Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A075601.9ON74174136220.0
Kpol_2002.121.9ON73968425720.0
ZYRO0F18392g1.9ON72568124790.0
KNAG0C002601.9ON74467824520.0
KAFR0D001801.9ON72368224360.0
TPHA0E039701.9ON74768624290.0
NCAS0B090701.9ON73068423970.0
SAKL0C00550g1.9ON73268523860.0
NDAI0A001801.9ON74068123760.0
KLLA0C00572g1.9ON71268022880.0
YCL057W (PRD1)1.9ON71268122520.0
CAGL0B00418g1.9ON74368722490.0
Skud_3.71.9ON71268122380.0
Smik_3.181.9ON71268122170.0
Suva_3.1561.9ON71268121960.0
Ecym_1011na 1ON71668320270.0
AGR406C1.9ON68368816480.0
AGR405Cna 1ON71768816030.0
ABR185WsingletonON4574158771e-109
NDAI0E020102.432ON7785594781e-49
Kpol_297.82.432ON7875134523e-46
SAKL0E03938g2.432ON7676764337e-44
KNAG0A062002.432ON7895414292e-43
Ecym_60992.432ON7735494274e-43
Kwal_26.76162.432ON7705114203e-42
TBLA0I007102.432ON7735114194e-42
CAGL0D02112g2.432ON7615154098e-41
KLTH0D04730g2.432ON7725194053e-40
Skud_11.932.432ON7724944043e-40
ZYRO0G20130g2.432ON7864994027e-40
KAFR0D029502.432ON7774834001e-39
Suva_11.912.432ON7755133991e-39
NCAS0A042802.432ON7735573902e-38
YKL134C (OCT1)2.432ON7724943866e-38
AFR198W2.432ON7764993822e-37
TPHA0G023902.432ON7955623823e-37
Smik_11.1022.432ON7724943752e-36
TDEL0A020802.432ON7875203724e-36
KLLA0B12397g2.432ON7795203539e-34
ZYRO0D06710g8.282ON320108820.23
Kwal_23.56605.295ON11153750.43
Smik_12.4414.186ON60750771.3
KAFR0F031904.101ON21067722.9
KAFR0A086203.9ON104945709.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07560
         (741 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...  1399   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....   995   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...   959   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...   949   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...   942   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...   940   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...   927   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...   923   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9        919   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...   885   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...   872   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   870   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)    866   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)   858   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...   850   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   785   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   639   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   622   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   342   e-109
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   188   1e-49
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   178   3e-46
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   171   7e-44
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   169   2e-43
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   169   4e-43
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   166   3e-42
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   166   4e-42
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   162   8e-41
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   160   3e-40
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   160   3e-40
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   159   7e-40
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   158   1e-39
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   158   1e-39
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   154   2e-38
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   153   6e-38
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   151   2e-37
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   151   3e-37
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   149   2e-36
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   147   4e-36
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   140   9e-34
ZYRO0D06710g Chr4 complement(579323..580285) [963 bp, 320 aa] {O...    36   0.23 
Kwal_23.5660 s23 (1258943..1259278) [336 bp, 111 aa] {ON} YDR286...    33   0.43 
Smik_12.441 Chr12 (773399..775222) [1824 bp, 607 aa] {ON} YLR353...    34   1.3  
KAFR0F03190 Chr6 complement(632585..633217) [633 bp, 210 aa] {ON...    32   2.9  
KAFR0A08620 Chr1 (1727701..1730850) [3150 bp, 1049 aa] {ON} Anc_...    32   9.2  

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score = 1399 bits (3622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 691/741 (93%), Positives = 691/741 (93%)

Query: 1   MWLANQTSVLFLRCYGLFAREFNYSIVFKNQFNLRSIQNLPLNFKXXXXXXXXXACVNLN 60
           MWLANQTSVLFLRCYGLFAREFNYSIVFKNQFNLRSIQNLPLNFK         ACVNLN
Sbjct: 1   MWLANQTSVLFLRCYGLFAREFNYSIVFKNQFNLRSIQNLPLNFKSSYSSMSSSACVNLN 60

Query: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120
           APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN
Sbjct: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120

Query: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP 180
           QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP
Sbjct: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP 180

Query: 181 KDLENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFVAFTK 240
           KDLENYEFVRKVHRDFVRAGLNLDESKR           NNSLKFATNLGEQTEFVAFTK
Sbjct: 181 KDLENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEFVAFTK 240

Query: 241 EELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKV 300
           EELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKV
Sbjct: 241 EELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKV 300

Query: 301 SENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGXXX 360
           SENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLG   
Sbjct: 301 SENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGSKE 360

Query: 361 XXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEGM 420
                          NLPFDNHYYVWDHR            VDLEKISEYYPLDSTIEGM
Sbjct: 361 IEILKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDSTIEGM 420

Query: 421 LNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKY 480
           LNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKY
Sbjct: 421 LNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKY 480

Query: 481 GHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHDL 540
           GHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHDL
Sbjct: 481 GHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHDL 540

Query: 541 VGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVA 600
           VGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVA
Sbjct: 541 VGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVA 600

Query: 601 TKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYDS 660
           TKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYDS
Sbjct: 601 TKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYDS 660

Query: 661 FGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIEDN 720
           FGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIEDN
Sbjct: 661 FGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIEDN 720

Query: 721 LIQFLGRKPSNEAFLKELGLN 741
           LIQFLGRKPSNEAFLKELGLN
Sbjct: 721 LIQFLGRKPSNEAFLKELGLN 741

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score =  995 bits (2572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/684 (68%), Positives = 554/684 (80%), Gaps = 2/684 (0%)

Query: 59  LNAPQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSL 118
           L APQ APTWNWTP  +VKDAE LI  SN  +D L  + SP   NF+VPYMN+ENKV  L
Sbjct: 57  LIAPQPAPTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENKVSPL 116

Query: 119 INQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEK 178
           INQLTFLQHVS++KDIRD+S KAT+L+QNFEIE SLR  LF+QFDKIW  +KD+ +  EK
Sbjct: 117 INQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEK 176

Query: 179 -DPKDLENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFVA 237
            D K+ E+Y F+ K H+DF+R+GLNL + KR           +NSL F+ NLGEQ EF+A
Sbjct: 177 SDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIA 236

Query: 238 FTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQ 297
           FTKEELDGVSD+VMEQFEKF DEKTG+E +KVTFKYPDI PVLK+A+NP TRK AF  DQ
Sbjct: 237 FTKEELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQ 296

Query: 298 NKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLG 357
           NKV EN  LF +TLKLRN L+ +L YS YANYNLE+KMAK +++VF FL+DL  +L+PLG
Sbjct: 297 NKVPENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPLG 356

Query: 358 XXXXXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTI 417
                             NLP+DNHYY+WDHR            VDLEKISEYYP++S+I
Sbjct: 357 LKEIEILKQLKEKDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESSI 416

Query: 418 EGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRD 477
           +GML IYET++ LKF+EE D +K +NVWH++VKQL+VWKMDNP+ PEF+GWIYFDLHPRD
Sbjct: 417 DGMLKIYETVMKLKFVEETDPAK-RNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRD 475

Query: 478 GKYGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGI 537
           GKYGHAANFGISSSY+  N++RSYPVTALVCNFSK T+DKP+LLKHNE+TTFFHELGHGI
Sbjct: 476 GKYGHAANFGISSSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGI 535

Query: 538 HDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNS 597
           HDLVG N  SR NGPG+VPWDFVEAPSQMLEFWTWNKNEL+SLSKHYKTGEKIP  L+ S
Sbjct: 536 HDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIES 595

Query: 598 LVATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKG 657
           LV+TKHVNGALFALRQLHF  FDM+VHT++D+  L+ L+LWN LRE++ LVENGD  +KG
Sbjct: 596 LVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKG 655

Query: 658 YDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEI 717
           YDSFGHIMS +YSAGYYGYMWAEVFATDMYYTKFAA+PL +K GVEYRD +L+RGG+YE+
Sbjct: 656 YDSFGHIMSGAYSAGYYGYMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEV 715

Query: 718 EDNLIQFLGRKPSNEAFLKELGLN 741
            DNL +FLGR+P+N AFLKE+GLN
Sbjct: 716 NDNLEEFLGREPNNSAFLKEMGLN 739

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/681 (68%), Positives = 542/681 (79%), Gaps = 4/681 (0%)

Query: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120
           APQ+AP+W +TP  L+ +   LI+ S  FYD+L  L +P   N + PYM++EN VG + +
Sbjct: 49  APQSAPSWAFTPQSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIES 108

Query: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP 180
           QLTF Q VS++K+IRDAS +AT+ LQNF IE SLR+ LFLQFDKIWN++KD    +E+  
Sbjct: 109 QLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNELKDKS--FEQGS 166

Query: 181 KDLENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFVAFTK 240
           ++ E Y++V K+HRD+ R GL L E KR            NSL+F+ NLGEQ EFVAFTK
Sbjct: 167 QEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTK 226

Query: 241 EELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKV 300
           EELDGVS+SVM+QFE+F DE  G   YKVTFKYPDIFPVLKTA+NP+TRK AFA DQ+KV
Sbjct: 227 EELDGVSESVMDQFEQFKDE-NGTTKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKV 285

Query: 301 SENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGXXX 360
            +N  LF  TL+LRN+LADILGYSTYANYNLELKMAK QD+V+KFL +L D+LKPLG   
Sbjct: 286 PQNEKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKE 345

Query: 361 XXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEGM 420
                           LP+D HYYVWDHR            VDLEKISEYYP++STI GM
Sbjct: 346 AENLKQIKQKECESLGLPYDGHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPIESTISGM 405

Query: 421 LNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKY 480
           L+IYETLL LKF+EE D  K ++VWH++VKQLAVWKMDNP  PEFVGWIYFDLHPRDGKY
Sbjct: 406 LSIYETLLKLKFVEETDPEK-RSVWHEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKY 464

Query: 481 GHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHDL 540
           GHAANFGIS+SY+K +  RSYPVTALVCNFSK +A KP+LLKHNEI+TFFHELGHGIHDL
Sbjct: 465 GHAANFGISASYVKEDGTRSYPVTALVCNFSKPSAKKPSLLKHNEISTFFHELGHGIHDL 524

Query: 541 VGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVA 600
           VG+N  + FNGPGAVPWDFVEAPSQMLEFWTWN+ EL  LS HY++GEKIP +LL SL++
Sbjct: 525 VGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIPKDLLQSLIS 584

Query: 601 TKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYDS 660
           TKHV+GALFALRQLHFGLFDM VHTSK++  LD LKLWNELREEVSLVENGD FTKGYDS
Sbjct: 585 TKHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDS 644

Query: 661 FGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIEDN 720
           FGHIMSDSYSAGYYGYMWAEVFA DMY+T+FAA+PL++K GV+YRD VL RGGLYE  DN
Sbjct: 645 FGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDN 704

Query: 721 LIQFLGRKPSNEAFLKELGLN 741
           L +FLGR+PS EAFLKELGLN
Sbjct: 705 LREFLGREPSEEAFLKELGLN 725

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score =  949 bits (2452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/678 (66%), Positives = 538/678 (79%), Gaps = 1/678 (0%)

Query: 64  AAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLINQLT 123
           A P W +  +++ ++A  +I+ +N FYD L  + +P  +N + PYMN+EN +G ++NQL 
Sbjct: 67  ALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGLMVNQLC 126

Query: 124 FLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDPKDL 183
           FLQHVSS+K+IR+AS KAT+LLQNFEIETSLR+ LFLQFDKIW ++K  K+++  D +  
Sbjct: 127 FLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFSHDEEQF 186

Query: 184 ENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFVAFTKEEL 243
           E Y+FV K H+DFVRAGLNL E  R           +NSL+F+ NLGEQ EF+ F+KE+L
Sbjct: 187 EIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLLFSKEQL 246

Query: 244 DGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKVSEN 303
           DGVSD+VMEQFE+  DE T +  YKVTFKYPDIFPVLK A+N ETRK AF GDQNKV +N
Sbjct: 247 DGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQN 306

Query: 304 TVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGXXXXXX 363
             LF  TLKLR++LA +LGY TYANYNLE+KMAK Q +VFKFL DL D+LKPLG      
Sbjct: 307 EELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKLKPLGEKEIGI 366

Query: 364 XXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEGMLNI 423
                        +PFD  YY+WDHR            VD E I+EYYP+DSTIEGML I
Sbjct: 367 LKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLKI 426

Query: 424 YETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKYGHA 483
           YET+  LKF+EEKD +K KNVW+++VKQ+AVWKMDN + P FVGWIYFDLHPRDGKYGHA
Sbjct: 427 YETVFKLKFVEEKDTAK-KNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHA 485

Query: 484 ANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHDLVGK 543
           ANFGI+SSYI+ +  RSYPVTALVCNFSK +A KP+LLKHNEITTFFHELGHGIHDLVGK
Sbjct: 486 ANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGK 545

Query: 544 NNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVATKH 603
           N  +RFNGPGA PWDFVEAPSQMLEF+TW+KN L SLSKHYKTGE+IP +LL+SL+ATKH
Sbjct: 546 NRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKH 605

Query: 604 VNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYDSFGH 663
           VNGALFALRQLHFGLFDM VHTSKD+ +LD LKLW +LR+E+SLVENG  +TKGYDSFGH
Sbjct: 606 VNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGH 665

Query: 664 IMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIEDNLIQ 723
           IMSDSYSAGYYGYMWAEVFATDMY TKFA NPL++ VG++YRD VLA GGLYEI+DNL +
Sbjct: 666 IMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKE 725

Query: 724 FLGRKPSNEAFLKELGLN 741
           FLGR+PS +AFLKELGL 
Sbjct: 726 FLGREPSKDAFLKELGLQ 743

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score =  942 bits (2436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/682 (67%), Positives = 533/682 (78%), Gaps = 5/682 (0%)

Query: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120
           APQAAP+WNW PS+L+ DAE +ID SN  YD L++LK P   N + PYM +ENK+  LIN
Sbjct: 44  APQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLIN 103

Query: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP 180
           +L FLQHVS +  IR+AS KAT+LLQ FEIE SLR+ LFLQFDKIW +I + KD + K+ 
Sbjct: 104 KLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFVKE- 162

Query: 181 KDLENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFVAFTK 240
            D E ++F+ KVH+D+VR+GLNL E KR           NNSL+++ NLGEQ E +AFT+
Sbjct: 163 YDFETWKFIEKVHKDYVRSGLNLPEDKREKIKEIKIKIGNNSLQYSKNLGEQKELIAFTR 222

Query: 241 EELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKV 300
           EELDGVSD+V EQFEKF DE+TG+E +KVTFKYPDIFPVLKTA+NPETR+KAF  DQNKV
Sbjct: 223 EELDGVSDAVFEQFEKFIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKV 282

Query: 301 SENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGXXX 360
            +N  LF  TLKLRN+LA  L YSTYANYNLE KMAK Q++V  FL DL  RLKPL    
Sbjct: 283 PQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKE 342

Query: 361 XXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEGM 420
                          N  +D+HYY++DHR            VDLE ISEYYPL+ TI GM
Sbjct: 343 ISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGM 402

Query: 421 LNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKY 480
           L IYE L  LKF EE   +KNK+VWH++VKQLAVWKMDNPE PEFVGWIYFDLHPRDGKY
Sbjct: 403 LKIYEELFKLKFNEE---TKNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKY 459

