTNLDQLFNKLKKASKKQIF 660
            SDSEENTQSDILFSTASKAQILDIRH            TIQTNLDQLFNKLKKASKKQIF
Sbjct: 601  SDSEENTQSDILFSTASKAQILDIRHKLSKKKPQVKKKTIQTNLDQLFNKLKKASKKQIF 660

Query: 661  DHQKNAIXXXXXXXXXXXXXXXXXXNLLEQXXXXXXXXXXXXXXXXXXXXXVDDKSVQSA 720
            DHQKNAI                  NLLEQ                     VDDKSVQSA
Sbjct: 661  DHQKNAIESKGLKLEDLKKEKEIVENLLEQEIERNRKIRAKERKRENKKNKVDDKSVQSA 720

Query: 721  SDEDDFDHSANELEDSFYNDXXXXXXXXXXXXXXXXXXXXXFRHKKGLKLVTEESDSEND 780
            SDEDDFDHSANELEDSFYND                     FRHKKGLKLVTEESDSEND
Sbjct: 721  SDEDDFDHSANELEDSFYNDSDENKEIIEPEEEDSEDDINIFRHKKGLKLVTEESDSEND 780

Query: 781  NPLESEKIPINPNIINLGHYGDNLDSKSTIFNENSKKFIEDIEQFEADXXXXXXXXXXXX 840
            NPLESEKIPINPNIINLGHYGDNLDSKSTIFNENSKKFIEDIEQFEAD            
Sbjct: 781  NPLESEKIPINPNIINLGHYGDNLDSKSTIFNENSKKFIEDIEQFEADNSTENSNNELNE 840

Query: 841  XXYKRHIXXXXXXXXXXXXXXXXXXXXXXXVGASKMFDMEAEESEDEWFGIGGADGEVSD 900
              YKRHI                       VGASKMFDMEAEESEDEWFGIGGADGEVSD
Sbjct: 841  LEYKRHIKQELEKQKLKEAKKKAKLRELKKVGASKMFDMEAEESEDEWFGIGGADGEVSD 900

Query: 901  EYDSEVEKLIDDYSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDIXXXXXXXXXXXXIX 960
            EYDSEVEKLIDDYSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDI            I 
Sbjct: 901  EYDSEVEKLIDDYSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDIKNGGFRKRNRNNID 960

Query: 961  XXXXXXXXXXXXXXXXXXXXXXXXXXLEVTNTDKILKTSKSKAFFMSMVDDIVETSNPFM 1020
                                      LEVTNTDKILKTSKSKAFFMSMVDDIVETSNPFM
Sbjct: 961  LELSDDEDDELREYRIKRREIMKKKRLEVTNTDKILKTSKSKAFFMSMVDDIVETSNPFM 1020

Query: 1021 ITQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSQSSRKKFVMSEDFVHK 1080
            ITQP                                      LSQSSRKKFVMSEDFVHK
Sbjct: 1021 ITQPSDDDSDDNNMDSISNKNHKDANNAKKDKKDKRTDDHARLSQSSRKKFVMSEDFVHK 1080

Query: 1081 TLSFLTKSKEVNEFQHVNEHYKSQIGTINDIQSLKQKSSIKTMHVLSMMSQDTNVXXXXX 1140
            TLSFLTKSKEVNEFQHVNEHYKSQIGTINDIQSLKQKSSIKTMHVLSMMSQDTNV     
Sbjct: 1081 TLSFLTKSKEVNEFQHVNEHYKSQIGTINDIQSLKQKSSIKTMHVLSMMSQDTNVDLDAS 1140

Query: 1141 XXXXXXMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKT 1200
                  MIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKT
Sbjct: 1141 DKDDDDMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKT 1200

Query: 1201 VGGMKTSITSFGRRKLVAPVKTHXXXXXXXXXXXXXXXXXXLFRNQDKSFKD 1252
            VGGMKTSITSFGRRKLVAPVKTH                  LFRNQDKSFKD
Sbjct: 1201 VGGMKTSITSFGRRKLVAPVKTHNNFNKNRISNIKSSSNSKLFRNQDKSFKD 1252

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  243 bits (619), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 227/698 (32%), Positives = 301/698 (43%), Gaps = 78/698 (11%)

Query: 580  LSQYENRLKENLLYNNSIDLYSDSEENTQSDIL-----FSTASKAQILDIR-HXXXXXXX 633
            L+ YE +LK  L  +  IDL  DS++    D +      S  SKA + DI+         
Sbjct: 393  LNNYELKLKRQLNSDQQIDLNLDSDDEDGIDRMGEKGPISQMSKATVFDIKARLSKKRPI 452

Query: 634  XXXXXTIQTNLDQLFNKLKKASKKQIFDHQKNAIXXXXXXXXXXXXXXXXXXNLLEQXXX 693
                   +T L  LFNKL+KAS++QI +HQK  I                  NLLEQ   
Sbjct: 453  VKISNDSKTTLHTLFNKLQKASRQQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQEIN 512

Query: 694  XXXXXXXXXXXXXXXXXXVDDKSVQSASDED---DFDHSANELEDSFYNDXXXXXXXXXX 750
                                +K +  A D++   DFDHSANEL++S  +           
Sbjct: 513  RNKKIRQREKER--------EKQLADAQDDENDLDFDHSANELDESELSGEESAIDSDND 564

Query: 751  XXXXXXXXXXXFRHKKGLKLVTEESDSENDNPLESEKIPI----------NPNIINLGHY 800
                        R KK  K++ E+SD+E ++   S    I          N N INLG Y
Sbjct: 565  YDDFSLEKTK--RSKK--KVIVEDSDTEIEDEKMSHNAQIREEKDDSLFQNRNAINLGPY 620

Query: 801  GDNLDS---KSTIFNENSKKFIEDIEQF-EADXXXXXXXXXXXXXXYKRHIXXXXXXXXX 856
            GDNL     + T   ++ K F    E   E D               K+H          
Sbjct: 621  GDNLSLAPIRITTEKQSGKNFKVSRESGDERDEEIPEKDRIRLIEEKKQH-------ELE 673

Query: 857  XXXXXXXXXXXXXXVGASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQ 916
                           G +   + EAEESEDEW GIGG DGE+SDEYDSEVEK+IDDYS+ 
Sbjct: 674  RQRKQMKKRKEMKAKGITNFLEEEAEESEDEWHGIGGIDGEMSDEYDSEVEKMIDDYSKA 733

Query: 917  DFNPDEIRNKLMNENKEMDIKMVNRILYDIXXXXXXXXXXXXIXXXXXXXXXXXXXXXXX 976
            +FNPDEIR  L +ENKE DIKMV +ILYDI            +                 
Sbjct: 734  NFNPDEIRQMLADENKETDIKMVEKILYDIKNGGFRKRRKGAMDLELSDEEDDELKQYRL 793

Query: 977  XXXXXXXXXXLEVTNTDKILKTSKSKAFFMSMVDDIVETSNPFMITQPXXXXXXXXXXXX 1036
                      LEV   + ++K  KSKAFF SMVDDIVE  NPF + +P            
Sbjct: 794  KRRELMRQKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFEPQRSGTITTDDGT 853

Query: 1037 XXXXXXXXXXXXXXXXXXXXXXXXXXLSQSSRKKFVMSEDFVHKTLSFLTKSKEVNEFQH 1096
                                       SQ+  KK ++SE+FV +TLSFL  SK++++F  
Sbjct: 854  QENANSNEGAA----------------SQNPSKKVMLSEEFVQRTLSFLNSSKDMDQFAP 897

Query: 1097 VNE-HYKSQIGTINDIQSLKQKSSIKTMHV--LSMMSQDTNVXXXXXXXXXXXMIHHAGS 1153
                  ++    I D+ +LK++SSIK+      S+  + T+                   
Sbjct: 898  ARSMRAEANDELIEDLTALKKQSSIKSFKTTRASVSQEPTDFDKEN-------------- 943

Query: 1154 FDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGR 1213
             D+SFDD L+S     SI+K F +T DINDKF++G KTV +S +YK+V   K SIT  G+
Sbjct: 944  -DDSFDDLLNSRVGTSSIMKTFSATVDINDKFQEGVKTVKVSKAYKSVSSSKASITYMGK 1002

Query: 1214 -RKLVAPVKTHXXXXXXXXXXXXXXXXXXLFRNQDKSF 1250
             RKLVAP K                    LF  QD+SF
Sbjct: 1003 MRKLVAPQK-KVANLSSSDIKNTNSRTSKLFSRQDESF 1039

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/65 (44%), Positives = 38/65 (58%), Gaps = 5/65 (7%)

Query: 3  MDAVFDSLDELKIKKRTTYKKVPEQVATELDKAATTISNPVPSFNLSEGFLFANDKLEKI 62
          MD +F +L  LK KKRTTYKK+ + +  +     T+ SN  P     EGFLF N  L +I
Sbjct: 1  MDGIFGNLQALKPKKRTTYKKISDDLEND-----TSESNNDPPALTGEGFLFDNPTLNRI 55

Query: 63 KNRLN 67
          K RL+
Sbjct: 56 KKRLD 60

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score =  214 bits (546), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 170/481 (35%), Positives = 214/481 (44%), Gaps = 45/481 (9%)

