Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A073006.14ON57357328210.0
SAKL0E01012g6.14ON54448716640.0
KLTH0C11396g6.14ON55049116500.0
YEL060C (PRB1)6.14ON63547516370.0
Smik_5.276.14ON60847516340.0
TDEL0G045506.14ON56447116260.0
Kwal_56.223876.14ON54346516210.0
Suva_5.76.14ON66447816260.0
Skud_5.296.14ON60847516180.0
NCAS0F002206.14ON69541615950.0
NDAI0K028806.14ON70449015380.0
KLLA0D00979g6.14ON56159215230.0
Kpol_1032.56.14ON68047814950.0
CAGL0B03619g6.14ON46847114650.0
ZYRO0C07942g6.14ON54846414690.0
KAFR0L003606.14ON50243814570.0
ACR012C6.14ON54147314440.0
KNAG0E009206.14ON53158914370.0
Kpol_1045.756.14ON47745613980.0
Ecym_30186.14ON57547413930.0
TPHA0M002306.14ON58546512631e-168
Skud_15.1646.14ON48241512411e-166
Suva_15.1786.14ON47641312231e-163
Smik_15.1726.14ON47842012141e-162
YOR003W (YSP3)6.14ON47842011851e-157
CAGL0E02651g6.14ON48542910901e-143
KAFR0B065506.14ON45641310161e-132
NCAS0D026306.14ON4514219601e-124
NDAI0I022806.14ON4824518621e-109
KNAG0F02970singletonON4204038161e-103
CAGL0L13266gsingletonON5794407687e-94
NCAS0D043906.313ON4923954939e-55
TDEL0A072806.313ON4363844863e-54
ZYRO0D08822g6.313ON4903914842e-53
SAKL0A02002g6.313ON4793894796e-53
CAGL0L10802g6.313ON5173684747e-52
Kpol_1028.616.313ON5183304731e-51
Kpol_1018.56.313ON4653194673e-51
TBLA0F039706.313ON7343214671e-49
KLTH0A06094g6.313ON4963464544e-49
Ecym_21056.313ON6103594534e-48
Suva_3.846.313ON5273154484e-48
KNAG0I024706.313ON4753944411e-47
NDAI0I005606.313ON4834104412e-47
Smik_3.1496.313ON4913164403e-47
AAR069W6.313ON7683664513e-47
KAFR0J024506.313ON4783564305e-46
YCR045C (RRT12)6.313ON4913164272e-45
Skud_3.1246.313ON5403424292e-45
TPHA0D037606.313ON6073484262e-44
Kwal_23.61836.313ON4933474159e-44
KLLA0F06028g6.313ON5083303903e-40
TBLA0A067006.313ON4972743331e-32
Kwal_33.133721.78ON3773023219e-32
KLTH0F02288g1.78ON3803073112e-30
Kpol_2000.691.78ON3863253061e-29
ZYRO0F16764g1.78ON3863222531e-22
TDEL0C062301.78ON3643072325e-20
TPHA0B045201.78ON3882722202e-18
TBLA0A054101.78ON3822831891e-14
NCAS0A008802.6ON833254980.003
YNL238W (KEX2)2.6ON814249950.008
CAGL0J07546g2.6ON789248910.020
NDAI0F038902.6ON833259890.036
Suva_14.1062.6ON809254880.056
Skud_14.1012.6ON819253860.095
KNAG0F007702.6ON826252850.099
TBLA0B001302.6ON842249850.12
Smik_14.972.6ON814254840.15
Kwal_56.248002.6ON803246830.21
SAKL0G00440g2.6ON83663820.27
KLTH0H00418g2.6ON811248800.41
NCAS0F004905.85ON98765800.47
TPHA0P017902.6ON799255790.56
ZYRO0F15598g2.6ON79065780.76
KLLA0D19811g2.6ON756249751.6
NDAI0D026205.85ON98749742.7
KAFR0A080402.6ON76659732.7
ACR241C1.199ON79597732.9
Kpol_1050.725.85ON98935723.7
Ecym_64862.6ON78165724.1
TDEL0G010905.85ON98341706.3
TPHA0A052005.85ON99140706.8
Ecym_20193.17ON42358697.6
ABL203W2.6ON768247698.3
NDAI0H029102.394ON75462699.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07300
         (573 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...  1091   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   645   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   640   0.0  
YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...   635   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   634   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   630   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   629   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   630   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   627   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   619   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   597   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   591   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   580   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   568   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   570   0.0  
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   565   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   560   0.0  
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   558   0.0  
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   543   0.0  
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   541   0.0  
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   491   e-168
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   482   e-166
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   475   e-163
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   472   e-162
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   461   e-157
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   424   e-143
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   395   e-132
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     374   e-124
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   336   e-109
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              318   e-103
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   300   7e-94
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   194   9e-55
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   191   3e-54
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   191   2e-53
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   189   6e-53
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   187   7e-52
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   186   1e-51
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   184   3e-51
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   184   1e-49
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   179   4e-49
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   179   4e-48
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   177   4e-48
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   174   1e-47
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    174   2e-47
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   174   3e-47
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   178   3e-47
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   170   5e-46
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   169   2e-45
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   169   2e-45
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   168   2e-44
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   164   9e-44
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   154   3e-40
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   132   1e-32
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   128   9e-32
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   124   2e-30
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   122   1e-29
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   102   1e-22
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    94   5e-20
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    89   2e-18
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    77   1e-14
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    42   0.003
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    41   0.008
CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] ...    40   0.020
NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {O...    39   0.036
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    39   0.056
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    38   0.095
KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6...    37   0.099
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    37   0.12 
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    37   0.15 
Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]...    37   0.21 
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    36   0.27 
KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar ...    35   0.41 
NCAS0F00490 Chr6 (89926..92889) [2964 bp, 987 aa] {ON} Anc_5.85 ...    35   0.47 
TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {...    35   0.56 
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    35   0.76 
KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]...    33   1.6  
NDAI0D02620 Chr4 complement(606774..609737) [2964 bp, 987 aa] {O...    33   2.7  
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    33   2.7  
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    33   2.9  
Kpol_1050.72 s1050 complement(157470..160439) [2970 bp, 989 aa] ...    32   3.7  
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    32   4.1  
TDEL0G01090 Chr7 (223036..225987) [2952 bp, 983 aa] {ON} Anc_5.8...    32   6.3  
TPHA0A05200 Chr1 complement(1168851..1171826) [2976 bp, 991 aa] ...    32   6.8  
Ecym_2019 Chr2 (28247..29518) [1272 bp, 423 aa] {ON} similar to ...    31   7.6  
ABL203W Chr2 (26256..28562) [2307 bp, 768 aa] {ON} Syntenic homo...    31   8.3  
NDAI0H02910 Chr8 complement(711397..713661) [2265 bp, 754 aa] {O...    31   9.8  