Query: 481 GHAANFGISSSYIK-PNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHD 539
           GHAANFGISSSY+     +RSYPVTALVCNFSK TA +P+LLKHNEITTFFHELGHGIHD
Sbjct: 460 GHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHD 519

Query: 540 LVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLV 599
           LVGKN  SRFNGPGA PWDFVEAPSQMLEFWTWN NEL SLS HY++ EKIP +LL SL+
Sbjct: 520 LVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLI 579

Query: 600 ATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYD 659
            TKHVNGALFALRQLHFGLFDM VHT+ ++E+L+ LKLWNELREE+ LVE G   +KGYD
Sbjct: 580 KTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYD 639

Query: 660 SFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIED 719
           SFGHIMSDSYSAGYYGYMWAEVFA DMY+TKF+ NPL+++VGV+YRD VLA GGLYEI D
Sbjct: 640 SFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIAD 699

Query: 720 NLIQFLGRKPSNEAFLKELGLN 741
           NL  FLGR+PS  AFLKELGL+
Sbjct: 700 NLRDFLGREPSKNAFLKELGLD 721

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score =  940 bits (2429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/686 (66%), Positives = 536/686 (78%), Gaps = 6/686 (0%)

Query: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120
           APQ +P W+++P +++ DA+ +ID SN FY+A+  +++P   NF++P +N+EN+    IN
Sbjct: 61  APQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAIN 120

Query: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSK---DKYE 177
           QLTFLQHVS +K IRDAS +AT+L+ NF+IE SLRY +F QFDKI+N +KD+K   D   
Sbjct: 121 QLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFDKIFNDLKDNKKYNDLKT 180

Query: 178 KDPKDLENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFVA 237
             PKD E +++V K H+D+VR+GLNL E KR            NSL+F+ NLGEQ EFVA
Sbjct: 181 ATPKDYEIFKYVEKCHKDYVRSGLNLSEEKRNEIKEIKKRIALNSLQFSKNLGEQNEFVA 240

Query: 238 FTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQ 297
           FTKEEL+GVSD VM+QFE + DE+TG++ +KVTFKYPDIFPVLKTA+NP TRK AF  DQ
Sbjct: 241 FTKEELEGVSDDVMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQ 300

Query: 298 NKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLG 357
           NKV EN  LF +TLKLR QL  ILGY TYANYNL++KMAK Q++V +FL DL D+LKPL 
Sbjct: 301 NKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLA 360

Query: 358 XXXXXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTI 417
                             N+ +D+HYY+WDHR            VDLEKISEYYP++STI
Sbjct: 361 EKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTI 420

Query: 418 EGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRD 477
           +GML IYET++NLKFIEE D          +VKQLAVWKMD+P  PEFVGWIYFDLHPR+
Sbjct: 421 QGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPRE 480

Query: 478 GKYGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGI 537
           GKYGHAANFG++ SYI  +++R YPVTALVCNFS  TADKPALLKHNEITTFFHELGHGI
Sbjct: 481 GKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGI 540

Query: 538 HDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNS 597
           HDLVG N   RFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIP  LL S
Sbjct: 541 HDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLES 600

Query: 598 LVATKHVNGALFALRQLHFGLFDMKVHTSKD---LENLDFLKLWNELREEVSLVENGDLF 654
           L+ATKHVNGALFALRQLHFGLFDMKVHT+ D   ++N+D ++LWN LREE+SLVENGD  
Sbjct: 601 LIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEM 660

Query: 655 TKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGL 714
            KGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYY+KFA +PL TK G+EYRD +LARGG+
Sbjct: 661 NKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGI 720

Query: 715 YEIEDNLIQFLGRKPSNEAFLKELGL 740
            E  DNL +FLGR+PS EAFLKELGL
Sbjct: 721 RETNDNLKEFLGREPSKEAFLKELGL 746

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score =  927 bits (2397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/684 (66%), Positives = 541/684 (79%), Gaps = 5/684 (0%)

Query: 59  LNAPQA-APTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGS 117
           L AP   APTW W+P  ++   +++ID + + YD+L  ++ P   + + PYM+YEN  G 
Sbjct: 50  LVAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSLAAIEEPSVESLVKPYMHYENDEGL 109

Query: 118 LINQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYE 177
           ++NQLTFLQHVS++K IRDAS +AT+LLQ+F IE S+R  LF QFDKIWNQ+KD  D   
Sbjct: 110 IVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMRLDLFQQFDKIWNQVKDDDDLKS 169

Query: 178 KDPKDLENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFVA 237
           KD    E Y+F+ KVH+D+VR GLNL E KR           +NSL ++ NLGEQ E+V+
Sbjct: 170 KD---FETYKFIEKVHKDYVRNGLNLPEEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVS 226

Query: 238 FTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQ 297
           FTKE+L GVS+SVMEQFEKF D KT +E YKVTFKYPDIFPVLKTA+ P+TRK A+  DQ
Sbjct: 227 FTKEQLKGVSESVMEQFEKFVDPKTNEEKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQ 286

Query: 298 NKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLG 357
           NKV +N  LF  TLKLRNQLA +LGYSTYANYNL++KMAK Q++VF F+ +L D+LKPLG
Sbjct: 287 NKVPQNEALFVETLKLRNQLAQLLGYSTYANYNLDIKMAKNQETVFDFVNNLKDKLKPLG 346

Query: 358 XXXXXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTI 417
                              L +D+HYY+WDHR            VDLE+ISEYYPL+STI
Sbjct: 347 QKEIETLKTLKKKDCEELGLAYDDHYYIWDHRYYDNKFLKDNYNVDLEQISEYYPLESTI 406

Query: 418 EGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRD 477
           +GML IYETLL LKF++E +  K K+VWH++VKQLAVWKMD+ +NPEF+GWIYFDLHPRD
Sbjct: 407 KGMLGIYETLLKLKFVDETN-PKIKDVWHEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRD 465

Query: 478 GKYGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGI 537
           GKY HAANFGISSSYI  + +RS+PVTALVCNFSK T  KP+LLKHNEITTFFHELGHGI
Sbjct: 466 GKYSHAANFGISSSYITQDGDRSFPVTALVCNFSKSTDKKPSLLKHNEITTFFHELGHGI 525

Query: 538 HDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNS 597
           HDLVGKN  +RFNGPGA PWDFVEAPSQMLEFWTWNKNELLSLS HY+TGEKI  +LL+S
Sbjct: 526 HDLVGKNKCARFNGPGATPWDFVEAPSQMLEFWTWNKNELLSLSGHYQTGEKISEDLLDS 585

Query: 598 LVATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKG 657
           L+ATKHVNGALFALRQLHFGLFDM VHT+K++E+L+ LKLWNELRE++ LVENG+  TKG
Sbjct: 586 LIATKHVNGALFALRQLHFGLFDMTVHTTKNVEDLNLLKLWNELREKICLVENGNELTKG 645

Query: 658 YDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEI 717
           YDSFGHIMSDSYSAGYYGYMWAEVFA DMYYTKFA++PL ++ GV+YRD VLA GGLYEI
Sbjct: 646 YDSFGHIMSDSYSAGYYGYMWAEVFAADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEI 705

Query: 718 EDNLIQFLGRKPSNEAFLKELGLN 741
            D L +FLGR+P+N+AFLKELGL+
Sbjct: 706 ADKLKEFLGREPTNDAFLKELGLH 729

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score =  923 bits (2386), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/685 (65%), Positives = 538/685 (78%), Gaps = 6/685 (0%)

Query: 57  VNLNAPQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVG 116
             L  PQAAP+W ++P  +++   + I  ++  +DAL  +++P   + + P++ +EN   
Sbjct: 54  ATLVPPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQ 113

Query: 117 SLINQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKY 176
            LINQLTFLQHVS++K++RDAS KAT+LLQ+FEIE SLR+ LF+QFDK+W   KD   K+
Sbjct: 114 PLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDKVWQACKDDA-KF 172

Query: 177 EKDPKDLENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFV 236
           +K+    E Y+FV K H+D+VRAGLNL E KR           NNSL+F+ NLGEQ EFV
Sbjct: 173 KKE--HFELYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFV 230

Query: 237 AFTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGD 296
           AFT EELDGVS SVM+QFEKF D   G E +KV+FKYPDI PVLKTA+NPETRK+AF GD
Sbjct: 231 AFTTEELDGVSASVMDQFEKFTD-TDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGD 289

Query: 297 QNKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPL 356
           QNKV +N VLF  TL+LR++LA +LGYSTYANYNL++KMAK Q++V  FLEDL ++LKPL
Sbjct: 290 QNKVPQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPL 349

Query: 357 GXXXXXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDST 416
           G                   +PFDNHYY+WD+R            VD EKISEY+PL+ T
Sbjct: 350 GVKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPT 409

Query: 417 IEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPR 476
           I GML IYET+L LKF+EE D  K K VWH++VKQLAVWK+D  E+PEFVGWIYFDLHPR
Sbjct: 410 IGGMLKIYETVLKLKFVEETDAEK-KQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPR 468

Query: 477 DGKYGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHG 536
           DGKYGHAANFGI+SSY++ +  RS+PVTALVCNFSK +A KPALLKH+EITTFFHELGHG
Sbjct: 469 DGKYGHAANFGIASSYVR-DGARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHG 527

Query: 537 IHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLN 596
           IHDLVG N+  RFNGPGA PWDFVEAPSQMLEFWTWNKNEL +LS+HY+TGEKIP +LL+
Sbjct: 528 IHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLD 587

Query: 597 SLVATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTK 656
           SL+ATKHVNGALFALRQL FGLFDM VHT KDLE+LD   LWN+LR+EVSLVENGD  TK
Sbjct: 588 SLIATKHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTK 647

Query: 657 GYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYE 716
           G++SFGHIMS +YSAGYYGYMWAEVFA DMY+TKFAA+PL   VGV YRD VL+RGGLYE
Sbjct: 648 GFNSFGHIMSGAYSAGYYGYMWAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYE 707

Query: 717 IEDNLIQFLGRKPSNEAFLKELGLN 741
           I+DNL +FLGR+P+NEAFLKELGL+
Sbjct: 708 IDDNLREFLGREPNNEAFLKELGLS 732

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score =  919 bits (2376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/681 (64%), Positives = 538/681 (79%), Gaps = 6/681 (0%)

Query: 61  AP-QAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLI 119
           AP    P W WTP Q++ + +  I+++N +Y++++ ++SP   N ++PYMNYENK+G LI
Sbjct: 65  APANTVPDWTWTPKQILDETKSYIEKTNKYYNSISEIESPSIENLIIPYMNYENKMGLLI 124

Query: 120 NQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKD 179
           NQLTFLQHVS++K IRDAS +AT LL++ +I TSLR+ ++ QF+K+W  +++  D  +  
Sbjct: 125 NQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQNDDDFLKN- 183

Query: 180 PKDLENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFVAFT 239
               E Y+F+ K+H+D +R GL     +             ++L F++NLGEQ E+V+FT
Sbjct: 184 -HQFETYKFIEKIHKDSLRNGLK--SERNYQLKYIKGKISADALTFSSNLGEQNEYVSFT 240

Query: 240 KEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNK 299
           KEELDGVS++VM+QFEKF D KT ++ YKVTFKYPDIFPVLKTA+NP+TRK AF GDQNK
Sbjct: 241 KEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKIAFLGDQNK 300

Query: 300 VSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGXX 359
           V EN  L  N LKLR +LA+ LGYSTYANYNL++KMAK Q++V KFL DL ++LKPL   
Sbjct: 301 VPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDLKEKLKPLAEK 360

Query: 360 XXXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEG 419
                            +P+D HYY+WDHR            VD+EKISEYYPL+STI+G
Sbjct: 361 EIKILKDLKKKECEELGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYYPLESTIDG 420

Query: 420 MLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGK 479
           ML IYET+LNLKFIEE D    KNVWH +VKQL+VW MD+  NP FVGWIYFDL+PRDGK
Sbjct: 421 MLKIYETVLNLKFIEETDPLA-KNVWHPDVKQLSVWNMDDRANPAFVGWIYFDLYPRDGK 479

Query: 480 YGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHD 539
           YGHAANFGI+SSYI   N+RSYPVTALVCNFSK T +KPALLKH+EITTFFHELGHGIHD
Sbjct: 480 YGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHELGHGIHD 539

Query: 540 LVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLV 599
           LVG+N  +RFNGPG+VPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIP +LL+SL+
Sbjct: 540 LVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPEDLLDSLI 599

Query: 600 ATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYD 659
           +TKHVNGALFALRQLHFGLFDM VHT+KD+ENLD LKLWNE REE+ LVENG+ FTKGY+
Sbjct: 600 STKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGENFTKGYN 659

Query: 660 SFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIED 719
           SFGHI+SDSYSAGYYGYMWAEVFA DMY+TKFA NPL+  VG++YRD +LA+GGLYEI D
Sbjct: 660 SFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEIND 719

Query: 720 NLIQFLGRKPSNEAFLKELGL 740
           NL++FLGR+PSN+ FLKELGL
Sbjct: 720 NLLEFLGREPSNKPFLKELGL 740

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/680 (62%), Positives = 526/680 (77%), Gaps = 10/680 (1%)

Query: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120
            PQAAP+WN+T  +L+K   + ID SN   D+L ++ +P   NF+ PY+++EN +  L N
Sbjct: 43  VPQAAPSWNYTTEELLKQTHEAIDSSNELLDSLESISNPSVENFVTPYLHHENTISPLFN 102

Query: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP 180
           QLTFLQHVSS+K++RD S K T+L++NF IE+SLR+ LF QFD +WNQ+KD   +++KD 
Sbjct: 103 QLTFLQHVSSDKELRDTSTKVTELIENFGIESSLRFKLFRQFDIVWNQLKDDA-QFKKD- 160

Query: 181 KDLENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFVAFTK 240
              E Y+FV K H+DF+R+GLNL E +R           NNSL+F+ NLGEQ EF+ FTK
Sbjct: 161 -HFEIYKFVEKCHKDFLRSGLNLPEEQRDKVKEIKKKISNNSLQFSKNLGEQNEFITFTK 219

Query: 241 EELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKV 300
           EEL GVS++VM+QFE  +++  G   YKVTFKYPDIFPVLK+A+N ETRK+AF GDQNKV
Sbjct: 220 EELIGVSENVMKQFETVDED--GITKYKVTFKYPDIFPVLKSAKNAETRKRAFIGDQNKV 277

Query: 301 SENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGXXX 360
            +N  LF  TL+LRN LA++L Y +YA+YNL++KMAK +++V  FL DL ++LKPLG   
Sbjct: 278 PQNEALFLETLQLRNDLAELLNYDSYADYNLDIKMAKKEEAVLTFLNDLKNKLKPLGEKE 337

Query: 361 XXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEGM 420
                          N P+D  YY+WD+R            +D EKI+EY+PL+STI+GM
Sbjct: 338 LTKLKNLKEEECKELNTPYDRRYYIWDNRYYDNQYLKKNFQIDEEKIAEYFPLESTIKGM 397

Query: 421 LNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKY 480
           L IYET+L LKFIEE     N + WH +VK+L+VWKMD+   P FVGWIYFDLHPR+GKY
Sbjct: 398 LQIYETVLKLKFIEED----NGDTWHPDVKKLSVWKMDD-NFPSFVGWIYFDLHPREGKY 452