Query: 768  LKLVTEESDSENDN-PLESEKIPINPNI-INLGHYGDNLDSKSTIFNENS---------- 815
            +K + +ESDSEN+  P E     +   I INLGHYGDN++ +   F E +          
Sbjct: 616  VKRMIDESDSENEAVPKEKVDASVPKRIAINLGHYGDNIEEEVNKFQETNDMNTQQTDKI 675

Query: 816  ---------KKFIEDIEQFEADXXXXXXXXXXXXXXYKRHIXXXXXXXXXXXXXXXXXXX 866
                     K  +ED    + D               +  I                   
Sbjct: 676  TMERNIVENKAILEDTAVVDEDNINEEADEAIR----RELIDKEKLQLRQKELEKAIKLK 731

Query: 867  XXXXVGASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNK 926
                 G +  F+MEAEES+DEW GIGGADGE SDEYDS+VEK+IDDYS+ +FN  EIR  
Sbjct: 732  ELKHKGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIREM 791

Query: 927  LMNENKEMDIKMVNRILYDIXXXX-XXXXXXXXIXXXXXXXXXXXXXXXXXXXXXXXXXX 985
            L  ENKEMD+KM+N+ILYDI             +                          
Sbjct: 792  LAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKR 851

Query: 986  XLEVTNTDKILKTSKSKAFFMSMVDDIVETSNPFMITQPXXXXXXXXXXXXXXXXXXXXX 1045
             LE+ +  K++K  KSKAFF SMV+DI+E  NPF   +                      
Sbjct: 852  RLEIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTATDLDTLDNNSLN 911

Query: 1046 XXXXXXXXXXXXXXXXXLSQSSRKKFVMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKSQI 1105
                                   KK ++SEDFV K+LSFL KS   NEF+   E  K Q 
Sbjct: 912  VRDSTRNNEKGPVDDKS------KKIIISEDFVQKSLSFL-KSNNYNEFEMDKELAKMQH 964

Query: 1106 GT----INDIQSLKQKSSIKTMHVLSMMSQDTNVXXXXXXXXXXXMIHHAGSFD--NSFD 1159
            G     I D+ +LKQ SSIK     S  +  T+            +       D   + D
Sbjct: 965  GNDDEPIEDLFTLKQHSSIK-----SFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGD 1019

Query: 1160 DPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGR-RKLVA 1218
              L S  K PSI+K F S  DINDKFK+GNKTV IS SYK VG  K SIT  G+ RKL+A
Sbjct: 1020 SSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMA 1079

Query: 1219 P 1219
            P
Sbjct: 1080 P 1080

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 3  MDAVFDSLDELKIKKR-TTYKKVPEQVATELDKAATTI-SNPV--PSFNLSEGFLFANDK 58
          MD   ++L  L+ KKR TTYKKV   +  + D     + +N +  P      GFLFAN  
Sbjct: 1  MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60

Query: 59 LEKIKNRLNLG 69
          L ++KNRL  G
Sbjct: 61 LNRVKNRLEGG 71

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%)

Query: 645 DQLFNKLKKASKKQIFDHQKNAIXXXXXXXXXXXXXXXXXXNLLEQ 690
           ++LFN L+KAS+KQI DHQ+  I                  NLLEQ
Sbjct: 486 NKLFNTLRKASRKQILDHQREVIETKGFKLEDMVKEKELVENLLEQ 531

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  212 bits (539), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 211/694 (30%), Positives = 294/694 (42%), Gaps = 94/694 (13%)

Query: 563  NKVQLKNVIAKPKRKVILSQYENRLKENLLYNNSIDLYSD----SEENTQSDILFSTASK 618
            NK +      K KR   LS YE  L+  +  +  +DL SD    SEE    +   S ASK
Sbjct: 494  NKARKPTEAPKTKRVTGLSSYETILRNKVNDDECLDLGSDDTYSSEEEYDKESKVSQASK 553

Query: 619  AQILDIRHXXXXXXXXXXXX-TIQTNLDQLFNKLKKASKKQIFDHQKNAIXXXXXXXXXX 677
            A +L+I+              T +T LD LF+ LKK +++QI  HQ   I          
Sbjct: 554  AAVLNIKAKALKKKAIVKAANTNKTTLDSLFSDLKKKNRQQILSHQAEIIGTKGINHKDL 613

Query: 678  XXXXXXXXNLLEQXXXXXXXXXXXXXXXXXXXXXVDDKSVQSASDEDDFDHSANELE--- 734
                    +LLEQ                       D          D ++SANELE   
Sbjct: 614  EREKEIVEDLLEQEILRNKRLREREREREQKEEEQSDM---------DNNYSANELESFD 664

Query: 735  ----DSFYNDXXXXXXXXXXXXXXXXXXXXXFRHKKGLK-------LVTEESDSE----- 778
                DS   D                     F   + LK        +  ESDSE     
Sbjct: 665  DSDHDSLNEDEPNINDDNNSSNGVDSEDEEEFAAFQVLKGKKRKNMQIQPESDSEEETVN 724

Query: 779  -NDNPLE--SEKIPINP----NIINLGHYGDNLDSKSTIFNE---NSKKFIEDIEQFEA- 827
             ND  +   SE  PI+P    N I+LG YG+NL+ ++ + N    ++K  +++ E   A 
Sbjct: 725  SNDKRVNAPSESKPIHPVNNINAIDLGDYGNNLEIRAELNNTEKLDTKCMLDEKEHARAV 784

Query: 828  DXXXXXXXXXXXXXXYKRHIXXXXXXXXXXXXXXXXXXXXXXXVGASKMFDMEAEESEDE 887
            D               KR                          G S  F+ EAEESEDE
Sbjct: 785  DKERLKTIMKEKKLMLKR--------------------AELKEKGVSNFFEEEAEESEDE 824

Query: 888  WFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDIX 947
            W GIGG DGEVSDEYDSEVEK+IDDYSR D +P+EIR  L++ENKEMD+KMVN+IL+DI 
Sbjct: 825  WHGIGGIDGEVSDEYDSEVEKMIDDYSRADMDPEEIRKLLVSENKEMDVKMVNKILFDIK 884

Query: 948  XXXXXXXXXXXIXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVTNTDKILKTSKSKAFFMS 1007
                       +                           L++ +  K++K  K+KAFF S
Sbjct: 885  NGNFRKRGRDTLELELSDEEDDDLRQYRQKRNELMKQRLLDLGDDKKLVKNVKTKAFFDS 944

Query: 1008 MVDDIVETSNPFMITQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSQSS 1067
            +V+DIVE  NPF +                                          +Q  
Sbjct: 945  LVEDIVEVKNPFGVMSDNETQDTDETTTIDTQTRESVSNKEEKP------------TQEK 992

Query: 1068 RKKFVMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKSQI-GTINDIQSLKQKSSIKTMHVL 1126
             KK V+SE+FV ++LSFL  ++ + EF+   +  + Q    ++D+ +LK++SS+K+   +
Sbjct: 993  GKKTVLSEEFVQRSLSFLNSNRNLTEFEQNQDLARLQHDDDVSDLYTLKKQSSVKSFKSV 1052

Query: 1127 SMMSQDTNVXXXXXXXXXXXMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFK 1186
               ++  NV                   DNS     ++  + PSIIK F S  +++DKF+
Sbjct: 1053 GSKNEIINVDAN----------------DNSGTAVATATFRPPSIIKSFNSKLNVDDKFR 1096

Query: 1187 DGNKTVTISNSYKTVGGMKTSITSFGR-RKLVAP 1219
            +G KTV    SYK VGG KTS+T   + RKL AP
Sbjct: 1097 NGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAP 1130

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 38/65 (58%), Gaps = 4/65 (6%)

Query: 3  MDAVFDSLDELKIKKRTTYKKVPEQVATELDKAATTISNPVPSFNLSEGFLFANDKLEKI 62
          MD + +  + +K+K+RTTYKKV +    E    A    + VP+     GFLF N  ++KI
Sbjct: 1  MDDLLERFNSVKVKRRTTYKKVQQNSTDE----AAGDDDCVPTSLAGNGFLFGNATVDKI 56

Query: 63 KNRLN 67
          KNRLN
Sbjct: 57 KNRLN 61

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score =  205 bits (521), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 215/694 (30%), Positives = 278/694 (40%), Gaps = 67/694 (9%)

Query: 575  KRKVILSQYENRLKENLLYNNSI--DLYSDSEENTQSD------------ILFSTASKAQ 620
            KR  +LS Y N LK  +  +  I  DL SDS+E    D            +  S  SKA 
Sbjct: 381  KRVPLLSSYANNLKREIDSSKCITLDLDSDSDEYGDDDMDSIKLSKDESVLPISQLSKAT 440

Query: 621  ILDIR-----HXXXXXXXXXXXXTIQTNLDQLFNKLKKASKKQIFDHQKNAIXXXXXXXX 675
            IL+++                    + + + L N L+KAS+KQI DHQK  I        
Sbjct: 441  ILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLLNTLRKASRKQILDHQKEVIETKGLKLE 500