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score = 1091 bits (2821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/573 (93%), Positives = 534/573 (93%)

Query: 1   MKLEKTSLVSLATISVASSFLIPADERMLRDKLVPQHGKAGADAEHAKHKGGQHSVVKHN 60
           MKLEKTSLVSLATISVASSFLIPADERMLRDKLVPQHGKAGADAEHAKHKGGQHSVVKHN
Sbjct: 1   MKLEKTSLVSLATISVASSFLIPADERMLRDKLVPQHGKAGADAEHAKHKGGQHSVVKHN 60

Query: 61  SAKHHKQSRKQMRVHKHXXXXXXXXXXXXXXXXXXXXXXXXXXXNYESPAIAPLYSQSLH 120
           SAKHHKQSRKQMRVHKH                           NYESPAIAPLYSQSLH
Sbjct: 61  SAKHHKQSRKQMRVHKHDDSDSGSDSDSGSDSDGDGDGDGDGDGNYESPAIAPLYSQSLH 120

Query: 121 PQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLDLQQPII 180
           PQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLDLQQPII
Sbjct: 121 PQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLDLQQPII 180

Query: 181 DSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISHR 240
           DSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISHR
Sbjct: 181 DSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISHR 240

Query: 241 ERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNGHG 300
           ERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNGHG
Sbjct: 241 ERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNGHG 300

Query: 301 THCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFK 360
           THCAGTIASKHYG            LRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFK
Sbjct: 301 THCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFK 360