Query: 481 GHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHDL 540
           GHAANFGISSS++K +  RSYPVTALVCNFSK T DKPALLKH+E+TTFFHELGHGIHDL
Sbjct: 453 GHAANFGISSSFLKSDGSRSYPVTALVCNFSKPTKDKPALLKHSELTTFFHELGHGIHDL 512

Query: 541 VGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVA 600
           VG N+  RFNGP A PWDFVEAPSQMLEFWTWNK EL SLSKHY+T EKIP  LL+SLV 
Sbjct: 513 VGGNDIGRFNGPSATPWDFVEAPSQMLEFWTWNKKELKSLSKHYQTEEKIPDSLLDSLVR 572

Query: 601 TKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYDS 660
           TKH+NGALFALRQLHFGLFDMKVHT+KD+  L+  +LWN LREE+ L++NGD+ TKG++S
Sbjct: 573 TKHINGALFALRQLHFGLFDMKVHTTKDISKLNVTELWNSLREEICLIDNGDIQTKGFNS 632

Query: 661 FGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIEDN 720
           FGHIMSDSYSAGYYGYMWA+VFA+DMYYTKF  +PL + VGV+YRD +LARGGLYEIEDN
Sbjct: 633 FGHIMSDSYSAGYYGYMWADVFASDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDN 692

Query: 721 LIQFLGRKPSNEAFLKELGL 740
           L +FLGRKP+N+AFLKELGL
Sbjct: 693 LTEFLGRKPNNKAFLKELGL 712

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score =  872 bits (2252), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/681 (60%), Positives = 514/681 (75%), Gaps = 7/681 (1%)

Query: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120
           APQA P W++TPS +     ++I+ SN+FYD+++ ++SP  +NF+ P+M +EN++G +IN
Sbjct: 36  APQAPPNWSFTPSDISGKTNEIINNSNNFYDSMSKVESPSVSNFVEPFMKFENELGPIIN 95

Query: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP 180
           QLTFLQHVSS+K+IRDAS  ++  L    I+ SLR+ +FLQF ++W  ++   D  E+  
Sbjct: 96  QLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIFLQFARVWQDVQSKADSVER-- 153

Query: 181 KDLENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFVAFTK 240
              E +++V K ++D++ +GL LDE  R            NS+ F+ NLGEQ E++ FTK
Sbjct: 154 ---ETFKYVEKSYKDYIHSGLELDEGNRLKIKEIKKKISVNSINFSKNLGEQKEYITFTK 210

Query: 241 EELDGVSDSVMEQFEKFNDEKTGKE-MYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNK 299
           E+L+GV DS++ QFE    +K   E +YKVTFKYPDIFPV+K A + +TRK+AF  DQNK
Sbjct: 211 EQLEGVPDSILTQFETIKSDKDSNETLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNK 270

Query: 300 VSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGXX 359
           V EN  +  +TLKLR++LA +LGY TYANYNL  KMA+   +V  FL DL D+L PLG  
Sbjct: 271 VPENEAILLDTLKLRDELASLLGYDTYANYNLYDKMAEDSTTVMNFLNDLKDKLIPLGRK 330

Query: 360 XXXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEG 419
                           N   D +YY+WDHR            VDLEKISEY+PL++TI G
Sbjct: 331 ELQVLQDMKAEDVKKLNQGADPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLEATITG 390

Query: 420 MLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGK 479
           ML IYETL NLKFIE KD S+NK+VWH +VKQ+AVW MD+P++P FVGWIYFDLHPRDGK
Sbjct: 391 MLEIYETLFNLKFIETKD-SQNKSVWHDDVKQIAVWNMDDPKSPNFVGWIYFDLHPRDGK 449

Query: 480 YGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHD 539
           YGHAANFG+SSS++  +  RSYPVTALVCNFSK T DKP+LLKHNEI TFFHELGHGIHD
Sbjct: 450 YGHAANFGLSSSFMIDDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHD 509

Query: 540 LVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLV 599
           LVG+N  SRFNGPG+VPWDFVEAPSQMLEFWTWNKNEL++LS HYKTGEKIP  L+NSL+
Sbjct: 510 LVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELINLSSHYKTGEKIPESLINSLI 569

Query: 600 ATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYD 659
            TKHVNGALF LRQLHFGLFDMKVHT KDL+NL     WN+LR+++SL+ NG   +KGYD
Sbjct: 570 KTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICDTWNQLRQDISLISNGGTLSKGYD 629

Query: 660 SFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIED 719
           SFGHIMSDSYSAGYYGY+WAEVFATDMY+TKFA +PL  K G++YRD VLARGGLY+I D
Sbjct: 630 SFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYDIND 689

Query: 720 NLIQFLGRKPSNEAFLKELGL 740
           NL +FLGR+PS +AFLKELGL
Sbjct: 690 NLKEFLGREPSKDAFLKELGL 710

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/687 (63%), Positives = 515/687 (74%), Gaps = 11/687 (1%)

Query: 58  NLNAPQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGS 117
           +L  PQ  P+W + P  ++   ++ I  +  FYD L  + +P   N +VPY+N+EN+   
Sbjct: 65  SLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHENENEL 124

Query: 118 LINQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYE 177
           LINQLTFLQHVS +K IRDAS +AT LLQ+FEIE+  R  LF QFD IWNQIKD KD++E
Sbjct: 125 LINQLTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKDEFE 184

Query: 178 KDPKDLENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFVA 237
               D E + FV K H+D+VRAGLNL   K            +N LKF+ NLGEQ E++ 
Sbjct: 185 ----DFEIWRFVEKCHKDYVRAGLNLPADKLEKVKEIKKKIADNCLKFSKNLGEQKEYIL 240

Query: 238 FTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQ 297
           FT EEL GV +SV+EQFEK NDE  G +  KVT+KYPDIFPVLK A+NPETR KAF GDQ
Sbjct: 241 FTAEELKGVPESVIEQFEKVNDE-FGIQKLKVTYKYPDIFPVLKNAQNPETRMKAFMGDQ 299

Query: 298 NKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLK-PL 356
           NKV EN  LF +TLKLRN+LA +LGY TYANYNL++KMAK  D+V  F+ DLI +L+ P 
Sbjct: 300 NKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPA 359

Query: 357 GXXXXXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDST 416
                              N+ +D  YY+WDHR            VD EKI+EYYPL+ST
Sbjct: 360 KKELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLEST 419

Query: 417 IEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPR 476
           I+GML IYETLL LKF+E K+   NK  WH +VKQLAVWK+D PENPEFVGWI+FDLHPR
Sbjct: 420 IDGMLKIYETLLKLKFVEVKE---NKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPR 476

Query: 477 DGKYGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHG 536
           DGKYGHAANFG+SSSYI  N  RSYP+TALVCNFSK T DKP+LLKH+EITTFFHELGHG
Sbjct: 477 DGKYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHG 536

Query: 537 IHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLN 596
           IHDLVG N   RFNGPGAVPWDFVEAPSQMLEFWTWN  ELLSLS++YK   KI T+LL 
Sbjct: 537 IHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLE 596

Query: 597 SLVATKHVNGALFALRQLHFGLFDMKVH--TSKDLENLDFLKLWNELREEVSLVENGDLF 654
           SL+ TKHVNGALFALRQLHFGLFDMKVH  ++++L+ LD  KLWN+LRE++ L+ NGD  
Sbjct: 597 SLIKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQP 656

Query: 655 TKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGL 714
           T GY+SFGHIMS SYSAGYYGYMWAEVFATDMYYTKF A+PL  +VGV+YRD VLARGGL
Sbjct: 657 TTGYNSFGHIMSGSYSAGYYGYMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGL 716

Query: 715 YEIEDNLIQFLGRKPSNEAFLKELGLN 741
           YEI+DNL +FLGRKP+ +AFL+ELGL+
Sbjct: 717 YEIDDNLEEFLGRKPAKDAFLEELGLH 743

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  866 bits (2238), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/681 (60%), Positives = 517/681 (75%), Gaps = 7/681 (1%)

Query: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120
           APQA PTW++TP+ +     ++ID+SN FY+ ++ ++SP   NF+ P+M +EN++G +IN
Sbjct: 36  APQAPPTWSFTPTDIGGKTTEIIDKSNKFYELMSQVESPSVTNFIEPFMKFENELGPIIN 95

Query: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP 180
           +LTFLQHVSS+K+IRDAS  ++  L    I+ SLR+ +FLQF ++W   +   D  +K  
Sbjct: 96  RLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDIFLQFARVWQDAQPKADSLKK-- 153

Query: 181 KDLENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFVAFTK 240
              E ++++ K ++DF+ +GL LDE+ R            NS+ F+ NLGEQ E++ FTK
Sbjct: 154 ---ETFKYIEKSYKDFIHSGLELDEANRLKIKEIKKKISMNSINFSKNLGEQKEYITFTK 210

Query: 241 EELDGVSDSVMEQFEKFNDEKTGKE-MYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNK 299
           E+L+GV DS++ QFE    EK G++ +YKVTFKYPDIFPV+K A + +TRK+AF  DQNK
Sbjct: 211 EQLEGVPDSILAQFETTKSEKGGEDTLYKVTFKYPDIFPVMKLASSAQTRKQAFLADQNK 270

Query: 300 VSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGXX 359
           V EN  +  +TLKLR++LA +LGY+TYA+YNL  KMAK   +V  FL DL  +L PLG  
Sbjct: 271 VPENEAILLDTLKLRDELASLLGYNTYADYNLYDKMAKDSRTVMDFLNDLKGKLIPLGKK 330

Query: 360 XXXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEG 419
                               D +YY+WDHR            VDLEKISEY+PL++TI G
Sbjct: 331 ELQVLQDMKVKDVERSKKDEDPNYYIWDHRYYDNKHLLENFNVDLEKISEYFPLETTITG 390

Query: 420 MLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGK 479
           ML IYETL NLKFIE K+  +NK+VWH++VKQLAVW MD+P++P F+GWIYFDLHPRDGK
Sbjct: 391 MLQIYETLFNLKFIETKE-PQNKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGK 449

Query: 480 YGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHD 539
           YGHAANFG+SSS++  +++RSYPVTALVCNFSK T DKP+LLKHNEI TFFHELGHGIHD
Sbjct: 450 YGHAANFGLSSSFMINDSKRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHD 509

Query: 540 LVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLV 599
           LVG+N  SRFNGPG+VPWDFVEAPSQMLEFWTWNKNEL+SLS HYKTGE+IP  L++SL+
Sbjct: 510 LVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELVSLSSHYKTGERIPESLIDSLI 569

Query: 600 ATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYD 659
            TKHVNGALF LRQLHFGLFDMKVHT KDLENL     WN+LR+E+SL+ NG   +KGYD
Sbjct: 570 KTKHVNGALFTLRQLHFGLFDMKVHTCKDLENLSICHTWNQLRQEISLMPNGGTLSKGYD 629

Query: 660 SFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIED 719
           SFGHIMSDSYSAGYYGY+WAEVFATDMY+TKFA +PL TK GV+YRD VLARGGLY+I D
Sbjct: 630 SFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYDIND 689

Query: 720 NLIQFLGRKPSNEAFLKELGL 740
           NL +FLGR+PS +AFLKELGL
Sbjct: 690 NLKEFLGREPSKDAFLKELGL 710

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/681 (60%), Positives = 516/681 (75%), Gaps = 7/681 (1%)

Query: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120
           APQA P W +TP+ +    +++ID+SN+FY++++N+++P   NF+ P+M +EN++G +IN
Sbjct: 36  APQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNFVEPFMKFENELGPIIN 95

Query: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP 180
           QLTFLQHVSS+K+IRDAS  ++  L    I+ SLR+ ++LQF ++W   +   D  E+  
Sbjct: 96  QLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVWQDAQSKSDSIER-- 153

Query: 181 KDLENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFVAFTK 240
              E ++++ K ++D++ +GL LDES R            NS+ F+ NLGEQ E++ FTK
Sbjct: 154 ---ETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGEQKEYITFTK 210

Query: 241 EELDGVSDSVMEQFEKFNDEKTGKE-MYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNK 299
           E+L+GV DSV+ QFE    +K   E +YKVTFKYPDIFPV+K A + +TRK+AF  DQNK
Sbjct: 211 EQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNK 270

Query: 300 VSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGXX 359
           V EN  +  +TL+LR++LA +LGY TYANYNL  KMAK   +V  FL DL D+L PLG  
Sbjct: 271 VPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKK 330

Query: 360 XXXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEG 419
                           N   D +YY+WDHR            VDLEKISEY+PL++TI G
Sbjct: 331 ELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLETTITG 390

Query: 420 MLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGK 479
           ML IYETL NLKFIE KD  ++K+VWH +VKQLAVW MD+P++P+FVGWIYFDLHPRDGK
Sbjct: 391 MLQIYETLFNLKFIEIKD-GQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGK 449

Query: 480 YGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHD 539
           YGHAANFG+SSS++  ++ RSYPVTALVCNFSK T DKP+LLKHNEI TFFHELGHGIHD
Sbjct: 450 YGHAANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHD 509

Query: 540 LVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLV 599
           LVG+N  SRFNGPG+VPWDFVEAPSQMLEFWTWNKNEL+ LS HY+TGEKIP  L++SL+
Sbjct: 510 LVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPESLIDSLI 569

Query: 600 ATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYD 659
            TKHVNGALF LRQLHFGLFDMKVHT KDL+NL   + WN+LR+++SL+ NG   +KGYD
Sbjct: 570 KTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQDISLISNGGTLSKGYD 629

Query: 660 SFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIED 719
           SFGHIMSDSYSAGYYGY+WAEVFATDMY+TKFA +PL TK G++YRD VLARGGL +I D
Sbjct: 630 SFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLNDIGD 689

Query: 720 NLIQFLGRKPSNEAFLKELGL 740
           +L +FLGR+PS +AFLKELGL
Sbjct: 690 DLKKFLGREPSKDAFLKELGL 710

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/681 (59%), Positives = 508/681 (74%), Gaps = 7/681 (1%)

Query: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120
           APQ  P+W++TP+ +    +++I++SN FYD+++ ++SP   NF+ P+M +EN++G +IN
Sbjct: 36  APQTPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQVESPAVTNFVEPFMKFENELGPIIN 95

Query: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP 180
           QLTFLQHVSS+K+IRDAS  ++  L    I+ SLR+ +FLQF ++W   +   D  E+  
Sbjct: 96  QLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLRHDVFLQFARVWQDAQSQADSIER-- 153

Query: 181 KDLENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFVAFTK 240
              E + ++ K ++D++ +GL LDE  R            NS+ F+ NLGEQ EF+ FTK
Sbjct: 154 ---ETFRYIEKSYKDYIHSGLELDEPDRLKVKEIKKKISVNSINFSKNLGEQKEFITFTK 210

Query: 241 EELDGVSDSVMEQFEKFNDEKTGKE-MYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNK 299
           E+L+GV DS++ QFE     K   E +YKVTFKYPDIFPV+K A + +TRK+AF  DQNK
Sbjct: 211 EQLEGVPDSILAQFETIESGKDSNETLYKVTFKYPDIFPVMKLASSSQTRKQAFLADQNK 270