Query: 676  XXXXXXXXXXNLLEQXXXXXXXXXXXXXXXXXXXXX-----VDDKSVQSASDEDDFDHSA 730
                      NLLEQ                            D    S S+   F  S 
Sbjct: 501  DMAKEKEIVENLLEQEILRNKRIRQKEKRREKLEENDFQLNAHDSGSDSGSESSGFALSG 560

Query: 731  NELEDSFYNDXXXXXXXXXXXXXXXXXXXXXFRHKKG--LKLVTEESDSEND---NPLES 785
            NE+ D  Y                        + KK   +K +  ESDS+ +    P E 
Sbjct: 561  NEIAD--YESSGSENDNRRESDSEKEDDEIILKQKKSHHVKHIINESDSDTEVEAKPKEK 618

Query: 786  EKIPINPNI-INLGHYGDNLDSKSTIFNENSKKFIEDIEQFEADXXXXXXX--------X 836
                +   I INLGHYGDN+   +  F E +    ++IE+  A+                
Sbjct: 619  ADESLPKRIAINLGHYGDNIGEDTDKFQETNVLDTQNIEEVMAERNTIENEVKDDVYVNE 678

Query: 837  XXXXXXYKRHIXXXXXXXXXXXXXXXXXXXXXXXVGASKMFDMEAEESEDEWFGIGGADG 896
                   ++ I                        G +  F+MEAEESEDEW GIGGADG
Sbjct: 679  EADEAIRRQLIDKEKLQLKQKEKEHEAKIKELKKRGVTNFFEMEAEESEDEWHGIGGADG 738

Query: 897  EVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDIXXX--XXXXX 954
            E SD+YDS++EK+IDDYS+ +FNP EIR  L  ENKEMDIKM+N+ILYDI          
Sbjct: 739  EGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKRA 798

Query: 955  XXXXIXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVTNTDKILKTSKSKAFFMSMVDDIVE 1014
                                            LE+ +  K++K  KS AFF SMV+DI+E
Sbjct: 799  KNSLELELSDDDEDDVLQQYRLKRRELMRKRRLEIGDDAKLVKNPKSSAFFESMVEDIIE 858

Query: 1015 TSNPFMITQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSQSSRKKFVMS 1074
              NPF   +                                             KK ++S
Sbjct: 859  YKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNTGNNEQKPVDQKN-------KKVIIS 911

Query: 1075 EDFVHKTLSFLTKS--------KEVNEFQHVNEHYKSQIGTINDIQSLKQKSSIKTMHVL 1126
            EDFV K+LSFL  +        KE++  QH N+        I D+ +LKQ SSIK+    
Sbjct: 912  EDFVQKSLSFLKSNNYEDFETDKELSRIQHGNDE------AIEDLYTLKQNSSIKSF--T 963

Query: 1127 SMMSQDTNVXXXXXXXXXXXMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFK 1186
            +  +  T                     +N  D  L  V K PSIIK F S  DINDKFK
Sbjct: 964  NSQTDSTTSKTVNTIIDLEKRPEDEDEVENG-DTSLVGVFKHPSIIKSFASRTDINDKFK 1022

Query: 1187 DGNKTVTISNSYKTVGGMKTSITSFGR-RKLVAP 1219
            +GNKTV I  SYKTVG  K SIT  G+ RKL+AP
Sbjct: 1023 EGNKTVKILKSYKTVGSSKASITYMGKTRKLIAP 1056

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 34/69 (49%), Gaps = 7/69 (10%)

Query: 3  MDAVFDSLDELKIKKRTT-YKKVPEQVATELDK----AATTISNPVPSFNLSEGFLFAND 57
          MD    +L  L  KKRTT YKKV   +  E D         I NP P      GFLFAN 
Sbjct: 1  MDDALHALSSLTAKKRTTTYKKVAVPILDENDNTNGNGPNDIDNP-PELT-GNGFLFANA 58

Query: 58 KLEKIKNRL 66
           L ++KNRL
Sbjct: 59 TLNRVKNRL 67

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  198 bits (503), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 170/465 (36%), Positives = 214/465 (46%), Gaps = 59/465 (12%)

Query: 763  RHKKGLKLVTEESDSENDNPLESEKIPINPNIINLGHYGDNLDSKSTIFNENSKKFIEDI 822
            R +K    + +ESD EN    E  KI    N I+LG YG NLD+ + + ++         
Sbjct: 580  RKEKHPVRIIQESDDEN----EINKI----NTIDLGVYGGNLDNPNPLSSQ--------T 623

Query: 823  EQFEADXXXXXXXXXXXXXXYKRH--IXXXXXXXXXXXXXXXXXXXXXXXVGASKMFDME 880
            E  E D               +RH  I                        G +K+F+ME
Sbjct: 624  EPNEDDEDEKSTYENKEITEEERHALILAEKKRIQLIEKKNAARTKEMKKKGVNKLFEME 683

Query: 881  AEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNENKEMDIKMVN 940
            AEESEDEW GIGGADGEVSDEYDSEVEK+IDDYS+ +FNPDEIR  L  ENKEMD+ M+ 
Sbjct: 684  AEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQMLALENKEMDLNMIT 743

Query: 941  RILYDIXXXXXXXXXXXXIXXXXXXXXXXXXXXXX--XXXXXXXXXXXLEVTNTDKILKT 998
            +ILYDI            +                             LE+ +  K++K 
Sbjct: 744  KILYDIKNGGFRKRRRGGLDLELSDDDEDDEELREYHKRKRELMKKRMLEIGDDKKLIKN 803

Query: 999  SKSKAFFMSMVDDIVETSNPFMITQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 1058
             KSKAFF SMV+DIV+  N F   +                                   
Sbjct: 804  PKSKAFFESMVEDIVDEKNAFGDIESIEKSSTELDTQEEKEQDVTPGV------------ 851

Query: 1059 XXXXLSQSSRKKFVMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKSQIG-TINDIQSLKQK 1117
                     +KK V+SE+FV KTLSFL   +++ EF    +  K Q G  + D+ SLKQ+
Sbjct: 852  --------DKKKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHGENVEDLFSLKQR 903

Query: 1118 SSIKTMHVLSMMSQDTNVXXXXXXXXXXXMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGS 1177
            S+IK     S     TN             I    + +N    PL    K PS+IK F S
Sbjct: 904  STIKEFRNPSQ----TNT------------IDLINNVENVESSPLGGF-KPPSVIKSFSS 946

Query: 1178 THDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGR-RKLVAPVK 1221
              DIN+KFKDGNKTVTIS  YKTVG  K SIT  G+ RKL+ P K
Sbjct: 947  RTDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKK 991

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 53/123 (43%), Gaps = 9/123 (7%)

Query: 613 FSTASKAQILDIRHXXXXXXXXXXXXTIQTNLDQLFNKLKKASKKQIFDHQKNAIXXXXX 672
            S  SKA +L+++             +  T+LD LF  LK+AS+KQI DHQ+  +     
Sbjct: 397 ISRTSKATLLNLKARLSKKKPVKSNKSTNTSLDVLFQNLKQASRKQILDHQRELVENRGF 456

Query: 673 XXXXXXXXXXXXXNLLEQXXXXXXXXXXXXXXXXXXXXXVDDKSVQSASDEDDFDHSANE 732
                        NLLE+                       +KS+ S +++ DFD SANE
Sbjct: 457 KLEDIEKEKEIVENLLEEEIKRNKRIRMREKQK--------EKSL-SENEDADFDLSANE 507

Query: 733 LED 735
           LED
Sbjct: 508 LED 510

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 52/97 (53%), Gaps = 12/97 (12%)

Query: 3  MDAVFDSLDELKIKKRTTYKKVPEQVATE---LDKAATTISNPVPSFNLSEGFLFANDKL 59
          M+++F+     K +++TTYKK+ E+   +   L +A   ++ PV    +  GF+F N  +
Sbjct: 1  MESIFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPV----IGNGFIFGNALI 56

Query: 60 EKIKNRLNLGSKSNNTTTGNVDIPTNQNKFSDQYKNS 96
          +KI+NRL+   K N   T    +PT      + YK++
Sbjct: 57 DKIRNRLD--GKENKEDTP---VPTQTQMIDNLYKDA 88

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score =  192 bits (488), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 149/387 (38%), Positives = 181/387 (46%), Gaps = 19/387 (4%)

Query: 872  GASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNEN 931
            G +  F+MEAEESEDEW G+GGADGE SDEYDSEVEK+IDDYS+  FN  EIR  L  EN
Sbjct: 763  GVTNFFEMEAEESEDEWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEIREMLAAEN 822

Query: 932  KEMDIKMVNRILYDIXXXX-XXXXXXXXIXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVT 990
            KEMD+KM+N+ILYDI             +                           LE+ 
Sbjct: 823  KEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIG 882

Query: 991  NTDKILKTSKSKAFFMSMVDDIVETSNPFMITQPXXXXXXXXXXXXXXXXXXXXXXXXXX 1050
            +  K++K  KSKAFF SMV+DI+E  NPF   +                           
Sbjct: 883  DDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQDNDNTKPGDNT 942