Query: 361 GSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTL 420
           GSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTL
Sbjct: 361 GSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTL 420

Query: 421 SDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQPE 480
           SDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQPE
Sbjct: 421 SDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQPE 480

Query: 481 QDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFWNISKP 540
           QDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFWNISKP
Sbjct: 481 QDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFWNISKP 540

Query: 541 ADLESNEVYKNLDLVGDVLYDQFTGIFKKMNLL 573
           ADLESNEVYKNLDLVGDVLYDQFTGIFKKMNLL
Sbjct: 541 ADLESNEVYKNLDLVGDVLYDQFTGIFKKMNLL 573

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/487 (64%), Positives = 375/487 (77%), Gaps = 23/487 (4%)

Query: 107 ESPAIAPLYSQSLHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPY 166
           E   +APL S S  P NIIPHRYII FKKD  PEEI FH++ I+E   +S+A+L     +
Sbjct: 61  EEVKLAPLVS-SPQPANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSF 119

Query: 167 FNSVEG---------LDLQQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDS 217
           F + +G            +  I +SF+I ++L GYIGYFTD+V+DFIR+N  V+F+E+DS
Sbjct: 120 FAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQWVEFIEKDS 179

Query: 218 TVNINEFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDF 277
            V  +EFDTQNGAPWGL+RISHRERLNLGSFNKYL+DD AG+GVT+YVIDTG+NV H DF
Sbjct: 180 LVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTGINVNHKDF 239

Query: 278 EGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDV 337
            GRA WGKT+P NDED DGNGHGTHCAGTIAS+HYG            LRSNGSG+MSDV
Sbjct: 240 NGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTMSDV 299

Query: 338 LKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNE 397
           +KGVE+A  SH    K  K GFKGSTANMSLGGGKSP+LDLAVNAAVKAGIHFAVAAGNE
Sbjct: 300 VKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNE 359

Query: 398 NQDACNTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATL 457
           NQDACNTSPA+A+ AITVGASTLSDDRAYFSNWGKCVD+FAPGLN+LSTYIGS+ ATATL
Sbjct: 360 NQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATL 419

Query: 458 SGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPEL 517
           SGTSMASPHVAGLL+YFLSLQP+ DSEF   +  GITPAQLKK+LI+Y TKD+L ++PE 
Sbjct: 420 SGTSMASPHVAGLLTYFLSLQPDSDSEFF--QASGITPAQLKKKLIAYSTKDVLYELPED 477

Query: 518 TPNVLVFNGAGQDLSDFWNISKP-----------ADLESNEVYKNLDLVGDVLYDQFTGI 566
           TPN L++NG GQDLSDFW  S+             D + +E+ ++ D   D+L+++   +
Sbjct: 478 TPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDLLFEEVRSV 537

Query: 567 FKKMNLL 573
           F K+N++
Sbjct: 538 FDKLNII 544

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/491 (64%), Positives = 378/491 (76%), Gaps = 26/491 (5%)

Query: 107 ESPAIAPLYSQSLHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPY 166
           ES  ++PL S S      IPHRYI+ FK++++PEE+DFH+Q ++E   QS+A+L   H +
Sbjct: 62  ESVELSPLVSSS-GKYLAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEF 120

Query: 167 FNSVEG--------LDLQQP---------IIDSFNINSLLQGYIGYFTDDVIDFIRLNPL 209
           F S E         LD Q+          I DSF+++ LL GYIGYFTD+++DFIR+NPL
Sbjct: 121 FTSTENFVEDRDFELDYQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNPL 180

Query: 210 VQFVEQDSTVNINEFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTG 269
           V FVEQDS V   EF TQNGAPWGL+RISHRE+LNLGSFNKYL+DD AG+GVT+YVIDTG
Sbjct: 181 VDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDTG 240

Query: 270 VNVEHNDFEGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSN 329
           VNV+H DFEGRASWGKTIP ND D DGNGHGTHCAGTIASKHYG            LRSN
Sbjct: 241 VNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSN 300

Query: 330 GSGSMSDVLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIH 389
           GSGSMSDV+KGVE+A  SH   VK  K GFKGSTANMSLGGGKSP+LD+AVNAAVKAGIH
Sbjct: 301 GSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIH 360

Query: 390 FAVAAGNENQDACNTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG 449
           FAVAAGNENQDACN+SPASA+ A+TVGASTL+DDRAYFSNWGKCVD+FAPGLN+LSTYIG
Sbjct: 361 FAVAAGNENQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIG 420

Query: 450 SDDATATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKD 509
           SD ATATLSGTSMASPHVAGLL+YFLSLQP+ DSE+  +  GGITP+QLKK+LI+Y TK+
Sbjct: 421 SDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHA-AGGITPSQLKKKLIAYSTKN 479

Query: 510 ILLDIPELTPNVLVFNGAGQDLSDFWN----ISKPADLESNEVYKNLDLV---GDVLYDQ 562
           +L DIP+ T N L+FNG G+ L DFW     + +  D  S+E+   +D +    DVLY++
Sbjct: 480 VLGDIPDDTVNYLIFNGGGEGLDDFWGKESVVDEVEDTISSEIESFIDALEEKTDVLYEE 539

Query: 563 FTGIFKKMNLL 573
              +F  MN++
Sbjct: 540 IREVFDHMNII 550

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/475 (66%), Positives = 364/475 (76%), Gaps = 12/475 (2%)

Query: 111 IAPLYSQS-LHP---QNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPY 166
           +APL S +  +P     IIP+RYII FK+    EEIDFH++++ + Q QS+  L  +  +
Sbjct: 161 LAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAF 220

Query: 167 FNSVEGLDLQQP----IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNIN 222
           F S +   L       I DSFNI++L  GYIGYFT +++D IR NPLV FVE+DS V   
Sbjct: 221 FISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEAT 280

Query: 223 EFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRAS 282
           EFDTQN APWGLARISHRERLNLGSFNKYL+DD AG GVT+YVIDTGVN+ H DFE RA 
Sbjct: 281 EFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAI 340

Query: 283 WGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVE 342
           WGKTIP NDEDLDGNGHGTHCAGTIASKHYG            LRSNGSG+MSDV+KGVE
Sbjct: 341 WGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVE 400

Query: 343 YATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDAC 402
           YA  +H  + + KK GFKGSTANMSLGGGKSP+LDLAVNAAV+ GIHFAVAAGNENQDAC
Sbjct: 401 YAAKAHQKEAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDAC 460

Query: 403 NTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSM 462
           NTSPASA  AITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSM
Sbjct: 461 NTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSM 520

Query: 463 ASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVL 522
           ASPHVAGLL+YFLSLQP  DSEF    +  +TP QLKK+LI Y TKDIL DIPE TPNVL
Sbjct: 521 ASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVL 580

Query: 523 VFNGAGQDLSDFWNISKPADLESNEVYKNLD-LVG---DVLYDQFTGIFKKMNLL 573
           ++NG GQDLS FWN +K +     +   N+D  +G   D+++DQ   I  K+N++
Sbjct: 581 IYNGGGQDLSAFWNDTKKSHSSGFKQELNMDEFIGSKTDLIFDQVRDILDKLNII 635

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/475 (66%), Positives = 365/475 (76%), Gaps = 12/475 (2%)

Query: 111 IAPLYSQS-LHP---QNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPY 166
           +APL S +  +P     IIP+RYI+ FKK V  EE++FH++S+++ Q QS+  L  +  +
Sbjct: 134 LAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAF 193

Query: 167 FNSVEGLDLQQP----IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNIN 222
           F S     L       I DSFNI+++  GYIGYFT ++ID IR NPLV FVE+DS V   
Sbjct: 194 FTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEAT 253

Query: 223 EFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRAS 282
           EFDTQN APWGLARISHRERLNLGSFNKYL+DD AG GVT+YVIDTGVN+ H DFE RA 
Sbjct: 254 EFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAI 313

Query: 283 WGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVE 342
           WGKTIP NDEDLDGNGHGTHCAGTIASKHYG            LRSNGSG+MSDV+KGVE
Sbjct: 314 WGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVE 373

Query: 343 YATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDAC 402
           YA  +H    + KK GFKGSTANMSLGGGKSP+LDLAVNAAV+AGIHFAVAAGNENQDAC
Sbjct: 374 YAAKAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDAC 433