Query: 300 VSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGXX 359
           VSEN  +  +TLKLR+++A +LGY TYANYNL  KMAK   +V  FL DL  +L PLG  
Sbjct: 271 VSENEAILLDTLKLRDEVASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKKKLIPLGEK 330

Query: 360 XXXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEG 419
                           N   D +YY+WDHR            VDLEKISE++PL++TI G
Sbjct: 331 ELQILQDMKAKDVKKRNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEFFPLETTITG 390

Query: 420 MLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGK 479
           ML IYETL NLKFIE K+  + K+VWH++VKQLAVW MD+P++P F+GWIYFDLHPRDGK
Sbjct: 391 MLQIYETLFNLKFIETKN-PQEKSVWHEDVKQLAVWNMDDPKSPRFIGWIYFDLHPRDGK 449

Query: 480 YGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHD 539
           YGHAANFG+SSS++  +  RSYPVTALVCNFSK T DKP+LLKHNEI TFFHELGHGIHD
Sbjct: 450 YGHAANFGLSSSFMVNDTTRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHD 509

Query: 540 LVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLV 599
           LVG+N  SRFNGPG+VPWDFVEAPSQMLEFWTWNKNEL+ LS HYKTGEKIP  L++SL+
Sbjct: 510 LVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELMHLSSHYKTGEKIPEPLIDSLI 569

Query: 600 ATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYD 659
            TKHVNGALF LRQLHFGLFDMKVH+ KDL+NL     WN+LR+++SL+ NG   +KGY 
Sbjct: 570 KTKHVNGALFTLRQLHFGLFDMKVHSCKDLQNLSICDTWNQLRQDISLMSNGGTLSKGYA 629

Query: 660 SFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIED 719
           SFGHIMSDSYSAGYYGY+WAEVFATDMY+TKFA +PL TK G++YRD VLARGGL +I D
Sbjct: 630 SFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRDIND 689

Query: 720 NLIQFLGRKPSNEAFLKELGL 740
           +L +FLGR+PS +AFLKELGL
Sbjct: 690 SLKEFLGREPSKDAFLKELGL 710

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/683 (55%), Positives = 495/683 (72%), Gaps = 8/683 (1%)

Query: 58  NLNAPQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGS 117
           +L +P+ AP+W++   ++V  A+  ID+   FYD++ +L++PD  NF+V  +++E++   
Sbjct: 42  SLLSPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVVAVIDHEDETDG 101

Query: 118 LINQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYE 177
            ++QLTFLQHVS++K++RDAS +AT L+Q + IETS RY L+ QF K+W Q KD ++  +
Sbjct: 102 YMSQLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVWEQYKDDENLKK 161

Query: 178 KDPKDLENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFVA 237
            DP   E Y ++  V++D++ AG+ L E  R           NNSL F+ NLGEQ +++A
Sbjct: 162 NDP---ELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKLANNSLAFSNNLGEQNDYIA 218

Query: 238 FTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQ 297
           FTK+EL GVS++ + QFEK  ++  G E YK+TFKYPDI PVL TA+NPETRK+A+ GDQ
Sbjct: 219 FTKDELVGVSETTLGQFEKVIED--GVEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQ 276

Query: 298 NKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLG 357
           NKV +N  +   TLKLRN+LA+I G+ TYA+Y LE+KMAK Q++VF FL DL D+L P G
Sbjct: 277 NKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGG 336

Query: 358 XXXXXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTI 417
                              LP++  +  WD+R            VD E++++Y+PL  TI
Sbjct: 337 KKDLENLKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTI 396

Query: 418 EGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRD 477
           +GMLNIY+ L NLKF+EE  +   KNVWH++VKQ AVW +D   NPEFVGWIYFDLHPR+
Sbjct: 397 DGMLNIYQKLFNLKFVEETREC-GKNVWHEDVKQFAVWDLDKC-NPEFVGWIYFDLHPRE 454

Query: 478 GKYGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGI 537
           GKYGHAANFG+ S Y+     R YPVT LVCNFSK ++ +PALLKH E+ TFFHELGHGI
Sbjct: 455 GKYGHAANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVVTFFHELGHGI 514

Query: 538 HDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNS 597
           H LVGK+     NGP ++PWDFVEAPSQMLEFW WNK+++L LSKHY+TGE+IP EL++S
Sbjct: 515 HALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETGEQIPDELVDS 574

Query: 598 LVATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKG 657
           L+ TKHVN  L  LRQLHF LFDM VHT K+L+ LD   LWN LREEV+L+ NGD+ TKG
Sbjct: 575 LIKTKHVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTLISNGDVLTKG 634

Query: 658 YDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEI 717
           YDSF HIMS  YSAGYYGYMW+EVFA DMY+T FA NPL+T VG  YRD +LA+GGL +I
Sbjct: 635 YDSFSHIMS-GYSAGYYGYMWSEVFAADMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDI 693

Query: 718 EDNLIQFLGRKPSNEAFLKELGL 740
           ED+L +FLGR+P+N+AFLKELGL
Sbjct: 694 EDSLEEFLGREPNNKAFLKELGL 716

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/688 (48%), Positives = 457/688 (66%), Gaps = 14/688 (2%)

Query: 56  CVNLNAPQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKV 115
             +L  PQAAP+WN++   ++  +  LI+Q+   Y  +   K P  +N+++P + +E + 
Sbjct: 4   LASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEET 63

Query: 116 GSLINQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDK 175
             L NQL FL++VS + +IR+AS  AT +L ++ I  + +Y L+  FD++W Q KD  +K
Sbjct: 64  DLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYKDD-EK 122

Query: 176 YEKDPKDLENYEFVRKVHRD---FVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQ 232
           ++K     EN+E  R + +D   + R+G+ +    R              L+F++NLGE+
Sbjct: 123 FKK-----ENFELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEE 177

Query: 233 TEFVAFTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKA 292
            E++AFTKEEL+GV D+V+ QFEK  +   G E +KVTFKYPDI PVL+ A NPETR++A
Sbjct: 178 VEYIAFTKEELEGVPDTVLNQFEKIIE--GGVEKFKVTFKYPDIGPVLRLASNPETRRRA 235

Query: 293 FAGDQNKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDR 352
              D+N+V+ N  L   TL+LR +LAD+LG+  +A YNL+ KMAK +++V KFL DL+++
Sbjct: 236 SMADENRVAANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEK 295

Query: 353 LKPLGXXXXXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYP 412
           L P+G                  NL FD  +Y WD              V+ + +++Y+P
Sbjct: 296 LLPVGKNDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFP 355

Query: 413 LDSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFD 472
           ++S IEGMLNIY TL  LKF+E  D+ + K+VWH++VKQ AVW +D+ +NP+F GW+YFD
Sbjct: 356 VESAIEGMLNIYTTLFRLKFVEITDECE-KSVWHEDVKQFAVWNIDDEDNPKFQGWLYFD 414

Query: 473 LHPRDGKYGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHE 532
           LHPRDGKYGHAANFG+ S+Y K +  +SYPVT LV NFSK T  +PALLK  E+TTFFHE
Sbjct: 415 LHPRDGKYGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHE 474

Query: 533 LGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPT 592
           LGHGIHDLVG N+    NGPG+VPWDFVEAPSQMLE+WT  ++ L  LSKHY+TGEKIP 
Sbjct: 475 LGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPK 534

Query: 593 ELLNSLVATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGD 652
            LL++  +   +N  L  L QL  GLFDM VHT +D +  +  KLWN+L  E+ L+   +
Sbjct: 535 SLLDAWFSVGGLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKN 593

Query: 653 LFTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARG 712
             + GYDSFGHIM+   +  YYGY+W++VFA DMY TKF  NP    VGVEYRD +LA G
Sbjct: 594 YTSTGYDSFGHIMAGYAAG-YYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATG 652

Query: 713 GLYEIEDNLIQFLGRKPSNEAFLKELGL 740
           GLY++ DNL +FLGR P+N+AFL+ LGL
Sbjct: 653 GLYDMTDNLRKFLGRDPNNKAFLRGLGL 680

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/688 (45%), Positives = 443/688 (64%), Gaps = 14/688 (2%)

Query: 58  NLNAPQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSP-DFNNFLVPYMNYENKVG 116
           +L  PQ  P WN+T ++++  A  L  +S+  Y+++ + K     +N++ P +  + +  
Sbjct: 11  SLVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETD 70

Query: 117 SLINQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKY 176
            L NQL FL++VS +  +R+AS     +L  +    S +Y L+  F+ IW Q KD ++  
Sbjct: 71  LLWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEF- 129

Query: 177 EKDPKDLENYEFVRKVHRD---FVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQT 233
                 + NYE  + + +D   + R   NL  ++             ++L+F+ NLGE+T
Sbjct: 130 -----KVTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEET 184

Query: 234 EFVAFTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAF 293
           E++ FT+EEL+GVS  V++QFE+  +   G +  KVTFKYPDI PVL+TA NPETR+KA+
Sbjct: 185 EYITFTEEELEGVSPLVLDQFERIIE--GGVKKLKVTFKYPDIGPVLRTATNPETRRKAY 242

Query: 294 AGDQNKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRL 353
             DQN+V+ N  L   TL LR ++A + GY  YA YNL  KMAK +++V  FL DL++RL
Sbjct: 243 VADQNRVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERL 302

Query: 354 KPLGXXXXXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPL 413
            P+G                  NL FD   Y WD+             +D E +++Y+P+
Sbjct: 303 LPVGEKDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPI 362

Query: 414 DSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDL 473
           +S IEGML+ Y+TL  LKF+E  D S+ KNVWH++VKQ AVW +D+ + PEF GWIYFDL
Sbjct: 363 ESVIEGMLDTYQTLFRLKFVEVTDPSQ-KNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDL 421

Query: 474 HPRDGKYGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHEL 533
           +PRDGKY HAANFG++S++ K +  +SYPVT LVCN +K T  + A+L+  EITT FHEL
Sbjct: 422 YPRDGKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHEL 481

Query: 534 GHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTE 593
           GHGIH LV  N  +  N  G+VPWDFVEAPSQMLE+WT  ++ L  LSKHY+TGEKIP  
Sbjct: 482 GHGIHHLVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPS 541

Query: 594 LLNSLVATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDL 653
           LL++   +  +   L+ L QL  GLFDM VHT ++   L+  KLWN++R E+SL+ + + 
Sbjct: 542 LLDAWFNSSGLGSGLYYLGQLRLGLFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNY 600

Query: 654 FTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGG 713
            + GY++FGHIM+ SYSAGYYGY+W++VFA DMY TKF +NP  + VG +YRD +LA GG
Sbjct: 601 TSTGYNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGG 660

Query: 714 LYEIEDNLIQFLGRKPSNEAFLKELGLN 741
           LY++ DNL +FLGR+P+N AFL+ LG N
Sbjct: 661 LYDMNDNLRKFLGREPNNRAFLRGLGFN 688

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  342 bits (877), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 186/415 (44%), Positives = 253/415 (60%), Gaps = 8/415 (1%)

Query: 327 ANYNLELKMAKAQDSVFKFLEDLIDRLKPLGXXXXXXXXXXXXXXXXXXNLPFDNHYYVW 386
           A Y LE+K AK  D+V  FL DL ++LKP                       +D   Y  
Sbjct: 49  AAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQECKELGNFYDGELYSQ 108

Query: 387 DHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWH 446
           D              VD E+ ++Y+PL+ TI+ ML+ Y TL    F+EE + +  +NVWH
Sbjct: 109 DLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRHNFVEETEPA-TRNVWH 167

Query: 447 KEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKYGHAANFGISSSYIKPNNERSYPVTAL 506
           ++ KQ +VWKMD+ + P+F GW+YFDLHPRDGK+GH A F    + +     R YPVT+L
Sbjct: 168 EDDKQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYTDMSEEGSRVYPVTSL 227

Query: 507 VCNFSKVTADKPALLKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQM 566
           VCNFS  + +KPALLKH E+  FFHELGHG H L+             VP DF+EAPSQM
Sbjct: 228 VCNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLCA--PELCCSSSWVPRDFIEAPSQM 285

Query: 567 LEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKVHTS 626
           LE+W W K+ +  LSKH +TGE+IP  L++ +V +K  N A+  L Q+   L DM VH  
Sbjct: 286 LEYWIWRKDVITDLSKH-ETGERIPESLVDCMVKSKRANAAIDNLIQV-LALLDMAVHKH 343

Query: 627 -KDLENLDFLKLWNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAEVFATD 685
               E LD   LWN L E+V L++N +  T+ Y SF HI+ + Y+AGYYGY W++VFA D
Sbjct: 344 VGSYETLDLNALWNNLCEDVILIKNPEP-TRAYCSFSHIV-EGYAAGYYGYQWSKVFAAD 401

Query: 686 MYYTKFAANPLETKVGVEYRDWVLARGGLYEIEDNLIQFLGRKPSNEAFLKELGL 740
           MY+++F    L+  +G  Y D ++ARGGLYE+EDNL +FL R+P+NEA+L++ GL
Sbjct: 402 MYFSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPNNEAYLRDQGL 456

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  188 bits (478), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 148/559 (26%), Positives = 250/559 (44%), Gaps = 56/559 (10%)

Query: 194 RDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTE-FVAFTKEELD--GVSDSV 250
           +DF+++G+ +D  K+               ++  N+ +     +   + ELD  G+   V
Sbjct: 209 QDFIKSGIYMDSGKKDQFITLSQDISVIGQEYINNINQLARNHIKVKRSELDNAGIEFDV 268

Query: 251 MEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKVSENTVLFTNT 310
             Q  K   + TGK  YK+       F +LK   +PE RKK +    +   +     TN 
Sbjct: 269 ACQLGK---DITGK-YYKIPTYGHLPFLILKACTDPEIRKKIWVAMHDCSKQQIERLTNL 324

Query: 311 LKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKP-----------LGXX 359
           +K+R  LA  +G   YA Y ++ KMAK    V +FL+ L+D LKP           L   
Sbjct: 325 VKIRAFLAHTMGRECYAAYAIDGKMAKNPKDVDEFLKSLMDFLKPKAAKELKFISDLIHN 384

Query: 360 XXXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEG 419
                             P+D  YY   HR            +D+     YYPL + I+G
Sbjct: 385 EKGEKPSDDVDEILTAVRPWDREYYTAIHRNKQKHLLLDDYALDV-----YYPLGNVIQG 439

Query: 420 MLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGK 479
           + +I+E++  ++F  E   +     W  +V++L V      E    +G IY DL  R GK
Sbjct: 440 LSDIFESIYGIRF--EPAVAGKGETWSSDVRRLNVVS----EKEGLIGIIYCDLFRRQGK 493

Query: 480 YGHAANFGISSSY-IKPNNER---------------SYPVTALVCNFSKV---TADKPAL 520
             +AA+F I  S  I P+ +                  P+ +L+CNF+     + +   L
Sbjct: 494 TNNAAHFTICCSRQIYPHEDDFSTIQLGTNVDGTKFQLPIISLLCNFNTRCLNSGETICL 553

Query: 521 LKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSL 580
           L  NEI T FHE+GH IH ++G+      +G      DFVE PS ++E +  +   L  +
Sbjct: 554 LALNEIETLFHEMGHAIHSMLGRTRLQNVSGT-RCSTDFVELPSVLMEHFARDTRVLKRI 612