Query: 1051 XXXXXXXXXXXXLSQSSRKKFVMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKSQIGT--- 1107
                              KK ++SEDFV K+LSFL KS   +EF+   E  + Q G    
Sbjct: 943  SNNEHNKHVG-----DKSKKLIISEDFVQKSLSFL-KSNNYDEFEMDRELARIQHGNGEG 996

Query: 1108 -INDIQSLKQKSSIKTMHVLSMMSQDTNVXXXXXXXXXXXMIHHAGSFDNS--FDDPLSS 1164
             + D+ +LKQ SSIK     S  +  TN            +  H    D     D  L  
Sbjct: 997  DVVDLFTLKQHSSIK-----SFTNSQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSLIG 1051

Query: 1165 VSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGR-RKLVAPVKTH 1223
              K PS+IK F S  DINDKFK+GNKTV IS SYKTVG  K SIT  G+ RKL+AP +  
Sbjct: 1052 GFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLMAPKRKT 1111

Query: 1224 XXXXXXXXXXXXXXXXXXLFRNQDKSF 1250
                              LF N   SF
Sbjct: 1112 EENHHPNHIKKSKTQKSKLFENGQDSF 1138

 Score = 40.0 bits (92), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 36/71 (50%), Gaps = 10/71 (14%)

Query: 3   MDAVFDSLDELKIKKR-TTYKKVPEQVATELDKAATTISN-PVPSFNL-----SEGFLFA 55
           MD   ++L  L  KKR TTYKKV   +   LD+   T  N P+   N        GFLF 
Sbjct: 44  MDDALNALSSLTSKKRATTYKKVASPI---LDENYDTDGNLPIDGMNAPPALTGNGFLFG 100

Query: 56  NDKLEKIKNRL 66
           N  L ++KNRL
Sbjct: 101 NATLNRVKNRL 111

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 55/137 (40%), Gaps = 19/137 (13%)

Query: 573 KPKRKVILSQYENRLKENLLYNNSIDLYSDSEENTQSD--------------ILFSTASK 618
           K K+  +LS Y N LK  +  +  I L  DS  +  +D              +  S  SK
Sbjct: 408 KDKKVPLLSTYANNLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDESALPISQLSK 467

Query: 619 AQILDIRHXXXXXXXXXXXXT-----IQTNLDQLFNKLKKASKKQIFDHQKNAIXXXXXX 673
           A I +++             +      +++ ++L N L+KAS+KQI DHQ+  +      
Sbjct: 468 ATIFNLKARLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVETKGFK 527

Query: 674 XXXXXXXXXXXXNLLEQ 690
                       +LLEQ
Sbjct: 528 LEDMVKEKEIVEDLLEQ 544

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
            YCL061C
          Length = 941

 Score =  184 bits (466), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 198/708 (27%), Positives = 292/708 (41%), Gaps = 102/708 (14%)

Query: 571  IAKPKRKVILSQYENRLKENLLYNNSIDLYSDSEENTQSDILFSTA--SKAQILDIRHXX 628
            + K K    L+ Y+  LKE       + L S+S++  + D+  ST+  +KA +L ++   
Sbjct: 310  VLKDKSSGALTAYQRELKEKAEIAKGVMLLSESDD--EEDLAVSTSHEAKATVLKLKARL 367

Query: 629  XXXXXXXXXXTIQTNLDQLFNKLKKASKKQIFDHQKNAIXXXXXXXXXXXXXXXXXXNLL 688
                        + +L  L   L+ ++K+QI D QK  I                  NLL
Sbjct: 368  SKRRPPVESQHGKASLSALMKNLRNSTKRQILDRQKEGIERQGLKFEDVEKEKEIVENLL 427

Query: 689  EQXXXXXXXXXXXXXXXXXX----------XXXVDDKSVQSASDED-----DFDHSANEL 733
            EQ                                D+ S  S SDED     D D+S  E 
Sbjct: 428  EQEIARNKRIRMKEKEKAQMNDVPSLALPNRVEEDNDSNYSVSDEDSVIKEDLDYSDLES 487

Query: 734  EDSFYNDXXXXXXXXXXXXXXXXXXXXXFRHKK-GLKLVTEESDSENDNPLESEKIPINP 792
            +DS  N+                      + K   + L+ ++   E       E + +N 
Sbjct: 488  DDSGSNEPKIASDSAGVEIDSDEDDIRFMKGKAHKISLLNDDESEE------EEDLTVN- 540

Query: 793  NIINLGHYGDNL-----DSKSTIFNENSKKFIEDIEQFEADXXXXXXXXXXXXXXYKRHI 847
            + INLG YGDNL     D   T   E++ + + +I + +                 +R  
Sbjct: 541  SAINLGAYGDNLITTTKDEAHTSAEEHTTQLVNEISESQYRTMEKEKSKIRAQEEKQR-- 598

Query: 848  XXXXXXXXXXXXXXXXXXXXXXXVGASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVE 907
                                    G + MFDMEAEES+DEW G+GG DGE  D+YDS++E
Sbjct: 599  -----------------LKQMKESGVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLE 641

Query: 908  KLIDDYSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDIXXXXXXXXXXXXIXXXXXXXX 967
            K+IDD+S    N D+IR  LM ENKE D+K VN+IL+DI            +        
Sbjct: 642  KMIDDFSNTTSNADQIRQLLMAENKETDLKTVNKILHDIKNGGFRKRRQNNLQLELSDDE 701

Query: 968  XXXXXXXXXXXXXXXXXXXLEVTNTD-KILKTSKSKAFFMSMVDDIVETSNPFMITQPXX 1026
                               L+    D K+LK S+SKAFF SMV+DI++  +PF       
Sbjct: 702  DDELLNYKKRKLELMRKRRLQFGADDKKLLKNSRSKAFFESMVEDIIDLKDPF------- 754

Query: 1027 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSQSSRKKFVMSEDFVHKTLSFLT 1086
                                                +  S+++K  +S +FV ++LSFL+
Sbjct: 755  --------------------SNQAETSEKDKKSEGLVDASNKQKDTISHEFVQQSLSFLS 794

Query: 1087 KSKEVNEFQHVNEHYKSQIGTIN-DIQSLKQKSSIKTMHVLSMMSQDTNVXXXXXXXXXX 1145
             S++ +EF+       SQ G  N D+ SLKQ S++KT++  S +  ++            
Sbjct: 795  SSRDFSEFEVAR---VSQEGERNTDLNSLKQDSTVKTLYAPSNIISESERAD-------- 843

Query: 1146 XMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMK 1205
               H    FDNS    L   S   S++K FG   + NDK K+G KTVT+S SY+TVGG K
Sbjct: 844  ---HE--EFDNSV---LPVESSYSSVVKSFGFDLNANDKLKEGRKTVTVSKSYRTVGGNK 895

Query: 1206 TSITSFGR-RKLVAPVKTHXXXXXXXXXXXXXXXXXXLFRNQDKSFKD 1252
             SIT  G+ RKLVAP K++                  +FRN + SF++
Sbjct: 896  ASITYLGKMRKLVAPKKSN--AEVRTTSKLSTLGNSKIFRNFESSFEN 941

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 7/66 (10%)

Query: 3  MDAVFDSLDELKIKKRTTYKKVPEQVATELDKAATTISNP-VPSFNLSEGFLFANDKLEK 61
          MD +F+S D    K+R TY+K    V  E D+      +P VP   L  GFLF +  L+K
Sbjct: 1  MDKLFESFDNAIKKRRATYQKA---VQNEDDEYT---EDPLVPPAVLGNGFLFNSSTLDK 54

Query: 62 IKNRLN 67
          +KNRLN
Sbjct: 55 VKNRLN 60

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score =  181 bits (460), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 142/361 (39%), Positives = 178/361 (49%), Gaps = 26/361 (7%)

Query: 872  GASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNEN 931
            G +  F+MEAEESEDEW G+GGADGE S+EYDSEVEK+IDDYS+  FN  EIR  L  EN
Sbjct: 775  GITNFFEMEAEESEDEWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAEN 834

Query: 932  KEMDIKMVNRILYDIXXXX-XXXXXXXXIXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVT 990
            KEMD+KM+NRILYDI             +                           LE+ 
Sbjct: 835  KEMDVKMINRILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIG 894

Query: 991  NTDKILKTSKSKAFFMSMVDDIVETSNPFMITQPXXXXXXXXXXXXXXXXXXXXXXXXXX 1050
            +  K++K  KSKAFF SMV+DI+E  NPF   +                           
Sbjct: 895  DDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDSIQIGDST 954

Query: 1051 XXXXXXXXXXXXLSQSSRKKFVMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKSQ--IG-- 1106
                              KK ++SEDFV K+LSFL +S   +EF+   E  + Q  IG  
Sbjct: 955  RNNEHRRVDDRS------KKTIISEDFVQKSLSFL-RSNNYDEFEMDKERARIQHDIGDE 1007

Query: 1107 TINDIQSLKQKSSIKTM-----HVLSMMSQDTNVXXXXXXXXXXXMIHHAGSFDNSFDDP 1161
             + D+ +LKQ SSIK+        LS    ++ +           + +   S    F   
Sbjct: 1008 GVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGF--- 1064

Query: 1162 LSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGR-RKLVAPV 1220
                 K PSIIK F S  DINDKFK+GNKTV IS +YKTVG  K SIT  G+ RKL+AP 
Sbjct: 1065 -----KHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLMAPK 1119

Query: 1221 K 1221
            K
Sbjct: 1120 K 1120

 Score = 37.4 bits (85), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 40/93 (43%), Gaps = 15/93 (16%)

Query: 3   MDAVFDSLDELKIKKR-TTYKKVPEQVATELDKAATTI-SN--PVPSFNLSEGFLFANDK 58
           MD V + L  L  KKR TTYKK+   +    D     + SN    P      GFLF N  
Sbjct: 56  MDNVLEVLSSLTSKKRVTTYKKIASPIPDGDDDVDGDLLSNNMGAPPALTGNGFLFGNAT 115

Query: 59  LEKIKNRLNLGSKSNNTTTGNVDIPTNQNKFSD 91
           L ++KNRL             +D+P +  +  D
Sbjct: 116 LNRVKNRLE-----------GIDVPEDDRQIKD 137

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%)

Query: 645 DQLFNKLKKASKKQIFDHQKNAIXXXXXXXXXXXXXXXXXXNLLEQ 690
           ++LFN L+KAS+KQI DHQ+  I                  NLLEQ
Sbjct: 528 NKLFNILRKASRKQILDHQREVIETKGFKLEDMAKEKEIVENLLEQ 573

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  181 bits (460), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 132/357 (36%), Positives = 177/357 (49%), Gaps = 37/357 (10%)

Query: 872  GASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNEN 931
            G SKMF+MEAEESEDEW G+GGADGE+SDEYDSE+EK++DDY++  F+P EIR  L  E+
Sbjct: 814  GVSKMFEMEAEESEDEWHGVGGADGELSDEYDSELEKMVDDYTKTTFDPAEIRQMLAAED 873

Query: 932  KEMDIKMVNRILYDIXXXXXXXXXXXXIXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVTN 991
            KE D K+VN+IL+DI            +                           LE   
Sbjct: 874  KEYDEKIVNKILHDIKNGGFRRRGKGALDIELSDDEDDELQRYHAKRRELLRQKVLENGE 933

Query: 992  TDKILKTSKSKAFFMSMVDDIVETSNPFMITQPXXXXXXXXXXXXXXXXXXXXXXXXXXX 1051
              K++   KS AFF SMV+D+VE+ NPF I +                            
Sbjct: 934  ASKLVSNPKSHAFFESMVEDLVESKNPFSIGETADPDSGAISENDKVDNASEHGTQPDAG 993

Query: 1052 XXXXXXXXXXXLSQSSRKKFVMSEDFVHKTLSFLTKSKEV-NEFQ---HVNEHYKSQIGT 1107
                         ++ RK+  +S++FV ++LSFL    E+ NEF+    + +H  S +G 
Sbjct: 994  GQPV---------RTERKRIKISQEFVQRSLSFLNSKDELDNEFELDRRLAKHQHSTLGD 1044

Query: 1108 IN----DIQSLKQKSSIKTMHVLSMMSQDTNVXXXXXXXXXXXMIHHAGSFDNSFDDPLS 1163
             N    D+ +LKQ S IKT+H  +  S  T             +     S  N F     
Sbjct: 1045 DNDDLEDLFTLKQNSCIKTLHTPARTSSRT-----------VDLEVDGNSPANGF----- 1088

Query: 1164 SVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGR-RKLVAP 1219
               K PS+I  F S  DIN+KFK+G KTV +S SYKT+GG + SIT  G+ RKL AP
Sbjct: 1089 ---KLPSVISSFSSRIDINEKFKEGTKTVKVSKSYKTIGGSRASITYLGKVRKLNAP 1142

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 68/162 (41%), Gaps = 9/162 (5%)

Query: 578 VILSQYENRLKENLLYNNSIDLYSDSEENTQSDILFSTASKAQILDIRHXXXXXXXXXXX 637
           V L+ Y+N+LK  L     IDL S S+E+  S +  S  SKA +L+I+            
Sbjct: 410 VPLNSYKNQLKARLDSKEHIDLDSSSDEDENS-VPASKMSKAAVLEIKARTSKRQGIKKT 468

Query: 638 XTIQT-----NLDQLFNKLKKASKKQIFDHQKNAIXXXXXXXXXXXXXXXXXXNLLEQXX 692
               +     +L +LF+ LKKA+KKQI DH++                     NLLEQ  
Sbjct: 469 RQQPSTPRAPSLKELFSSLKKANKKQILDHRREITEKRGLNLEDIEREKKEVENLLEQ-E 527

Query: 693 XXXXXXXXXXXXXXXXXXXVDDKSVQSASDEDDFDHSANELE 734
                              +D++  Q      DFD+S NEL+
Sbjct: 528 IERNRKIRLREKQREKKKELDEQ--QDGGYPGDFDYSENELD 567

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
            complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  180 bits (457), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 154/438 (35%), Positives = 199/438 (45%), Gaps = 67/438 (15%)

Query: 793  NIINLGHYGDNLDSKSTIFNENSKKFIEDIEQFEADXXXXXXXXXXXXXXYKRHIXXXXX 852
            N INLGHYGDNL  +    N N +  I+  E  + +              YK  +     
Sbjct: 578  NTINLGHYGDNLSQE----NNNERNNIDSDESEDEEL-------------YKEMVKKEID 620

Query: 853  XXXXXXXXXXXXXXXXXXVGASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDD 912
                               G + MF++EAEESEDEW GIGG DGE+SDEYDSEVEK+IDD
Sbjct: 621  RRRDQERKQRQKLRELKDKGITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDD 680

Query: 913  YSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDIXXXXXXXXXXXXIXXXXXXXXXXXXX 972
            YS+++FN  EIR KL  ENK+MD+KMVNRIL DI            +             
Sbjct: 681  YSKENFNAGEIREKLAAENKDMDLKMVNRILNDI-KNGGFRKRRNALEIELSDDEDDDLK 739

Query: 973  XXXXXXXXXXXXXXLEVTNTDKILKTSKSKAFFMSMVDDIVETSNPF-------MITQPX 1025
                          LE  +  K++   KS AF  SMVDDIVE  NPF       M   P 
Sbjct: 740  AYRAKRRQLMKEKRLETDHNKKLMTNKKSHAFLESMVDDIVEVKNPFDERDDNIMDDTPE 799

Query: 1026 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSQSSRKKFVMSEDFVHKTLSFL 1085
                                                    + +KKF++SE FV K+LSFL
Sbjct: 800  TDAEGDVNSNELL---------------------------NKKKKFILSEAFVQKSLSFL 832

Query: 1086 TKSKEVNEFQHVNEHYKSQIG-TINDIQSLKQKSSIKTMHVLSMMSQDTNVXXXXXXXXX 1144
            + S+ + EF+  N   K Q      D+ +LK   SIK++  L     ++           
Sbjct: 833  SSSRNLEEFEMNNNLAKEQHSHAATDMFALKSHCSIKSLESLPGSHNNS-------ISSK 885

Query: 1145 XXMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGM 1204
              ++H     +     P S + K  S+IK F S+ DI+ KFKDGNKTV +S SY+TVG  
Sbjct: 886  LDLLH-----EEIVSTPFSGL-KQTSVIKSFSSSIDIDSKFKDGNKTVKVSKSYRTVGSA 939

Query: 1205 KTSITSFGR-RKLVAPVK 1221
            K SIT  G+ RKLV P K
Sbjct: 940  KASITYLGKARKLVPPKK 957

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 72/165 (43%), Gaps = 3/165 (1%)

Query: 572 AKPKRKVILSQYENRLKENLLYNNSIDLYSDSEENTQSDILFSTASKAQILDIRHXXXXX 631
           +K  + + LS YEN LK+++   N I+ +SDSE+ T+     S ASKA IL I+      
Sbjct: 318 SKESKFIGLSNYENILKKDINKQNCIE-FSDSEDETEVTSKVSRASKATILSIKANLSRH 376

Query: 632 XXXXXXXTIQTNLDQLFNKLKKASKKQIFDHQKNAIXXXXXXXXXXXXXXXXXXNLLEQX 691
                    +  L  LF+ LKKA+K QI DH+K  +                  NLLEQ 
Sbjct: 377 KPAQSSINNKNALGNLFSDLKKATKAQILDHKKEIMEQKGYKMEEIEKEKEIVENLLEQE 436

Query: 692 XXXXXXXXXXXXXXXXXXXXVDDKSVQSASDEDDFDHSANELEDS 736
                                  + +++   E+DF  SANEL DS
Sbjct: 437 IERNRKIRIREKQKEELKKR--KQRIENGDQEEDFAISANELSDS 479

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 38/65 (58%), Gaps = 5/65 (7%)

Query: 3  MDAVFDSLDELKIKKRTTYKKVPE-QVATELDKAATTISNPVPSFNLSEGFLFANDKLEK 61
          MD VFD LD LK KKRTTYKKV +  V  E   +   I  P     L +  LF N KL++
Sbjct: 1  MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEFNIELP----GLGQSILFNNSKLKQ 56