Query: 581 SKHYKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKVH---TSKDLENLDFLKL 637
             HYKTG+++P  LLN  +             Q    + D +++     ++++++D +K+
Sbjct: 613 GHHYKTGDRVPATLLNRYLEKARFLKDCETFSQAKMAMLDQRLYDKNIVQNIDSVDVVKI 672

Query: 638 WNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLE 697
           ++EL +E+ ++ + +  +     FGH+    Y A YY Y++    A+ ++   F  +P  
Sbjct: 673 YHELEKELEVLVDDE--SNWCAKFGHLF--GYGATYYCYLFDRAIASKVWKKLFEKDPYS 728

Query: 698 TKVGVEYRDWVLARGGLYE 716
              G ++++ VL  GGL E
Sbjct: 729 RSGGEKFKNDVLKWGGLRE 747

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  178 bits (452), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 142/513 (27%), Positives = 226/513 (44%), Gaps = 54/513 (10%)

Query: 236 VAFTKEELD--GVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAF 293
           V  +  +LD  G+   ++ Q EK   +  GK     T+ Y   F +LK+  + E R+K +
Sbjct: 260 VVVSCNQLDSLGIDPELLSQIEK---DIAGKNYKIPTYGYIP-FALLKSCPSEEIREKIW 315

Query: 294 AGDQNKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRL 353
               N  +E     T+ +KLR  L+ +LG  +YA Y LE KMAK    V +F++ L+D  
Sbjct: 316 VAVHNCSNEQIKRLTDLVKLRAVLSQLLGKKSYAEYQLEGKMAKNPKEVIEFIKTLMDFT 375

Query: 354 KPLGXXXXXXXXXXXXXXXX-XXNL----------PFDNHYYVWDHRXXXXXXXXXXXXV 402
           KP+                    NL          P+D  YY    R             
Sbjct: 376 KPMAAKELDGIAEKKLTIKSNGSNLSVCDILKTVRPWDRDYYSAIEREQTSAKNLYGS-- 433

Query: 403 DLEKISEYYPLDSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPEN 462
             E++ +Y+ L + ++G+ N+++ +  +K   E D  K    W  EV+++ V      E+
Sbjct: 434 --EEVLKYFTLGNVMQGLSNLFQKIYGIKL--ELDVPKIGETWSPEVRKINVIS----ED 485

Query: 463 PEFVGWIYFDLHPRDGKYGHAANFGISSSY-IKP---------------NNERSYPVTAL 506
              +G IY DL  R GK  +AA+F I  S  I P                     P+ +L
Sbjct: 486 EGLIGIIYCDLFERSGKTSNAAHFTICCSRDISPYETEDSTTQIAIDSKGTRFQLPIISL 545

Query: 507 VCNFSKVT---ADKPALLKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAP 563
           VCNFSK      D    L   E+ T FHE+GH +H ++G+      +G      DFVE P
Sbjct: 546 VCNFSKTMISETDSVCFLHLPEVETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELP 604

Query: 564 SQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKV 623
           S ++E++  +   L ++ KHY T E +  E+L   +             Q    + D  +
Sbjct: 605 SILMEYFARDPRVLETIGKHYLTKETVKREMLEPHLQDLKYLQHCETYSQAKMAMLDQTL 664

Query: 624 H---TSKDLENLDFLKLWNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAE 680
           H    S  L++LD +KL+ +L  ++ ++ +    +     FGH+    YSA YY Y++  
Sbjct: 665 HGETISSHLDHLDVVKLYQDLERQLGVLVDDK--SNWCGKFGHLFG--YSAVYYSYLFDR 720

Query: 681 VFATDMYYTKFAANPLETKVGVEYRDWVLARGG 713
             A+ ++   F  NP     G +YR+ VL  GG
Sbjct: 721 AIASKIWGALFERNPFSRASGDKYRNSVLQWGG 753

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  171 bits (433), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 160/676 (23%), Positives = 293/676 (43%), Gaps = 55/676 (8%)

Query: 71  TPSQLVKDAEDLIDQSNHFYDALTNLKSPD-FNNFLVPYMNYENKVGSLINQLTFLQHVS 129
           +P  L K     + Q+N   + + + +SP  + N++       + +  +I+   F++   
Sbjct: 80  SPQGLRKFCRHSLTQANELVETMRHDRSPKGYANYIANLDRLSDILCRVIDLAEFIRASH 139

Query: 130 SEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDPKDLENYEFV 189
            +     A+    +  + FEI   L   + L  D + + + D     E  P++++  + +
Sbjct: 140 PDPHFVQAAQDCHE--EMFEIMNVLNTDVAL-CDILKHVLTDPTILSELSPEEIKVGKIL 196

Query: 190 RKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLG-EQTEFVAFTKEELD--GV 246
            +   DF ++G++++   R                F  N    ++ ++    EEL+  G+
Sbjct: 197 LE---DFEKSGIHMNPEVREQFIALSQQISVVGQDFINNTEYVRSNYIKVEVEELNKSGI 253

Query: 247 SDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKVSENTVL 306
           +  V+ Q  K   +  G+     TF Y   + +L++  +   R K ++   +   +    
Sbjct: 254 NKIVLNQLSK---DIKGRHYKIPTFGYIP-YSILRSCPDDNIRMKVWSALHSCSEKQIAR 309

Query: 307 FTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGXXXXXXXXX 366
               +KLR+ LA+I+G  ++A+Y LE KMAK  + V  F++ LID  KP           
Sbjct: 310 LDQLIKLRSVLANIMGKKSFAHYQLEGKMAKTPEYVRGFMQSLIDATKPKAAEELKFIAD 369

Query: 367 XXXXXXXXXNLPFDNHYYV------WDHR-XXXXXXXXXXXXVDLEKISEYYPLDSTIEG 419
                    N P ++ + +      WD                + E+IS Y+ L   I+G
Sbjct: 370 LKAKHVPG-NKPAESMHEILEMVKPWDRDFYGSVHALQQRRPFNNEQISSYFSLGVVIQG 428

Query: 420 MLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGK 479
           + N+++ +  +    E    K    W  EV+++ V      E    +G +Y DL  R GK
Sbjct: 429 LSNLFKQIYGIYL--EPVVPKTGETWSPEVRRINVVS----EKEGVIGVVYCDLFERQGK 482

Query: 480 YGHAANFGISSSYIKPNNER----------------SYPVTALVCNFSKVTADKP---AL 520
             + A+F +  S    + E                   PV +LVCNFS  T  +     L
Sbjct: 483 TANPAHFTVCCSRQIYDGETDLSTIQVGQNSKGEQFQLPVISLVCNFSPTTISQEQSICL 542

Query: 521 LKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSL 580
           L+ +EI T FHE+GH +H ++G+      +G      DFVE PS ++E +  +   L  +
Sbjct: 543 LQLSEIETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEHFARDHRVLQRM 601

Query: 581 SKHYKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKVH---TSKDLENLDFLKL 637
           + HY TGE IP +LL S  +         A  Q    + D ++H     K+++ LD +KL
Sbjct: 602 ASHYSTGESIPEQLLFSYQSEVKFLQHAEAFSQAKMAILDQELHGESIMKEMQYLDIVKL 661

Query: 638 WNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLE 697
           ++ L  ++ ++   D  +     FGH+    Y A YY Y++    A+ ++   FA +P  
Sbjct: 662 YHNLERQLEVL--SDDKSNWCGRFGHLF--GYGATYYSYLFDRAIASKIWQHLFANDPFC 717

Query: 698 TKVGVEYRDWVLARGG 713
            + G ++++ VL  GG
Sbjct: 718 RRSGEKFKNSVLKWGG 733

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  169 bits (429), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 139/541 (25%), Positives = 244/541 (45%), Gaps = 58/541 (10%)

Query: 232 QTEFVAFTKEELD--GVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETR 289
           ++EF+    EELD  GVS  ++ Q             YKV       + +L++ +N   R
Sbjct: 260 RSEFIEIASEELDNSGVSPILLRQLTT----TVRGTHYKVPAYGTAPYIILRSCKNENAR 315

Query: 290 KKAFAGDQNKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDL 349
           K  +    +   +     T+ +K+R+ L++I+G   +A Y L+ KMAK+ ++V  F+  L
Sbjct: 316 KAVWTALHSCPDKQINRLTHMVKMRSVLSNIMGKVGFAVYQLQGKMAKSPENVLNFITRL 375

Query: 350 IDRLKPLGXXXXXXXX-----------XXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXX 398
           ++  KP+                                P+D  YYV   +         
Sbjct: 376 MEHTKPMAAEELKLLANMKLNDLGLPEANSEKEILETVRPWDRDYYVAKSQQTRKAKNQL 435

Query: 399 XXXVDLEKISEYYPLDSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMD 458
               + E I+ Y+ L S +EG+ N+++++  +    E   S     W  EV+++ V    
Sbjct: 436 ---TNHEPINAYFTLGSVLEGLSNLFKSIYGISL--EVVASIPGETWSSEVRRVNV---- 486

Query: 459 NPENPEFVGWIYFDLHPRDGKYGHAANFGISSS---YIKPN---------NERS----YP 502
             EN   +G +Y DL  R  K    A+F +  S   Y + N         N R      P
Sbjct: 487 KTENNNIIGVVYCDLFERKAKTSSPAHFTVCCSRELYAEENDPSILQSGVNSRGEKFQLP 546

Query: 503 VTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEA 562
           + +LVCNF++ + ++  LL+ +EI T FHE+GH +H ++G+      +G      DFVE 
Sbjct: 547 IISLVCNFARTSDNELCLLQLSEIETLFHEMGHAMHSMLGQTKLQNISGTRCTT-DFVEL 605

Query: 563 PSQMLEFWTWNKNELLSLSKHYKTGEKIPTELL-NSLVATKHV-NGALFALRQLHFGLFD 620
           PS ++E +  +   L  + +HY T EK+P +LL   L +T+++ N   FA  Q    + D
Sbjct: 606 PSIIMEHFARDPRVLKGIGRHYITKEKVPEDLLAEELNSTRYLQNCETFA--QAKMAMLD 663

Query: 621 MKVHTSK---DLENLDFLKLWNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYM 677
            +++ +     + +LD ++L+++L   + ++ +    T     FGH+    Y A YY Y+
Sbjct: 664 QRLYDNNIIFHVRDLDVVELYHDLERNLEVLVDDQ--TNWCGKFGHLF--GYGATYYSYL 719

Query: 678 WAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYE----IEDNLIQFLGRKPSNEA 733
                A  ++   F  +P     G  +++ VL  GGL +    I D L Q + +K   +A
Sbjct: 720 LDRAIAAKIWDCLFVNDPFSRTGGENFKNAVLKWGGLRDPWECIADVLDQPMLKKGDTKA 779

Query: 734 F 734
            
Sbjct: 780 M 780

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  169 bits (427), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 142/549 (25%), Positives = 239/549 (43%), Gaps = 51/549 (9%)

Query: 195 DFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFV--AFTKEELD-----GVS 247
           DF ++G+ ++   R               +F TN    TE+V  +F + E D     GVS
Sbjct: 212 DFEKSGIYMNPKVRERFIELSQVISIVGQEFITN----TEYVGTSFVEIETDVLEASGVS 267

Query: 248 DSVMEQFEKFNDEKTGKEMYKV-TFKYPDIFPVLKTARNPETRKKAFAGDQNKVSENTVL 306
             V++Q  K   + +GK  YK+ T+ Y   + +++T  +   RKK +    +   +    
Sbjct: 268 QMVLQQLSK---DLSGK-FYKIPTYGYLP-YSIIRTCPSEYIRKKVWTAMYSCPEKQIKR 322

Query: 307 FTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGXXXXXXXXX 366
               ++LR QLA I+G   YA Y LE KMAK+  +V  F+  LI+  KPL          
Sbjct: 323 LKKLVRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLAMEELKPLAD 382

Query: 367 XXXXXXXXXNLPFDNHYYVWDH----RXXXXXXXXXXXXVDLEKISEYYPLDSTIEGMLN 422
                         +    WD                  +  + ++ Y+ L   I+G+ +
Sbjct: 383 MKHDNHCKDASEILSSVRPWDRDYFGSMSLLAQPRSVKTMSFQSLNCYFSLGVVIQGLSD 442

Query: 423 IYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKYGH 482
           +++++  ++   E   +K    W  EV+++ V    N      +G IY DL  R GK  +
Sbjct: 443 LFQSIYGIRL--EPVVAKTGETWDPEVRKIQVISEANG----VIGVIYCDLFERQGKTPN 496

Query: 483 AANFGISSSYIKPNNERSY----------------PVTALVCNFSKVTAD--KPALLKHN 524
            A+F +  S     NE  Y                PV +LVCNFS   AD     LL+ +
Sbjct: 497 PAHFTVCCSRQIYPNETDYSTIQVGSHPDKSKFQMPVISLVCNFSHTQADDDSICLLQLS 556

Query: 525 EITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHY 584
           E+ T FHE+GH +H ++G+      +G      DFVE PS ++E +  +   L  +S HY
Sbjct: 557 EVETLFHEMGHAMHSMLGRTQLQNISGTRCAT-DFVELPSILMEHFAKDLRVLSRISSHY 615

Query: 585 KTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREE 644
            TGE++P E+L +               Q+   + D ++H+  D  + D + +++ L +E
Sbjct: 616 ATGERVPKEMLVNYQQENRFLEHTETFSQIKMAMLDQRLHSLTD-NSEDIVTVYHGLEKE 674

Query: 645 VSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEY 704
           + ++   D  +     FGH+    Y A YY Y+     A  ++   F  +P     G ++
Sbjct: 675 LQVLV--DDRSNWCGRFGHLF--GYGASYYSYLMDRAIAAKVWNHLFQHDPFSRAGGEKF 730

Query: 705 RDWVLARGG 713
           ++ VL  GG
Sbjct: 731 KNSVLKWGG 739

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  166 bits (420), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 135/511 (26%), Positives = 233/511 (45%), Gaps = 45/511 (8%)

Query: 232 QTEFVAFTKEELD--GVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETR 289
           ++++V    +ELD  GVS  ++ Q  +  D K   + YKV       F +L++  N   R
Sbjct: 242 RSDYVKIPCKELDSSGVSTLLLNQLSR--DLKN--QNYKVPAYGYAAFSILRSCPNENVR 297

Query: 290 KKAFAGDQNKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDL 349
            K +    +   +        + LR  LA I+G  +YA Y L  KMAK+   V  F++ L
Sbjct: 298 MKIWTAMHSCPEKQISRLKQLVMLRGLLASIMGKKSYAEYQLSGKMAKSPVYVRGFVQSL 357

Query: 350 IDRLKPLGXXXXXXXXXXXXXXXXXXNLP---FDNHYYV--WDHRXXXXXXXXXXXXVDL 404
           +D  KPL                   N+P    D   +V  WD                L
Sbjct: 358 VDVTKPLAAEELRVLAKLKSGHLGV-NVPQSDADVLRFVRPWDRDFYSTLNALQQQRKTL 416

Query: 405 E--KISEYYPLDSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPEN 462
           E   IS Y+ L + ++G+  ++E +  ++   E   +K    W  EV+++ V      E 
Sbjct: 417 ENEHISSYFSLGTVMQGLSRLFEDIYGIRL--EPVVAKAGETWSPEVRRINVVS----EK 470