Query: 62 IKNRL 66
          I+NRL
Sbjct: 57 IRNRL 61

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  167 bits (424), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 129/349 (36%), Positives = 163/349 (46%), Gaps = 41/349 (11%)

Query: 872  GASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNEN 931
            G ++ F+ EAEES+DEW GIGG DG+   EYDSEVEK+IDDYS+ + +   +R K+M+EN
Sbjct: 802  GVNQYFEEEAEESDDEWRGIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMDEN 861

Query: 932  KEMDIKMVNRILYDIXXXXXXXXXXXXIXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVTN 991
            KEMD+K+VN+ILYDI            +                           LE  +
Sbjct: 862  KEMDLKLVNKILYDIKNGGFRKRGRNDMELEFSDDEDAELQEFRRKRRELMKQRMLENED 921

Query: 992  TDKILKTSKSKAFFMSMVDDIVETSNPFMITQPXXXXXXXXXXXXXXXXXXXXXXXXXXX 1051
            TDK+ K  KSKAFF SM+ D+VE  N F                                
Sbjct: 922  TDKLTKNPKSKAFFESMIVDLVEDKNNF------------------DDLSDQIELKEENI 963

Query: 1052 XXXXXXXXXXXLSQSSRKKFVMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKSQIGTINDI 1111
                          + R K  +SEDFV KTLSFL   +   EFQ       S+   I D+
Sbjct: 964  TQEDNEKEYNEAKSNKRGKIRISEDFVQKTLSFLHNDESTQEFQP--SFIMSKEKGIGDM 1021

Query: 1112 QSLKQKSSIKTMHVLSMMSQDTNVXXXXXXXXXXXMIHHAGSFDNSFDDPLSSVSKAPSI 1171
             +LK  SS+     LS   +  N            +I    SF            K PSI
Sbjct: 1022 NALKSNSSLSFCSKLSTSRKIIN--------DEEDVIEEFESF------------KRPSI 1061

Query: 1172 IKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGR-RKLVAP 1219
            I+ F S   I+DKFKDGNK+V +S SYKTVGG K SIT  G+ RKLV P
Sbjct: 1062 IQSFSSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPP 1110

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 46/80 (57%), Gaps = 17/80 (21%)

Query: 3  MDAVFDSLDELKIKKRTTYKKV-------PEQVATELDKAATTISNPVPSFNLSE----- 50
          MD +FD L+++KIKKRTTYKKV        +++A E D +   + N   + + SE     
Sbjct: 1  MDFLFDELEQVKIKKRTTYKKVQVVGTGQGDEIARE-DTSNQIVPNNASTSSDSERLLNN 59

Query: 51 ----GFLFANDKLEKIKNRL 66
              GFL  +DKL+ I++RL
Sbjct: 60 VNKKGFLLTSDKLDTIRSRL 79

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 54/99 (54%), Gaps = 6/99 (6%)

Query: 571 IAKPKRK---VILSQYENRLKENLLYNNSIDLYSDSEENTQSDILF--STASKAQILDIR 625
           I+KP+ K   +IL  Y N LK+ +  N  + L SDS++   S +++  S  SKA +L+++
Sbjct: 486 ISKPRWKSSSMILPAYVNNLKQKV-ENKKLQLSSDSDDEVDSAVIYKLSNKSKATLLNLK 544

Query: 626 HXXXXXXXXXXXXTIQTNLDQLFNKLKKASKKQIFDHQK 664
                          + + + LFN L+KA+K+QI  H+K
Sbjct: 545 VRLSKKKPVKKVHNEKDSTNLLFNNLRKATKQQIMLHRK 583

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  153 bits (387), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 111/365 (30%), Positives = 170/365 (46%), Gaps = 69/365 (18%)

Query: 871  VGASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNE 930
            +G +KM ++EA+ESEDEW G+GG D E SDEYDS+++K+IDDY++ +F+P EIR  L +E
Sbjct: 780  LGVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKNEFDPVEIRKILASE 839

Query: 931  NKEMDIKMVNRILYDIXXXXXXXXXXXXIXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVT 990
            + + D  MVN+IL+DI            +                           L+  
Sbjct: 840  DLQHDKNMVNKILHDIKTGGFRKRGRGELDLELSEDEDGILQSYRAKRWNEQKQKMLDSE 899

Query: 991  NTDKILKTSKSKAFFMSMVDDI---VETSNPFMITQPXXXXXXXXXXXXXXXXXXXXXXX 1047
            +   +    KS  FF SMVD+    VE +     + P                       
Sbjct: 900  HNTSVKSNPKSLPFFESMVDEFTIPVERALGTPDSPP----------------------- 936

Query: 1048 XXXXXXXXXXXXXXXLSQSSRKKFVMSEDFVHKTLSFLTKSKEVNEFQ---------HVN 1098
                           L Q++++K V+SE FV +TLSFLT  + +   +         + N
Sbjct: 937  -------AQSTNVLELKQNTKQKIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPNNDN 989

Query: 1099 EHYKSQIGTINDIQSLKQKSSIKTMHVLSMMSQDTNVXXXXXXXXXXXMIHHAGSFDNSF 1158
            + Y S+   + D+ +LK+ S+IK ++  S                            N  
Sbjct: 990  DIYSSE---VEDLYTLKETSTIKVLNTYS-----------------------GKPIVNED 1023

Query: 1159 DDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFG-RRKLV 1217
            +D      KAPS+++ FGS +D+NDKFKDG K+V ISN YKT+G  + +IT  G +RKL+
Sbjct: 1024 EDGAEFGFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSSRAAITFLGKKRKLI 1083

Query: 1218 APVKT 1222
             P ++
Sbjct: 1084 IPKRS 1088

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 43/88 (48%), Gaps = 8/88 (9%)

Query: 580 LSQYENRLKENLLYNNSIDLYSDSEENTQSDILFSTASKAQILDIRHXXXXXXXXXXXXT 639
           L   +N + ++++ ++S D     EE+  +    ST  KA +L+I+              
Sbjct: 410 LQSMKNTVGQDIILDSSSD-----EEHASNQFATSTMVKAALLNIKAKISKNMNLSKNAE 464

Query: 640 IQTN---LDQLFNKLKKASKKQIFDHQK 664
              N   L QLF  LKKA+KKQI DH++
Sbjct: 465 QSINSPTLKQLFISLKKANKKQILDHRR 492

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 925

 Score =  152 bits (385), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 123/350 (35%), Positives = 172/350 (49%), Gaps = 65/350 (18%)

Query: 872  GASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNEN 931
            G +K+ +MEAEESEDEW G+GGADGE SD+YDS+++ +IDD+S+  F+   IR +L  EN
Sbjct: 614  GLNKILEMEAEESEDEWHGVGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALEN 673

Query: 932  KEMDIKMVNRILYDIXXXXXXXXXXXXIXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVTN 991
            KEMD +M+N+IL+DI            +                           LE  N
Sbjct: 674  KEMDERMINKILHDINTGGFRKRGRGALDLELSDDEDELLRQFREKRREIMKQKLLE--N 731

Query: 992  TDKILKTSKSKAFFMSMVDDIVETSNPFMITQPXXXXXXXXXXXXXXXXXXXXXXXXXXX 1051
             D ++  SKSKAFF SMV+DI   S P + +                             
Sbjct: 732  VDGVVNNSKSKAFFDSMVEDITRKSIPAVTS----------------------------- 762

Query: 1052 XXXXXXXXXXXLSQSSRKKFVMSEDFVHKTLSFLT-KSKEVNEFQHVNEHYKSQIGTIND 1110
                         +  +KK V+SE+FV  +LSFL+ K  ++NEF+     + +      D
Sbjct: 763  -------FSNTRDEMGKKKIVISEEFVQSSLSFLSAKDDDINEFEVTEAAHDA----TED 811

Query: 1111 IQSLKQKSSIKTMHVLSMMSQDTNVXXXXXXXXXXXMIHHAGSFDNSFDDPLSSVSKAPS 1170
            ++SLKQ+S+IK     S+ S   N               ++  FD+   D  S   K PS
Sbjct: 812  LESLKQRSNIK-----SLDSPQRN--------------RNSAFFDDV--DGTSLDFKLPS 850

Query: 1171 IIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFG-RRKLVAP 1219
            I+K F S  D+NDKFK G KTVTIS SY+   G +++IT  G +RKL AP
Sbjct: 851  IVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKLKAP 900

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 960

 Score =  147 bits (371), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 140/456 (30%), Positives = 202/456 (44%), Gaps = 74/456 (16%)

Query: 770  LVTEESDSENDNPLESEKIPINPNIINLGHYGDNLDSKSTIFNENSKKFIEDIEQFE-AD 828
            L  E+SDSE+D+ L         NII+LG YG+NL     + +E      ED+E    +D
Sbjct: 541  LPAEDSDSEHDDTLPR-------NIIDLGPYGNNL----QVNHE------EDMENLPLSD 583

Query: 829  XXXXXXXXXXXXXXYKRHIXXXXXXXXXXXXXXXXXXXXXXXVGASKMFDMEAEESEDEW 888
                              I                        G +KM +MEAEESEDEW
Sbjct: 584  SAEIDAAEEEKTNEL---IMEKIRKIEMRKKKKEQRLKDMKAKGLNKMLEMEAEESEDEW 640

Query: 889  FGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNENKEMDIKMVNRILYDIXX 948
             G+GG DG++SDE+DS++E++IDD+++ + N D++R  L  ENKE+D KMVN+ILYDI  
Sbjct: 641  KGVGGVDGDLSDEHDSDLEEMIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIKN 700

Query: 949  XXXXXXXXXXIXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVTNTDKILKTSKSKAFFMSM 1008
                      +                           +E  + +K  + +KSKAF  SM
Sbjct: 701  GGFRKRGRNALDLELSDDEDEDLRNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLESM 760

Query: 1009 VDDIVETSNPFMITQPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSQSSR 1068
            VDDI E+ NPF    P                                          ++
Sbjct: 761  VDDIDESKNPF--GDPEMDVEDNTDVDTQENDYP-----------------------KNK 795

Query: 1069 KKFVMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKSQIGTIN---DIQSLKQKSSIKTMHV 1125
            +K  +S++FV ++LSFL+ +    EF+        QI   +   D+ SLK+ SSI  +H 
Sbjct: 796  EKNTLSQEFVQRSLSFLSNNNSSREFE-----LGEQITLGDEEQDVSSLKRNSSIHALHN 850

Query: 1126 LSMMSQDTNVXXXXXXXXXXXMIHHAGSFDNSFDDPLSSVS-KAPSIIKIFGSTHDINDK 1184
             S                    I      +N  +D ++  + K PS+IK      D N+K
Sbjct: 851  SS------------------SPIKEDLEKENQDEDFITLPNFKPPSLIKSLAGGFDPNNK 892

Query: 1185 FKDGNKTVTISNSYKTVGGMKTSITSFGR-RKLVAP 1219
            F+ G KTVT+S SY+ VGG ++SIT FG+ RKLV P
Sbjct: 893  FQSGKKTVTVSKSYRAVGGSRSSITYFGKMRKLVGP 928

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 3/64 (4%)

Query: 3  MDAVFDSLDELKIKKRTTYKKVPEQVATELDKAATTISNPVPSFNLSEGFLFANDKLEKI 62
          MD++ + LD L  K+RTTYKKV      + ++    ISN  P   L  GFLF N  ++K+
Sbjct: 1  MDSLLEKLDPLSSKRRTTYKKV---FEPQEEEETQQISNSPPPPILGNGFLFQNSTIDKV 57

Query: 63 KNRL 66
          +NRL
Sbjct: 58 RNRL 61

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 56/129 (43%), Gaps = 1/129 (0%)

Query: 563 NKVQLKNVIAKPKRKVILSQYENRLKENLLYNNSIDLYSDSEENTQSDIL-FSTASKAQI 621
           +K  L+N     +R+ + S YE +LK  L     I L  D +E+ +   +  S  SKA +
Sbjct: 310 DKSTLENTTESSQRQRVFSVYEYKLKGELDSKRCIQLDDDEDESDEDVEVPLSRVSKATV 369

Query: 622 LDIRHXXXXXXXXXXXXTIQTNLDQLFNKLKKASKKQIFDHQKNAIXXXXXXXXXXXXXX 681
           LDI+               +T L+ L   LKKASKKQI DHQ   +              
Sbjct: 370 LDIKARRSKQEPLSKIKQKKTTLNDLICTLKKASKKQITDHQNELMKSRGYKLEDIEKQK 429

Query: 682 XXXXNLLEQ 690
               NLLEQ
Sbjct: 430 EEIENLLEQ 438

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
            YCL061C
          Length = 965

 Score =  134 bits (338), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 118/257 (45%), Gaps = 19/257 (7%)

Query: 763  RHKKGLKLVTEESDSENDNPLESEKIPINPNIINLGHYGDNLDSKSTIFNENSKKFIEDI 822
            +HKK    + ++SDSE +  +   K  I  N I+LGHYGDN+                 I
Sbjct: 525  KHKKTE--IVDDSDSEIEAQIVDSKEIITANTIDLGHYGDNI-----------------I 565

Query: 823  EQFEADXXXXXXXXXXXXXXYKRHIXXXXXXXXXXXXXXXXXXXXXXXVGASKMFDMEAE 882
            +Q                  Y   I                        G SKMF++EAE
Sbjct: 566  QQSRETLNETEESDEEDEERYNAIISEGIRKQKELEKREAKRLKEMKTSGVSKMFEVEAE 625

Query: 883  ESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNENKEMDIKMVNRI 942
            ESEDEW GIGG D + SD YDSEVEK+IDDYSRQ+FNP EIR  L  ENKE D+ +VN+I
Sbjct: 626  ESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSEIREMLAKENKETDLALVNKI 685

Query: 943  LYDIXXXXXXXXXXXXIXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVTNTDKILKTSKSK 1002
            LYDI                                        L++    KI+K  KSK
Sbjct: 686  LYDIKNGGFRTRKRRDRDLEFSDDDDDDLKAYRAKRRALMREKRLDIEGDKKIVKNPKSK 745

Query: 1003 AFFMSMVDDIVETSNPF 1019
            AFF S+VDDI+ET NPF
Sbjct: 746  AFFESIVDDIIETKNPF 762

 Score = 84.7 bits (208), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 61/182 (33%), Positives = 89/182 (48%), Gaps = 18/182 (9%)

Query: 1071 FVMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKSQIGT-INDIQSLKQKSSIKTMHVLSMM 1129
             V+SE+FV ++LSFL   +E +EF+  N+H   +  T   D+ +LK+ SSIKT+  ++  
Sbjct: 799  IVISEEFVQRSLSFLNSCREQDEFEINNQHNGGEKATSTADLYTLKRYSSIKTLQSVTSS 858

Query: 1130 SQDTNVXXXXXXXXXXXMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGN 1189
               +                 +GS  N          +  S++  F S  DIN KFK+G 
Sbjct: 859  RSSSIASNLNEQPS-----QSSGSLFNDL--------RKTSVLNSFSSDVDINSKFKEGT 905

Query: 1190 KTVTISNSYKTVGGMKTSITSFG-RRKLVAPVKTHXXXXXXXXXXXXXXXXXXLFRNQDK 1248
            K+V +SN+YKTVG  + SIT  G  R+LVAP K+                   LF NQ+ 
Sbjct: 906  KSVKVSNAYKTVGSARASITYMGTSRRLVAPKKSR---LTTSSKANSRTTPSRLFDNQEG 962

Query: 1249 SF 1250
            SF
Sbjct: 963  SF 964

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 69/157 (43%), Gaps = 6/157 (3%)

Query: 580 LSQYENRLKENLLYNNSIDLYSDSEENTQSDILFSTASKAQILDIRHXXXXXXXXXXXXT 639
           L  YE+ L+     N  I  +S+S+E++ ++I  S ASKA IL+IR             +
Sbjct: 323 LGNYEHNLRRKA-NNEQIIEFSESDEDSDTNISPSYASKAVILNIRANKSKQQPKVSQKS 381

Query: 640 IQTNLDQLFNKLKKASKKQIFDHQKNAIXXXXXXXXXXXXXXXXXXNLLEQXXXXXXXXX 699
            QT L  L+N LK+ASK+QI  +QK  +                  NLLEQ         
Sbjct: 382 DQTTLLMLYNNLKRASKEQIVSYQKELMEKKGINLEELEKENEIVENLLEQEIARNQKIR 441

Query: 700 XXXXXXXXXXXXVDDKSVQSASDEDDFDHSANELEDS 736
                        D       S+ ++FD SANELEDS
Sbjct: 442 QREKQKQKKENQDD-----LNSNPEEFDLSANELEDS 473

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 3  MDAVFDSLDELKIKKRTTYKKVPEQVATELDKAATTISNPVPS--FNLSEGFLFANDKLE 60
          MD++FD L+  K KKRTTY K+P  +  E  ++   + N        L  G LF N  L 
Sbjct: 1  MDSLFDQLNHFK-KKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDGGILFGNSILG 59

Query: 61 KIKNRLN 67
          +I+NRLN
Sbjct: 60 QIRNRLN 66

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  117 bits (294), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 109/364 (29%), Positives = 159/364 (43%), Gaps = 75/364 (20%)

Query: 872  GASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNEN 931
            G +KM +MEAEESEDEW GIGG+D E+S++YDSEVEK+IDDYS    N D +R  L    
Sbjct: 685  GITKMLEMEAEESEDEWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAILAKNE 744

Query: 932  KEMDIKMVNRILYDIXXXXXXXXXXXXIXXXXXXXXXXXXXXXXXXXXXXXXXXXLEVTN 991
            ++ D  +VN+IL+DI            +                           LE  +
Sbjct: 745  RQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKILENGD 804

Query: 992  TDKILKTSKSKAFFMSMVDDIVETS--NPFMI-----TQPXXXXXXXXXXXXXXXXXXXX 1044
            T K++   KS AFF +MVDD+ E S  N F       T P                    
Sbjct: 805  TSKLVSNPKSYAFFQTMVDDVTEASFGNTFDANIDEKTDPS------------------- 845