Query: 463 PEFVGWIYFDLHPRDGKYGHAANFGISSSYIK---------------PNNER-SYPVTAL 506
              +G +Y DL  R GK  + A+F +  S                  P+ E+   PV +L
Sbjct: 471 EGIIGVVYCDLFERQGKTSNPAHFTVCCSRTIYPGETDLSTIQVGQLPSGEKFQLPVISL 530

Query: 507 VCNFSKVTADKP--ALLKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPS 564
           VC+F++ +A +    LL+ +++ T FHE+GH +H ++G+ +    +G      DFVE PS
Sbjct: 531 VCSFAQNSASRQGVCLLQLSDVDTLFHEMGHAMHSMLGRTSLQNISGTRCAT-DFVELPS 589

Query: 565 QMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKVH 624
            ++E +  +   L  + +HY T + IPTELL       +         Q    + D ++H
Sbjct: 590 ILMEHFARDSRVLSRIGRHYATDQPIPTELLKLNQTEMNYLQHTETFSQAKMAMLDQELH 649

Query: 625 TSKDLEN--LDFLKLWNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAEVF 682
           +SK L +  LD +KL++ + +++ ++   D  +     FGH++   Y A YY Y++    
Sbjct: 650 SSKALTDGKLDVVKLYHGVEKDMEVL--ADDQSNWCGRFGHLL--GYGASYYSYLFDRAI 705

Query: 683 ATDMYYTKFAANPLETKVGVEYRDWVLARGG 713
           A+ ++   FA +P   + G ++++ VL  GG
Sbjct: 706 ASKIWQHLFAEDPFNRENGEKFKESVLKWGG 736

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  166 bits (419), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 137/511 (26%), Positives = 227/511 (44%), Gaps = 46/511 (9%)

Query: 232 QTEFVAFTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKK 291
           + +++    +E D   D    ++ K + + +GK  YK+       +  L   ++ E RKK
Sbjct: 246 EKDYIKIKCDEFDKACDYPALKY-KLSKDLSGK-YYKIPTYGKIPYTALLKCKDEELRKK 303

Query: 292 ---AFAGDQNKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLED 348
              AF    NK  E     T  +K R +LA +L  S+Y+ Y LE KMAK    V  FL  
Sbjct: 304 LWVAFHSCSNKQIER---LTKIIKHRIELAKLLSKSSYSEYTLEGKMAKGPKEVNNFLNA 360

Query: 349 LIDRLKPLGXXXXXXXXXXXXXXX----XXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDL 404
           L+  + P                             N+   WD                +
Sbjct: 361 LLKSILPEVTKELEPISNKKCLSEGFSLETSEQSILNNIKPWDRDYYNPIQATSEGAYQM 420

Query: 405 EKISEYYPLDSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPE 464
             I EY+ L + I G+ N++ ++  ++F  E    ++   W K+V++L V      E+  
Sbjct: 421 -LIMEYFTLGNIIHGLSNLFNSIYGIRF--EPGKIEDGETWSKDVRKLNVIS----EDEG 473

Query: 465 FVGWIYFDLHPRDGKYGHAANFGISSS-------------YIKPNNERS----YPVTALV 507
            +G IY DL  R+GK    +++ I  S                 NN+       P+ +LV
Sbjct: 474 LIGVIYCDLFEREGKSESPSHYTICCSREIYSEEHDLSTIQTGVNNKTGKNFQLPIVSLV 533

Query: 508 CNFSKVTAD---KPALLKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPS 564
           CNF    A    +   L+H+EI T FHE+GH +H ++G+      +G   V  DFVE PS
Sbjct: 534 CNFQVTNAKESRRICFLQHHEIETLFHEMGHAMHSMLGRTRFQTISGTRCVS-DFVEIPS 592

Query: 565 QMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKVH 624
            ++EF+  N   L+ +S+HY +GE I  E+LN  +       A     Q    L D ++H
Sbjct: 593 ILMEFFANNPKVLIDISRHYDSGESIDIEVLNKYLENTKQFKACETYSQGKMALLDQRLH 652

Query: 625 T--SKDLENLDFLKLWNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAEVF 682
              +  L+N+D +++++ L +E+S++   D  +     FGH+    Y A YY Y++    
Sbjct: 653 AENANSLDNIDVVEIYHNLEKELSVLP--DTESNWCGRFGHLY--GYGALYYCYLFDRAI 708

Query: 683 ATDMYYTKFAANPLETKVGVEYRDWVLARGG 713
           AT ++ + F  +P   K G  +++ +L  GG
Sbjct: 709 ATKIWESLFQNDPFSRKGGNIFKEQLLKWGG 739

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  162 bits (409), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 127/515 (24%), Positives = 228/515 (44%), Gaps = 54/515 (10%)

Query: 234 EFVAFTKEELD--GVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKK 291
           EF+   ++E+D  G+S  +     + N + TGK  YK+         +LK+  + + RK+
Sbjct: 234 EFIKVKRDEMDKSGISPLLTA---RLNRDLTGK-YYKIPTYGQIPLQILKSCPDEDIRKE 289

Query: 292 AFAGDQNKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLID 351
            +A   N            ++LR  L+++LG  +Y++Y L+ KMA + ++V  F++ L++
Sbjct: 290 VWAALHNCPKAQIQRLNQLVRLRVILSNLLGKQSYSDYQLDNKMAGSPENVKGFIKTLMN 349

Query: 352 RLKPLGXXXXXXXXXXXXXXXXXXNL----------PFDNHYYVWDHRXXXXXXXXXXXX 401
             KPL                   ++          P+D +Y+   +             
Sbjct: 350 VTKPLAARELEFIARDKLNAPDSRHMSDNEILSIVKPWDKNYFSSKY-----DSDNEMAM 404

Query: 402 VDLEKISEYYPLDSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPE 461
           +  E++  Y+ L + I G+  +++ +  +    +   ++N   W  +V++L V      E
Sbjct: 405 IRDEQLRYYFSLGNVINGLSELFKRIYGITL--QPSRTENGETWSPDVRRLDVIS----E 458

Query: 462 NPEFVGWIYFDLHPRDGKYGHAANFGISSSYIKPNNERSY----------------PVTA 505
               VG IY DL  R GK  + A+F +  S     +E  +                PV +
Sbjct: 459 EEGLVGVIYCDLFERVGKISNPAHFTVCCSRQVYPDENDFTTIQTGQNSDGTVFQLPVIS 518

Query: 506 LVCNFSKVT---ADKPALLKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEA 562
           LVCNFS V     ++   L  NEI T FHE+GH +H ++G+      +G      DFVE 
Sbjct: 519 LVCNFSTVALPNGNRTCFLHMNEIETLFHEMGHAMHSMLGRTRLQNISGTRCAT-DFVEL 577

Query: 563 PSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMK 622
           PS ++E +  +   L ++  HY+T E  P  LLN  +             Q    + D K
Sbjct: 578 PSILMEHFARDIRVLRTIGSHYETSEPAPEALLNDYLDKTQFLQHCETYSQAKMAMLDQK 637

Query: 623 VHTS---KDLENLDFLKLWNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWA 679
           +H S    D+E +D  K++ +L   + ++ + +  +     FGH+    Y A YY Y++ 
Sbjct: 638 LHGSFSLSDIERIDSAKIYQKLETRLQVLADDE--SNWCGRFGHLF--GYGATYYSYLFD 693

Query: 680 EVFATDMYYTKFAANPLETKVGVEYRDWVLARGGL 714
              A+ ++ + F  +P     G ++++ VL  GGL
Sbjct: 694 RAIASKVWDSLFKDDPFNRTGGEKFKERVLKWGGL 728

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  160 bits (405), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 132/519 (25%), Positives = 242/519 (46%), Gaps = 60/519 (11%)

Query: 232 QTEFVAFTKEELD--GVSDSVMEQFEKFNDEKTGKEMYKV-TFKYPDIFPVLKTARNPET 288
           ++E+V  +  EL+  G+S  ++    +     T  + YKV T+ Y   F +L++  +   
Sbjct: 243 KSEYVKVSCNELETSGISPLLLNHLSR----DTKGQNYKVPTYGYI-AFSILRSCPSENI 297

Query: 289 RKKAFAGDQNKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLED 348
           R K +    +   +      + +KLR  LA I+G ++Y++Y LE KMAK+   V  F+E 
Sbjct: 298 RMKVWTAVHSCPEKQITRLKHLVKLRGLLAQIMGKNSYSDYQLEGKMAKSPVYVRGFVES 357

Query: 349 LIDRLKPLGXXXXXXXXXXXXXXXXXXNLPFDNH-------YYVWDHRXXXXXXXXXXXX 401
           L + +KPL                   +LP              WD              
Sbjct: 358 LAEAIKPLAMRELRALANLKSSHL---DLPIPKTDEEVLKFVRPWDRDFYSTLISLQQQR 414

Query: 402 VDLE--KISEYYPLDSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDN 459
             LE  +I+ Y+ L + ++G+ ++ E +  ++   E   +K    W  EV+++ V     
Sbjct: 415 KTLENEQINSYFSLGTVMQGLSSLLEDIYGIRL--EPAVAKVGETWSPEVRRINVVS--- 469

Query: 460 PENPEFVGWIYFDLHPRDGKYGHAANFGISSSYI---------------KPNNERSY--P 502
            +    +G +Y DL  R GK  + A+F +  S                 +P++ + +  P
Sbjct: 470 -DQEGVIGVVYCDLFERQGKTSNPAHFTVCCSRQIYPEETDLSTIQVGQQPSSGQIFQLP 528

Query: 503 VTALVCNFSKVTADKP--ALLKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFV 560
           V +LVC+FS+ +  K    LL+ +E+ T FHE+GH IH ++G+ +    +G      DFV
Sbjct: 529 VISLVCSFSQNSGSKKDVCLLQLSEVDTLFHEMGHAIHSMLGRTSLQNISGTRCAT-DFV 587

Query: 561 EAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELL----NSLVATKHVNGALFALRQLHF 616
           E PS ++E +  +   L  + KHY T E +P ELL    N L   +  N   F+  Q   
Sbjct: 588 ELPSILMEHFAHDSRVLSRIGKHYITNEPVPDELLHLNQNELKYLQ--NTETFS--QAKM 643

Query: 617 GLFDMKVHTSKDLEN--LDFLKLWNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYY 674
            + D ++H+ + L +  +D +++++E+ +++ ++ +    +     FGH++   Y A YY
Sbjct: 644 AMLDQEMHSPRMLTDGPVDVVEIYHEVEKQMGVLTDDK--SNWCGRFGHLL--GYGASYY 699

Query: 675 GYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGG 713
            Y++    A+ ++   FA +P   K G ++++ VL  GG
Sbjct: 700 SYLFDRAIASKVWQHLFANDPFSRKSGEKFKNSVLRWGG 738

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  160 bits (404), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 129/494 (26%), Positives = 220/494 (44%), Gaps = 50/494 (10%)

Query: 254 FEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKVSENTVLFTNTLKL 313
            ++ N +  G+     TF Y   + +LK+    E RKK +    +   +     ++ +KL
Sbjct: 263 LKQLNKDVKGQNYKIPTFGYA-AYALLKSCEKEEVRKKLWTALHSCSDKQIKRLSHLIKL 321

Query: 314 RNQLADILGYSTYANYNLELKMAK----AQDSVFKFLEDLIDR-------LKPLGXXXXX 362
           R  LA+++   +YA Y LE KMAK     QD +   +   ID+       +  L      
Sbjct: 322 RAILANLMNKESYAEYQLEGKMAKNPKDVQDFILTLMNGTIDKTANELKFIAELKTKDLK 381

Query: 363 XXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEGMLN 422
                          P+D  YY   +              + ++IS Y+ L + IEG+ +
Sbjct: 382 KPLATKTDDILRLVRPWDRDYYTGKY-----LQLNPSDAPNAKEISYYFTLGNVIEGLSD 436

Query: 423 IYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKYGH 482
           +++ +  ++   E + +     W  +V++L V      E    +G IY DL  R+GK  +
Sbjct: 437 LFQHIYGIRL--EPEIADEGETWSPDVRRLNVIS----EEEGIIGIIYCDLFERNGKTSN 490

Query: 483 AANFGISSS-YIKPNN------------ERSY---PVTALVCNFSKV-TADKPAL--LKH 523
            A+F +  S  I PN             + SY   PV +LVCNF+ +  A K  L  L+ 
Sbjct: 491 PAHFTVCCSRQIYPNETDFSTIQVGENPDGSYFQLPVISLVCNFAPIPIASKKTLCFLQL 550

Query: 524 NEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKH 583
           +E+ T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L  +SKH
Sbjct: 551 SEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKISKH 609

Query: 584 YKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKVHTSK---DLENLDFLKLWNE 640
           Y+TGE I   +L S + T +         Q    + D   H  +   D++N D +K +  
Sbjct: 610 YETGETIQAGMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEIISDIDNFDIVKNYQA 669

Query: 641 LREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKV 700
           L   + ++ +    +     FGH+    Y A YY Y++    A+ ++Y  F  +P   K 
Sbjct: 670 LERRLKVLVDDQ--SNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKN 725

Query: 701 GVEYRDWVLARGGL 714
           G +++  +L  GGL
Sbjct: 726 GDKFKKHLLKWGGL 739

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  159 bits (402), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 123/499 (24%), Positives = 216/499 (43%), Gaps = 45/499 (9%)

Query: 245 GVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKVSENT 304
           G++  ++ Q  K   +  GK  YK+       + VL+   +   RKK +    +   +  
Sbjct: 269 GINQLILSQLSK---DIKGKH-YKIPTHGYIAYSVLRACPDEIVRKKLWTAMHSCPDKQI 324

Query: 305 VLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKP-----LGXX 359
           V     ++LR  LA ++G  +YA Y LE KMAK+ + V  F++ LI   +P     LG  
Sbjct: 325 VRLDQLVRLRAVLAFLMGKKSYAEYQLEGKMAKSPEEVTDFIDSLIKVTQPKAKQELGFI 384

Query: 360 XXXXXXXXXXXXXXXXNLPFDNHYYVWD---HRXXXXXXXXXXXXVDLEKISEYYPLDST 416
                           NL   +    WD   +             +D ++IS Y+ L + 
Sbjct: 385 SDLKRKHMDLPPSETSNLDTLDIVRPWDRDFYHTIYSIQQRRQSPIDDQQISMYFTLGNV 444

Query: 417 IEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPR 476
           ++G+ +++  +  ++   E   ++    W  EV++L V      +    +G +Y DL  R
Sbjct: 445 MQGLSDLFHQIYGIRL--EPVIAQKGETWSPEVRRLNVVS----DEEGVIGVVYCDLFER 498

Query: 477 DGKYGHAANFGISSS---YIKPNNERSY-------------PVTALVCNFSKVT---ADK 517
           DGK  + ++F +  S   Y K N+  +              P+ +LVCNF+         
Sbjct: 499 DGKTSNPSHFTVCCSRQIYPKENDLSTIQIGTNKDGTKFQLPIISLVCNFASSVVSFGQS 558

Query: 518 PALLKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNEL 577
             LL  +EI T FHE+GH +H ++G+      +G      DFVE PS ++E +  +   L
Sbjct: 559 LCLLHISEIETLFHEMGHAMHSMLGRTRLQNLSGTRCAT-DFVELPSILMEHFARDTRVL 617