Query: 1045 XXXXXXXXXXXXXXXXXXLSQSSRKKFVMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKS- 1103
                                 ++ +K V+SE FV +TLSFL+     +E     +   S 
Sbjct: 846  ---------------------AAGRKIVISEQFVKETLSFLSSKSGDSEIPAETKSISSS 884

Query: 1104 --QIGTINDIQSLKQKSSIK----TMHVLSMMSQDTNVXXXXXXXXXXXMIHHAGSFDNS 1157
              +   I D+ +LKQ S+IK    ++ + + M++                +      D  
Sbjct: 885  TVEREEIQDLHTLKQNSNIKHLKGSLELPAQMAE----------------LSSGDEGDYG 928

Query: 1158 FDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGRRKLV 1217
            F     S+ +  S  K F +  +++DKFK G K V I  + KT+GG K +IT  GR++ +
Sbjct: 929  F-----SLDRFRSAAKSFNNGTNVDDKFKSGTKAVRILKANKTIGGSKAAITFIGRKRRL 983

Query: 1218 APVK 1221
             P K
Sbjct: 984  IPPK 987

 Score = 33.1 bits (74), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 1/80 (1%)

Query: 612 LFSTASKAQILDIRHXXXX-XXXXXXXXTIQTNLDQLFNKLKKASKKQIFDHQKNAIXXX 670
           L S  SKA +L I+              T  +  ++LF KL+KA+++Q+ + ++NAI   
Sbjct: 380 LSSAVSKAAVLAIKARNSKFITPQKIDETKSSKSNELFAKLRKANREQLLEQRRNAIERR 439

Query: 671 XXXXXXXXXXXXXXXNLLEQ 690
                          NLLEQ
Sbjct: 440 GINMQNLEQEREQLGNLLEQ 459

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  111 bits (277), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 70/150 (46%), Positives = 90/150 (60%), Gaps = 2/150 (1%)

Query: 872  GASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNEN 931
            G +K F+MEAEESEDEW GIGG DGE+SDEYDS+VEK+IDDYS+ +F+P+EIR  L  EN
Sbjct: 724  GVTKFFEMEAEESEDEWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAEN 783

Query: 932  KEMDIKMVNRILYDIXXXXXXXXXXXXIXXXXXXXXXXXXXXXX-XXXXXXXXXXXLEVT 990
            KEMD+ M+N+ILYDI            +                            LE+ 
Sbjct: 784  KEMDLNMINKILYDIKNGGFRKRKRGGLELELSEDEDDDALREYHLKRKELMRKRRLELG 843

Query: 991  NTD-KILKTSKSKAFFMSMVDDIVETSNPF 1019
            + + K++K  KSKAFF SMV+DI +  N F
Sbjct: 844  DDEKKLVKNPKSKAFFESMVEDITDDKNAF 873

 Score = 96.7 bits (239), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 87/152 (57%), Gaps = 16/152 (10%)

Query: 1074 SEDFVHKTLSFLTKSKEVNEFQHVNEHYKSQIGT-INDIQSLKQKSSIKTMHVLSMMSQD 1132
            SE+FV +TLSFL  S+E  EF       K Q GT + ++ SLKQ+SSIK     S  S  
Sbjct: 918  SEEFVQRTLSFLKSSREDEEFAMNENLAKEQHGTKVENLLSLKQQSSIKVFQSPSNNS-- 975

Query: 1133 TNVXXXXXXXXXXXMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHDINDKFKDGNKTV 1192
                          +       D+  D P++ + K PSI+K FGS  DIN+KF+DGNKTV
Sbjct: 976  ---------SKVIKLDDINNDDDDDEDSPIA-LFKVPSILKSFGSKTDINEKFQDGNKTV 1025

Query: 1193 TISNSYKTVGGMKTSITSFGR-RKLVAPVKTH 1223
            TIS SY+TVG  K SIT  G+ RKL+AP  TH
Sbjct: 1026 TISKSYRTVGSSKASITYLGKSRKLMAP--TH 1055

 Score = 56.6 bits (135), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 73/162 (45%), Gaps = 8/162 (4%)

Query: 580 LSQYENRLKENLLYNNSIDLYSDSE--ENTQSDILFSTASKAQILDIRHXXXXXXXXX-- 635
           LS+YEN+LK  L   N + L SD E  ++T++ +  S  SKA IL I+            
Sbjct: 411 LSRYENKLKTVLNSKNQLQLGSDDESSDDTENSLPVSRTSKATILTIKARLSKQKSKKNV 470

Query: 636 -XXXTIQTNLDQLFNKLKKASKKQIFDHQKNAIXXXXXXXXXXXXXXXXXXNLLEQXXXX 694
               T+ TNL++LF  LKK+S+KQI ++Q+  I                  NLLEQ    
Sbjct: 471 QKDGTVNTNLNKLFENLKKSSRKQILENQRELIENKGLNFEDIEMEKELVENLLEQEIKR 530

Query: 695 XXXXXXXXXXXXXXXXXVDDKSVQSASDED-DFDHSANELED 735
                             +D    S +D D +FD SANE E+
Sbjct: 531 NQKIRQREKEREDKKNNANDSD--SVNDSDVEFDLSANEQEE 570

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 7/70 (10%)

Query: 3  MDAVFDSLDELKIKKRTTYKK------VPEQVATELDKAATTISNPVPSFNLSEGFLFAN 56
          MD++ D L  +   ++TTY K      + EQ    +    T+  N  P+  L  GFLF N
Sbjct: 1  MDSLIDDLKPVTKVRKTTYNKKSLDPSIEEQEEDGILTDVTSGGNVTPTI-LGTGFLFKN 59

Query: 57 DKLEKIKNRL 66
            ++K++ RL
Sbjct: 60 STIDKVRARL 69

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
           YCL061C (MRC1) - protein involved in replication
           checkpoint [contig 123] FULL
          Length = 970

 Score = 98.2 bits (243), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 57/74 (77%)

Query: 873 ASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNENK 932
           A+ M D EAEES+DEWFG+GGADGE SD YDSE++++IDDYS    +P+ +R KLM E K
Sbjct: 635 ANGMIDFEAEESDDEWFGVGGADGENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEK 694

Query: 933 EMDIKMVNRILYDI 946
             D  MV+RIL+DI
Sbjct: 695 LHDKDMVDRILHDI 708

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 68/157 (43%), Gaps = 29/157 (18%)

Query: 1066 SSRKKFVMSEDFVHKTLSFLTKSKEVN----EFQHVNEHYKSQIGTI---NDIQSLKQKS 1118
            S +++  +SE FV KTLSFL KSKE      EF  V +  +S  G      D   LKQ S
Sbjct: 800  SGKRETRISEQFVQKTLSFL-KSKEDEQGDAEFVSVADTQESSSGDFAEATDFYRLKQLS 858

Query: 1119 SIKTMHVLSMMSQDTNVXXXXXXXXXXXMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGST 1178
             IK+       S    V                        D + S     ++++ F  +
Sbjct: 859  GIKSFSAPLRSSIRLQVRNK---------------------DGVLSGKANTTLVERFVRS 897

Query: 1179 HDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGRRK 1215
             D N+KF++G KTV   NSYK  G  + SIT  G+ +
Sbjct: 898  VDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKAR 934

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 993

 Score = 88.2 bits (217), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 54/74 (72%)

Query: 873 ASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNENK 932
           AS++ D EAEES+DEW GIGG DGE  D++DS++EK+IDDYS   F+  E+R + + E  
Sbjct: 651 ASRIIDYEAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEI 710

Query: 933 EMDIKMVNRILYDI 946
             D  MVN+IL+DI
Sbjct: 711 SEDKSMVNKILHDI 724

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 79/163 (48%), Gaps = 31/163 (19%)

Query: 1069 KKFVMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKS---QIGTIN-----DIQSLKQKSSI 1120
            KK V+SE FV +TLSFLT S EV E +    +  S    + + N     DI +LKQ SSI
Sbjct: 825  KKTVLSEAFVQQTLSFLT-SGEVGEEKGPENNLGSLPTHVPSFNTEETQDIFALKQNSSI 883

Query: 1121 KTMHVLSMMSQDTNVXXXXXXXXXXXMIHHAGSFDNSFDDPLSSVSKAPSIIKIFGSTHD 1180
            K++   +  S +              M+      D+  D  L S  +A S    F    D
Sbjct: 884  KSLSAPTRNSSN--------------ML-----IDDQED--LLSRKRACSFFARFTKRVD 922

Query: 1181 INDKFKDGNKTVTISNSYKTVGGMKTSITSFGR-RKLVAPVKT 1222
             N+KF++G KTV   NSYK  G  K SIT  G+ RKL AP K 
Sbjct: 923  ANEKFEEGKKTVRSLNSYKVAGSSKASITYLGKARKLNAPKKV 965

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.126    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 113,528,022
Number of extensions: 4930434
Number of successful extensions: 24561
Number of sequences better than 10.0: 237
Number of HSP's gapped: 25714
Number of HSP's successfully gapped: 311
Length of query: 1252
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1131
Effective length of database: 39,606,813
Effective search space: 44795305503
Effective search space used: 44795305503
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 72 (32.3 bits)