Query: 578 LSLSKHYKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKVHTSK---DLENLDF 634
             + KH  TGE +P  LL + +             Q    + D ++H  +    ++ LD 
Sbjct: 618 RQIGKHCNTGEPVPESLLTNYLQDLQYMQYCETFSQAKMAMLDQRLHGKEIITGMDTLDV 677

Query: 635 LKLWNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAAN 694
           + L+  L  E+ ++ +      G   FGH+    Y A YY Y++    A+ ++ + F  +
Sbjct: 678 VALYQNLERELRVLVDDQSTWCG--RFGHLF--GYGATYYSYLFDRAIASKVWESLFQED 733

Query: 695 PLETKVGVEYRDWVLARGG 713
           P     G  ++++VL  GG
Sbjct: 734 PFSRAGGQRFKEYVLKWGG 752

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  158 bits (400), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 127/483 (26%), Positives = 213/483 (44%), Gaps = 48/483 (9%)

Query: 264 KEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKVSENTVLFTNTLKLRNQLADILGY 323
           +E YK+    P  + VLK  +N E R   +    +  SE  +  ++ +KLR  LA+++G 
Sbjct: 276 RENYKIPTYGPTPYAVLKDCKNEEVRADIWTALHSCSSEQILRLSHLVKLRAMLANLMGA 335

Query: 324 STYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGXXXXXXXXXXXXXXXXXXNL------ 377
            +++ Y L+ K+AKA   V  F+E LI  ++P                    N       
Sbjct: 336 ESFSQYQLKGKLAKAPKDVKNFIETLIKYVRPNTEKELKFIADLKREDQGKINCGEMDGV 395

Query: 378 -----PFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEGMLNIYETLLNLKF 432
                P+D  YY   +                E +S Y+ L    EG+ ++   +  +K 
Sbjct: 396 LSTVRPWDRDYYSSIYFKGKEKTEHEFT----EPLSSYFTLGGVFEGLSDLLTQIYGIKL 451

Query: 433 IEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKYGHAANFGISSS- 491
             E     +   W  +V+++ V      E    +G IYFDL  R GK  + A+F +  S 
Sbjct: 452 --EPAIPVSGETWFNDVRKINVIS----EEEGIIGIIYFDLFERYGKTSNPAHFTVCCSR 505

Query: 492 --YIKPNNER-------------SYPVTALVCNFSKVT--ADKP-ALLKHNEITTFFHEL 533
             Y + N +                P+ +LVCNFS+ T  +DK   LL  +EI T FHE+
Sbjct: 506 EMYPEENADSIIQLGSKKDGTIFQLPIISLVCNFSRRTFQSDKTICLLTLSEIETLFHEM 565

Query: 534 GHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTE 593
           GH IH ++G+      +G      DFVE PS ++E +  +   L  +S HY+TGEKI  +
Sbjct: 566 GHAIHSMLGRTTLQNVSGTRCAT-DFVELPSILMEHFASDTRVLKKMSCHYETGEKIAEK 624

Query: 594 LLNSLVATKHVNGALFALRQLHFGLFDMKVHTSK---DLENLDFLKLWNELREEVSLVEN 650
            L   +       +     Q    + D ++H+ K   +L+NL+ ++++  L   + ++  
Sbjct: 625 KLQFHLKEGEFLRSCETFSQAKMAMLDQELHSDKIIHNLDNLNVVEIYQNLERRLQVLV- 683

Query: 651 GDLFTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLA 710
            D  +     FGH+    Y A YY Y++    A  ++   FA +P     G ++++ +L 
Sbjct: 684 -DDRSNWCGKFGHLF--GYGATYYSYLFDRAIARKVWNHLFANDPFNKTNGEKFKESLLK 740

Query: 711 RGG 713
            GG
Sbjct: 741 WGG 743

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  158 bits (399), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 133/513 (25%), Positives = 225/513 (43%), Gaps = 53/513 (10%)

Query: 236 VAFTKEELDGVSDSVMEQFEKFNDEKTGKEMYKV-TFKYPDIFPVLKTARNPETRKKAFA 294
           V  +  ELD  + S     ++ N +  G+  YKV TF Y   + +LK+    + RKK + 
Sbjct: 249 VKISCRELDNSNVSAF-LLKQLNKDVKGQN-YKVPTFGYA-AYALLKSCEKEQVRKKIWT 305

Query: 295 GDQNKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAK----AQDSVFKFLEDLI 350
              +   +      + +KLR  LAD++   +YA Y LE KMAK     QD +   + D I
Sbjct: 306 ALHSCSDKQIKRLNHLIKLRANLADLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNDTI 365

Query: 351 DR-------LKPLGXXXXXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVD 403
           D+       +  L                     P+D  YY   +               
Sbjct: 366 DKTATELKFIAELKAKDLKKPLATKTDEILKLVRPWDRDYYTGKYLQLNPSNAPSA---- 421

Query: 404 LEKISEYYPLDSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENP 463
            ++IS Y+ L + I+G+ ++++ +  +K   E   +     W  +V++L V      E  
Sbjct: 422 -KEISSYFTLGNVIQGLSDLFQHIYGIKL--EPAIADEGETWSPDVRRLNVIS----EEE 474

Query: 464 EFVGWIYFDLHPRDGKYGHAANFGISSS-YIKPNNER---------------SYPVTALV 507
             +G IY DL  R GK  + A+F +  S  I PN                    PV +LV
Sbjct: 475 GIIGIIYCDLFERSGKTSNPAHFTVCCSRQIYPNETDFSTIQLGENADGSFFQLPVISLV 534

Query: 508 CNFSKV-TADKPAL--LKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPS 564
           CNF+ +  A K +L  L+ +E+ T FHE+GH +H ++G+ +    +G      DFVE PS
Sbjct: 535 CNFAPIPIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPS 593

Query: 565 QMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKVH 624
            ++E +  +   L  + KHY+TGE +  ++L S + T +         Q    + D   H
Sbjct: 594 ILMEHFAKDIRILTRIGKHYETGETVEPDMLQSFMRTTNFLQNCETYSQAKMAMLDQSFH 653

Query: 625 TSK---DLENLDFLKLWNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAEV 681
             +   +++N D +K +  L   + ++ +    +     FGH+    Y A YY Y++   
Sbjct: 654 DEEVISNIDNYDVVKNYQALERRLKVLVDDQ--SNWCGRFGHLF--GYGATYYSYLFDRT 709

Query: 682 FATDMYYTKFAANPLETKVGVEYRDWVLARGGL 714
            A+ ++Y  F  +P   K G +++  +L  GGL
Sbjct: 710 IASKIWYALFEDDPYSRKNGDKFKKHLLKWGGL 742

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  154 bits (390), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 139/557 (24%), Positives = 249/557 (44%), Gaps = 58/557 (10%)

Query: 195 DFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGE-QTEFVAFTKEELD--GVSDSVM 251
           DF ++G+ +D + R                F  N+   ++  V     EL+  GV+  ++
Sbjct: 205 DFEKSGIYMDPNIRKQFISLSQEISLTGQDFINNIDLIKSNHVKIKCSELNKSGVNSLLL 264

Query: 252 EQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKVSENTVLFTNTL 311
           +Q  K   + TGK  YK+         ++++  +   R K +A   +  ++     T+ +
Sbjct: 265 KQLPK---DITGK-YYKIPTSGYIPISLIRSCPDATIRAKVWASLHSCPNDQIRRLTHLV 320

Query: 312 KLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKP-----------LGXXX 360
           KLR  LA +L   ++A Y LE KMAK   +V  F++ L+D ++P           L    
Sbjct: 321 KLRAILAHLLNKCSFAKYQLEGKMAKTPQNVRDFIKTLMDYMRPKAAQELKFMADLKCKE 380

Query: 361 XXXXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEGM 420
                            P+D  YY   H             +++     Y+ + + ++G+
Sbjct: 381 LNIPTSDSTTAILDLISPWDREYYTTIHSKAKDVNLYENHPINM-----YFTMGNIMKGL 435

Query: 421 LNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKY 480
            +I++ +  ++   E    +    W  EV++L V      E    +G +Y DL  R GK 
Sbjct: 436 SHIFQRIYGIRL--EAVVPEEGETWSPEVRRLNVIS----ETEGLIGVVYCDLFERAGKT 489

Query: 481 GHAANFGISSS-YIKPN-NERS--------------YPVTALVCNFSKV--TADKP-ALL 521
            + A+F +  S  I P+ N+ S               PV +LVCNFS    + DK   LL
Sbjct: 490 SNPAHFTVCCSRQIYPDENDLSTIQIGTNPDGTAFQLPVISLVCNFSSTLTSNDKMICLL 549

Query: 522 KHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLS 581
           + NEI T FHE+GH +H ++G++     +G      DFVE PS ++E +  +K  L  + 
Sbjct: 550 QLNEIETLFHEMGHAMHSMLGRSRLQNVSGTRCAT-DFVELPSILMEHFARDKRVLHEIG 608

Query: 582 KHYKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKVHTS---KDLENLDFLKLW 638
            HY+T E++   ++ + +             Q    + D ++++    KDL+++D +K++
Sbjct: 609 FHYETNERVSEYVIEAHLKKMKFLQDCETFSQGKMAMLDQELYSENIIKDLDHVDVVKIY 668

Query: 639 NELREEVS-LVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLE 697
             L E++  LV+N    +     FGH+    Y A YY Y++    A+ ++   FA +P  
Sbjct: 669 QTLEEDLKVLVDNK---SNWCGKFGHLF--GYGASYYSYLFDRAIASKVWDQLFAKDPFS 723

Query: 698 TKVGVEYRDWVLARGGL 714
            + G ++++ VL  GGL
Sbjct: 724 REGGEKFKNCVLKWGGL 740

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  153 bits (386), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 122/494 (24%), Positives = 219/494 (44%), Gaps = 50/494 (10%)

Query: 254 FEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKVSENTVLFTNTLKL 313
            ++ N +  G+     TF Y   + +LK+  N   RKK +    +   +     ++ +KL
Sbjct: 263 LKQLNKDVKGQNYKVPTFGYA-AYALLKSCENEMVRKKLWTALHSCSDKQVKRLSHLIKL 321

Query: 314 RNQLADILGYSTYANYNLELKMAK----AQDSVFKFLEDLIDR-------LKPLGXXXXX 362
           R  LA+++  ++YA Y LE KMAK     QD +   + + I++       +  L      
Sbjct: 322 RAILANLMHKTSYAEYQLEGKMAKNPKDVQDFILTLMNNTIEKTANELKFIAELKAKDLK 381

Query: 363 XXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEGMLN 422
                          P+D  YY   +              + ++IS Y+ L + I+G+ +
Sbjct: 382 KPLTTNTDEILKLVRPWDRDYYTGKY-----FQLNPSNSPNAKEISYYFTLGNVIQGLSD 436

Query: 423 IYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKYGH 482
           +++ +  ++   E   +     W  +V++L V      E    +G IY DL  R+GK  +
Sbjct: 437 LFQQIYGIRL--EPAITDEGETWSPDVRRLNVIS----EEEGIIGIIYCDLFERNGKTSN 490

Query: 483 AANFGISSS-------------YIKPNNERSY---PVTALVCNFSKV-TADKPAL--LKH 523
            A+F +  S              +  N + +Y   PV +LVCNFS +  A K +L  L+ 
Sbjct: 491 PAHFTVCCSRQIYPSETDFSTIQVGENPDGTYFQLPVISLVCNFSPILIASKKSLCFLQL 550

Query: 524 NEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKH 583
           +E+ T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L  + KH
Sbjct: 551 SEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKIGKH 609

Query: 584 YKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKVHTSK---DLENLDFLKLWNE 640
           Y TGE I  ++L   + + +         Q    + D   H  K   D++N D ++ +  
Sbjct: 610 YGTGETIQADMLQRFMKSTNFLQNCETYSQAKMAMLDQSFHDEKIISDIDNFDVVENYQA 669

Query: 641 LREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKV 700
           L   + ++ +    +     FGH+    Y A YY Y++    A+ ++Y  F  +P   K 
Sbjct: 670 LERRLKVLVDDQ--SNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKN 725

Query: 701 GVEYRDWVLARGGL 714
           G +++  +L  GGL
Sbjct: 726 GDKFKKHLLKWGGL 739

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  151 bits (382), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 125/499 (25%), Positives = 213/499 (42%), Gaps = 48/499 (9%)

Query: 242 ELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKVS 301
           E  G S  V+ Q  K     T    YK+       + +L    +   R++ +    +   
Sbjct: 265 ESSGTSHLVLRQLTK----DTMGNNYKIPTSGYAPYTLLNACPSEAIRRQVWTAMFSCSE 320

Query: 302 ENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPL--GXX 359
           +      + L+LR +LA+I+G + Y +Y LE KMAK+ ++V  FL  L+D  KPL  G  
Sbjct: 321 KQVKRLKSLLQLRRKLANIMGATDYVSYQLEGKMAKSPENVKNFLNTLVDHTKPLAAGEL 380

Query: 360 XXXXXXXXXXXXXXXXNL-----PFDNHYYVWDHRXXXXXXXXXXXXVD-LEKISEYYPL 413
                           N      P+D  YY                 VD    I+ Y+ L
Sbjct: 381 EELAKLKRNVENLSETNTLKLMRPWDRDYY----SSLSPNFTRPNHRVDGFTSINTYFSL 436

Query: 414 DSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDL 473
              ++G+ +++  +  +    +   ++    W  +V++L V      E    +G IY DL
Sbjct: 437 GVVMQGISDLFRDIYGISL--KPVVAQAGETWAPDVRKLQVIS----ETEGIIGLIYCDL 490

Query: 474 HPRDGKYGHAANFGISSSYI---------------KPNNER-SYPVTALVCNFSKVTADK 517
             R GK    ++F +  S                  P+  R   PV +L+CNF      K
Sbjct: 491 LERPGKTTSPSHFTVCCSRQIYPEENDFSTIQVGENPDGSRFQMPVISLICNFRATRHGK 550

Query: 518 P---ALLKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNK 574
                LL+ +++ T FHE+GH +H ++G+      +G   V  DFVE PS ++E +  ++
Sbjct: 551 NKSLCLLELSDVETLFHEMGHALHSMLGRTQLQNLSGTRCVT-DFVELPSILMEHFAKDR 609

Query: 575 NELLSLSKHYKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDF 634
             LL +S +Y TGE IP ELL++     +         Q+   + D ++H+  D +  D 
Sbjct: 610 RVLLRISSNYATGEPIPEELLSAFQEQNNFLKNTETFSQIKMSMLDQRLHSITDQD--DI 667

Query: 635 LKLWNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAAN 694
           + +++ L  E+ ++ +    T     FGH+    Y A YY Y+     A  ++   F  +
Sbjct: 668 IAVYHGLEREMEVLVDDQ--TNWCGRFGHLF--GYGASYYSYLMDRAIAAKIWDHLFKKD 723

Query: 695 PLETKVGVEYRDWVLARGG 713
           P     G ++++ VL  GG
Sbjct: 724 PFSRSSGEKFKEGVLKWGG 742

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  151 bits (382), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 140/562 (24%), Positives = 242/562 (43%), Gaps = 49/562 (8%)

Query: 184 ENYEFVRKVHRDFVRAGLNLDESKRXXXXXXXXXXXNNSLKFATNLGEQTEFVAFTKEEL 243
           E Y+  + +  DF ++G+ ++ + R               +F +N    T+       E 
Sbjct: 214 EEYKVGKILLEDFEKSGIYMEPNTREKFIELSQEISLVGQEFISNTDYVTKNNILIDRES 273

Query: 244 DGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKVSEN 303
             +S+  +    +   + TGK  YK+    P  + +L    N   RKK +    +   E 
Sbjct: 274 LNLSELELPFTYQLKTDITGKH-YKIPTTGPIPYSILTNCSNETIRKKIWTELHSCSQEQ 332

Query: 304 TVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGXXXXXX 363
                  + LR +LA +L   ++A Y L+ KMAK  + V KF+  L+D  KPL       
Sbjct: 333 IERLKKMVTLRYKLAKLLKKKSFAEYQLQGKMAKNPEEVKKFISTLLDFTKPLAIKELTS 392

Query: 364 XXXXXXX---------XXXXXNL--PFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYP 412
                                NL  P+D +YY   +R             DL ++  Y+ 
Sbjct: 393 LAEVKAADLGLAFKNDSNFIVNLIRPWDRNYYSKINRYENKQTME-----DLNELPYYFS 447

Query: 413 LDSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFD 472
           L + I G+ N++  +  ++F  E    K +  W  EV++L V      E+   +G +Y D
Sbjct: 448 LGNVIAGLSNLFHNIYGIRF--ELAVPKLEETWLPEVRKLNVIS----ESEGLIGIVYCD 501

Query: 473 LHPRDGKYGHAANFGISSS---------------YIKPNNERSYPVTALVCNFSK---VT 514
           L  R  K  +AA+F I  S                    N    P+ +L+CNFSK     
Sbjct: 502 LFERPSKKTNAAHFTICCSREIGKGEDISTMQVGMNSKGNMFQLPIISLICNFSKSHLFE 561

Query: 515 ADKPALLKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNK 574
            + P  L+ +EI T FHE+GH +H ++G+      +G      DFVE PS ++E +  + 
Sbjct: 562 ENGPCFLQLHEIETLFHEMGHAMHSVLGRTRLQNTSGTRCAT-DFVELPSILMEHFAKDV 620

Query: 575 NELLSLSKHYKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKVHTSK---DLEN 631
             + S+S HY + E    ELL + + +      L    Q    + D  +H+++   D ++
Sbjct: 621 RVMESISSHYISQEPASPELLQTWLHSTDNLQNLELYTQAKMSMLDQILHSNEIFEDQKD 680

Query: 632 LDFLKLWNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKF 691
           ++ +K +N+L +++ L  +    +     FGH+    Y A YY Y++    A+ ++ + F
Sbjct: 681 INVVKSYNDLEKKLELFSDDQ--SNWCGKFGHLFG--YGASYYSYLFDRAIASKVWESLF 736

Query: 692 AANPLETKVGVEYRDWVLARGG 713
             NP     G++++D VL  GG
Sbjct: 737 KQNPFSRTSGLKFKDSVLRWGG 758

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  149 bits (375), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 125/494 (25%), Positives = 212/494 (42%), Gaps = 50/494 (10%)

Query: 254 FEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNKVSENTVLFTNTLKL 313
            ++ N +  G+     TF Y   F +LK+      RKK +    +   +        +KL
Sbjct: 263 LKQLNKDVKGQNYKVPTFGYA-AFALLKSCEIEVVRKKIWTALHSCSDKQIKRLDRLIKL 321

Query: 314 RNQLADILGYSTYANYNLELKMAK----AQDSVFKFLEDLIDR-------LKPLGXXXXX 362
           R  LA+++   +YA Y LE KMAK     QD +   + + ID+       +  L      
Sbjct: 322 RAVLANLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNNTIDKTANELKFIADLKAKDLK 381

Query: 363 XXXXXXXXXXXXXNLPFDNHYYVWDHRXXXXXXXXXXXXVDLEKISEYYPLDSTIEGMLN 422
                          P+D  YY   +                ++IS Y+ L + I+G+ +
Sbjct: 382 KPLTTNTDEILKLVRPWDRDYYTGKY-----IQLNPSNVPSAKEISYYFTLGNVIQGLSD 436

Query: 423 IYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKYGH 482
           +++ +  ++   E   +     W  +V++L V      E    +G IY DL  R+GK  +
Sbjct: 437 LFQQIYGIRL--EPAIADEGETWSPDVRRLNVIS----EEEGIIGIIYCDLFERNGKTSN 490

Query: 483 AANFGISSS-------------YIKPNNERSY---PVTALVCNFSKV-TADKPAL--LKH 523
            A+F +  S              +  N   SY   PV +LVCNFS V  A K +L  L+ 
Sbjct: 491 PAHFTVCCSRQIYPHETDFSTIQVGENPNGSYFQLPVISLVCNFSPVPIASKKSLCFLQL 550

Query: 524 NEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKH 583
           +E+ T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L  + KH
Sbjct: 551 SEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRVLTRIGKH 609

Query: 584 YKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKVHTSK---DLENLDFLKLWNE 640
           Y+TGE I   +L   + T +         Q    + D   H  K   D++N + +  +  
Sbjct: 610 YETGETIQKGMLQCFMKTTNFLQNCETYSQAKMAMLDQSFHDEKIMSDIDNFNVVDNYQA 669

Query: 641 LREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKV 700
           L   + ++ +    +     FGH+    Y A YY Y++    A+ ++YT F  +P     
Sbjct: 670 LERHLKVLVDDQ--SNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYTLFDDDPYSRNN 725

Query: 701 GVEYRDWVLARGGL 714
           G +++  +L  GGL
Sbjct: 726 GDKFKKHLLKWGGL 739

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  147 bits (372), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 129/520 (24%), Positives = 227/520 (43%), Gaps = 59/520 (11%)

Query: 232 QTEFVAFTKEELD--GVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETR 289
           ++ ++    EE+D  G++  ++ Q  K   +  GK  YK+       + +L++  + E R
Sbjct: 255 RSNYIKIKCEEVDNSGINKLLISQLPK---DVRGK-YYKIPTHGYIAYSILRSCPDEEIR 310

Query: 290 KKAFAGDQNKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDL 349
              +        +        L+LR  LA ++G  ++A Y LE KMA+    V  F+  L
Sbjct: 311 MNLWTAMHRCSDKQINRLDQLLRLRAILAKLMGKESFAQYQLEGKMAQTPQQVRDFIGTL 370

Query: 350 IDRLKP-----------LGXXXXXXXXXXXXXXXXXXNL--PFDNHYYVWDHRXXXXXXX 396
           ++ ++P           L                   ++  P+D  YY            
Sbjct: 371 VNYMRPKTIEELKFIYELKSKQEKREIQPSPSEQDIASMVRPWDREYYT-----SMYSLQ 425

Query: 397 XXXXXVDLEKISEYYPLDSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWK 456
                +D E+IS Y+ L + I+G+ +++E++  ++   E    K    +  EV++L V  
Sbjct: 426 QRRDAIDDEQISSYFTLGNVIQGLSDLFESIYGIRL--EPVVPKTGETFSPEVRRLNVV- 482

Query: 457 MDNPENPEFVGWIYFDLHPRDGKYGHAANFGISSS-YIKP------------NNER---S 500
               E    +G +Y DL  R GK  + ++F +  S  I P            N+E     
Sbjct: 483 ---CEQEGVIGVVYCDLFERAGKTSNPSHFTVCCSRQIYPKETEFSTIQTGFNSEGLMFQ 539

Query: 501 YPVTALVCNFSKVT---ADKPALLKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPW 557
            PV ALVCNFS  T        LL+ NE+ T FHE+GH +H ++G+      +G      
Sbjct: 540 LPVIALVCNFSSSTDSEGKSICLLQLNEVETLFHEMGHAMHSMLGRTRLQNISGTRCAT- 598

Query: 558 DFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTE-LLNSLVATKHVNGALFALRQLHF 616
           DFVE PS ++E +  +   L  + KH++TG  I  + LLN L  TK +        Q   
Sbjct: 599 DFVELPSILMEHFARDVRVLERIGKHHRTGAPISEKLLLNYLEETKFMQHCE-TFSQAKM 657

Query: 617 GLFDMKVHTS---KDLENLDFLKLWNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGY 673
            + D  +H     KD ++ D    + +L  ++ ++ +    +     FGH+    Y A Y
Sbjct: 658 AMLDQDLHGEKVIKDFDHFDVTAAYQQLERDMKVLVDDK--SNWCGKFGHLF--GYGATY 713

Query: 674 YGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGG 713
           Y Y++    A+ ++ + F+++P     G ++++ VL  GG
Sbjct: 714 YSYLFDRAIASKVWDSLFSSDPYSRVNGEKFKECVLKWGG 753

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  140 bits (353), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 126/520 (24%), Positives = 221/520 (42%), Gaps = 57/520 (10%)

Query: 232 QTEFVAFTKEELDG-VSDSVMEQFEKFNDEKTGKEMYKV-TFKYPDIFPVLKTARNPETR 289
           ++ ++  + E +D  V+  V  Q +K   + TG E YKV T+ Y     +L+T  +   R
Sbjct: 244 RSNYIKISCELMDAHVNKMVCSQMKK---DITG-EYYKVPTYGYIP-HTLLRTCSDEVIR 298

Query: 290 KKAFAGDQNKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDL 349
            K +    +         T  + LR +LA +LG   +A Y L  KMAK  ++V  FLE L
Sbjct: 299 MKIWTEMHSCSDAQIERLTKLISLRVELAKLLGSQNFAQYQLHGKMAKTPENVSGFLESL 358

Query: 350 I--------DRLKPLGXXXXXXXXXXX---XXXXXXXNLPFDNHYYVWDHRXXXXXXXXX 398
           +          LKPL                        P+D  YY              
Sbjct: 359 VHSTRIKAASELKPLAVLKSELTGTQTPHTSEEVLELMKPWDRDYY---GSIQALAQRRS 415

Query: 399 XXXVDLEKISEYYPLDSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMD 458
               + E IS  + L   ++G+ +++E +  +K +      K    W  +V+++ V    
Sbjct: 416 SSLDNGESISSSFSLGVVMQGLSDLFEKIYGIKLVPAT--PKTGETWSPDVRRIDVVD-- 471

Query: 459 NPENPEFVGWIYFDLHPRDGKYGHAANFGISSSY---------------IKPNNER-SYP 502
             E+   +G +Y DL  R+GK  + A+F +  S                +  N ++   P
Sbjct: 472 --EHDGLIGVMYCDLFEREGKTPNPAHFTVCCSRNMYLNEADTSTIQVGVNSNGQKFQLP 529

Query: 503 VTALVCNFSKVTAD-------KPALLKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAV 555
           V +LVC+F  V  +       +  LL+ NEI T FHE+GH +H ++G+      +G    
Sbjct: 530 VISLVCDFRWVEVNMGDGKHQQMCLLQLNEIETLFHEMGHAMHSMLGRTQLQNVSGTRCA 589

Query: 556 PWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVATKHVNGALFALRQLH 615
             DFVE PS ++E +  +   L S+S HYKTG+ +  E+L +               Q+ 
Sbjct: 590 T-DFVELPSILMEHFARDTRVLSSISSHYKTGKSLDVEVLKNHQLENQFLQNCETFSQIK 648

Query: 616 FGLFDMKVHTSKDLEN--LDFLKLWNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGY 673
               D ++H      +  +D + +++ L   ++++ +    +     FGH+    Y A Y
Sbjct: 649 MSFLDQELHNLDHTTDGSIDVIAIYHRLERRLAVLPDDQ--SNWCGKFGHLF--GYGASY 704

Query: 674 YGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGG 713
           Y Y++    A+ ++   F  +P     G ++++ +L  GG
Sbjct: 705 YSYLFDRAIASKIWDHLFEQDPFNRTNGTKFKEGLLQWGG 744

>ZYRO0D06710g Chr4 complement(579323..580285) [963 bp, 320 aa] {ON}
           weakly similar to uniprot|Q04608 Saccharomyces
           cerevisiae YDR124W Hypothetical ORF
          Length = 320

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 52/108 (48%), Gaps = 24/108 (22%)

Query: 522 KHNEITTFFHELGHG----IHDLVGKNNNSRFNG-----------PGAVPWDFVEAPSQM 566
           K NEI  F  + G+     + D +  N+N +F+            P  V WD V+   ++
Sbjct: 15  KFNEIAVFLLKEGYEFSIFVKDKIDSNSNCKFSQAYVTTAVEDILPIGV-WDLVDG-EKI 72

Query: 567 LEFWTWNKNELLSLSKHYKTGEKIPTELLNSLVATKHVNGALFALRQL 614
           +++     ++L +   HY T   IP  L N +V  K+V+GAL  LRQ+
Sbjct: 73  IKY----DSKLCAPQNHYPT---IPLPLTNLIVVEKYVHGALKLLRQV 113

>Kwal_23.5660 s23 (1258943..1259278) [336 bp, 111 aa] {ON} YDR286C -
           Hypothetical ORF [contig 11] FULL
          Length = 111

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 24/53 (45%)

Query: 437 DDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGKYGHAANFGIS 489
           DD KNK  W K    + V  ++N ENPE +  I+  L P   K       G S
Sbjct: 59  DDPKNKEWWTKYCLDVPVLHIENTENPESLSKIFHKLEPEQVKTQVRTAAGAS 111

>Smik_12.441 Chr12 (773399..775222) [1824 bp, 607 aa] {ON} YLR353W
           (REAL)
          Length = 607

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 24/50 (48%), Gaps = 5/50 (10%)

Query: 449 VKQLAVWKMDNPENPEFVGWIYFDLHPRDGKYGHAANFGISSSYIKPNNE 498
           V   AV  +  P++P  +G I   LH RD       N G S  YIK NNE
Sbjct: 301 VPGTAVRMIKIPQSPSLIGNILIPLHERD-----TGNEGSSKDYIKLNNE 345

>KAFR0F03190 Chr6 complement(632585..633217) [633 bp, 210 aa] {ON}
           Anc_4.101 YGL020C
          Length = 210

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 5/67 (7%)

Query: 659 DSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIE 718
           D+F +++S  ++ G     W  +  T + Y       + TKVGV +  W+ A   +    
Sbjct: 134 DTFPYLISGVWNNG-----WLHLVLTPLNYILGRQTSMSTKVGVSFGIWIWALTNVISNI 188

Query: 719 DNLIQFL 725
           ++LI+FL
Sbjct: 189 ESLIKFL 195

>KAFR0A08620 Chr1 (1727701..1730850) [3150 bp, 1049 aa] {ON} Anc_3.9
           YNL329C
          Length = 1049

 Score = 31.6 bits (70), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 26/45 (57%)

Query: 614 LHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGY 658
           L+  L+D  V  S D E L+F  L   +R   +++ NGDL ++G+
Sbjct: 106 LNTKLYDKLVTLSTDYERLEFFSLKYNIRNLKTVIHNGDLISEGW 150

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 82,347,673
Number of extensions: 3808537
Number of successful extensions: 12087
Number of sequences better than 10.0: 65
Number of HSP's gapped: 12245
Number of HSP's successfully gapped: 80
Length of query: 741
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 624
Effective length of database: 40,065,477
Effective search space: 25000857648
Effective search space used: 25000857648
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)