Query: 403 NTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSM 462
           NTSPASA  AITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSD+ATATLSGTSM
Sbjct: 434 NTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSM 493

Query: 463 ASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVL 522
           ASPHVAGLL+YFLSLQP  DSEF    +  +TP QLKK+LI Y TKDIL DIPE TPN L
Sbjct: 494 ASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNFL 553

Query: 523 VFNGAGQDLSDFWNISKPADLESNEVYKNLD-LVG---DVLYDQFTGIFKKMNLL 573
           ++NG GQDLS FWN +K +    ++   N+D  +G   D+L++Q   +  K+N++
Sbjct: 554 IYNGGGQDLSAFWNDTKKSHPSGSKHELNMDEFIGSKTDLLFEQVRDVLDKLNII 608

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/471 (65%), Positives = 365/471 (77%), Gaps = 13/471 (2%)

Query: 110 AIAPLYSQSLHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNS 169
            +APL      P N  PHRYI+  K   +PEEI  H ++I + Q QS+ +L  D P+F S
Sbjct: 100 GVAPLSI----PPNAFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFF-S 153

Query: 170 VEGLDLQQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNG 229
            +G+     I DSF++  LL GY+GYFTD V++ IR +P+V FVE DS V+ +EFDTQNG
Sbjct: 154 AQGVRTTGGIQDSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNG 213

Query: 230 APWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPN 289
           APWGL+RISHRERLNLGSFNKYLFDD+AG+GVT+YVIDTG+NV+H DFEGRA WGKTIP 
Sbjct: 214 APWGLSRISHRERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPT 273

Query: 290 NDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHL 349
           NDEDLDGNGHGTHCAGTIASKHYG            LRSNGSGSMSDV+KGVE+A  SH 
Sbjct: 274 NDEDLDGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQ 333

Query: 350 ADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASA 409
             VK+KK GFKGSTANMSLGGGKSP+LDLAVNAAVKAGIHFAVAAGNENQDACNTSPA+A
Sbjct: 334 KAVKDKKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAA 393

Query: 410 KYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAG 469
           + A+TVGASTLSDDRAYFSN+GKCVD+FAPGLNILSTYIGSDDATATLSGTSMASPHVAG
Sbjct: 394 EQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAG 453

Query: 470 LLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQ 529
           LL+YFLSLQP+ DS+F  +   G+TP QLKK+LI+Y TKDIL D+PE TPN L++NG G 
Sbjct: 454 LLTYFLSLQPDSDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGH 513

Query: 530 DLSDFWN-------ISKPADLESNEVYKNLDLVGDVLYDQFTGIFKKMNLL 573
            L  FW+        ++  D +  E+  NL    D L+DQ   +  ++N++
Sbjct: 514 GLKGFWDGHDKQEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/465 (64%), Positives = 364/465 (78%), Gaps = 17/465 (3%)

Query: 125 IPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLDL-------QQ 177
           IPHRYI+ FK  V PEE+DFH + ++E   QS+ +L  +  +F +    ++       + 
Sbjct: 80  IPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMDEEMGIMATSREG 139

Query: 178 PIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARI 237
            I+DSF++N +L+GYIGYFT +++DFIR+NPLV FVEQDS V  NEFDTQNGAPWGL+RI
Sbjct: 140 GILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMVYANEFDTQNGAPWGLSRI 199

Query: 238 SHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGN 297
           SHRE+LNLGSFNKYL+DD AG+GVT+YVIDTG+N++H DFEGRA+WGKT+P ND D DGN
Sbjct: 200 SHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEGRAAWGKTVPTNDLDQDGN 259

Query: 298 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKS 357
           GHGTHCAGTIASKHYG            LRSNGSGSMSDV+KGVE+A  SH   VK  K 
Sbjct: 260 GHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVKGVEFAAKSHQDAVKKNKK 319

Query: 358 GFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGA 417
           GFKGSTANMSLGGGKSP+LD+AVNAAVKAGIHFAVAAGNENQDACN+SPA+A+ AITVGA
Sbjct: 320 GFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQDACNSSPAAAENAITVGA 379

Query: 418 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSL 477
           STL+DDRAYFSNWGKCVD+FAPGLN+LSTYIGS+ ATATLSGTSMASPHVAGLL+YFLSL
Sbjct: 380 STLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSGTSMASPHVAGLLTYFLSL 439

Query: 478 QPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFWNI 537
           QP+ DSE+  +  GGITP+QLKK+LI+Y TK+ L D+PE T N L++NG GQDL DFW  
Sbjct: 440 QPDSDSEYFHA-AGGITPSQLKKKLIAYSTKNALGDLPEDTVNYLIYNGGGQDLDDFWVK 498

Query: 538 ---SKPADLESN------EVYKNLDLVGDVLYDQFTGIFKKMNLL 573
               K AD + N       +   L+   D LY++   IF+ +N++
Sbjct: 499 DLEEKVADAKDNTASEFESIIDALEEKTDGLYEEIREIFEGLNII 543

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/478 (66%), Positives = 366/478 (76%), Gaps = 17/478 (3%)

Query: 111 IAPLYS-QSLHPQ---NIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPY 166
           +APL S +  +P     IIP+RYII FKKDV PEE  FH++++ + Q QS+  L  +  +
Sbjct: 189 LAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAF 248

Query: 167 FNSVEGLDLQQP----IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNIN 222
           F S     L       I DSFNI+SL  GYIGYFT +++D IR NPLV FVE+DS V   
Sbjct: 249 FISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQEIVDLIRQNPLVDFVEKDSVVEAT 308

Query: 223 EFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRAS 282
           +FDTQN APWGLAR+SHRERLNLGSFNKYL+DD AG GVT+YVIDTGVNV H DFE RA 
Sbjct: 309 DFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAI 368

Query: 283 WGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVE 342
           WGKTIP NDEDLDGNGHGTHCAGTIASKHYG            LRSNGSG+MSDVLKGVE
Sbjct: 369 WGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVLKGVE 428

Query: 343 YATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDAC 402
           YA  +H    + KK GFKGSTANMSLGGGKSP+LDLAVNAAV+AGIHFAVAAGNENQDAC
Sbjct: 429 YAAKAHQKQAEEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDAC 488

Query: 403 NTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSM 462
           NTSPASA  AITVGASTLSDDRAYFSN+GKCVDVFAPGLNILSTYIGSD+ATATLSGTSM
Sbjct: 489 NTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDEATATLSGTSM 548

Query: 463 ASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVL 522
           ASPHVAGLL+YFLSLQP  DSEF    +  +TP QLKK+LI Y TKDIL DIP+ TPN L
Sbjct: 549 ASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKKKLIHYSTKDILFDIPDDTPNAL 608

Query: 523 VFNGAGQDLSDFWNISKPADLESNEVYK---NLD-LVG---DVLYDQFTGIFKKMNLL 573
           ++NG GQDLS FWN +K +   S+  +K   NLD  +G   D++++Q   +  K+N++
Sbjct: 609 IYNGGGQDLSAFWNDTKKS--HSSSGFKQELNLDEFIGSKTDLIFEQVRDVLDKLNII 664

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/475 (65%), Positives = 360/475 (75%), Gaps = 12/475 (2%)

Query: 111 IAPLYSQS-LHPQ---NIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPY 166
           +APL S +   P     IIP+RYII FKK V  E  DFH++S+++ Q QS+  L  +  +
Sbjct: 134 LAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAF 193

Query: 167 FNSVEGLDLQQP----IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNIN 222
           F S     L       I DSFNI+++  GYIGYFT ++ID IR NPLV FVE+DS V   
Sbjct: 194 FISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDFVERDSVVEAT 253

Query: 223 EFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRAS 282
           +FDTQN APWGLARISHRERLNLGSFNKYL+DD AG GVT+YVIDTGVNV H DFE RA 
Sbjct: 254 DFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNVNHKDFEKRAI 313

Query: 283 WGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVE 342
           WGKTIP NDEDLDGNGHGTHCAGTIASKHYG            LRSNGSG+MSDV+KGVE
Sbjct: 314 WGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVE 373

Query: 343 YATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDAC 402
           YA  +H    + KK GFKGSTANMSLGGGKSP+LDLAVNAAV+AGIHFAVAAGNENQDAC
Sbjct: 374 YAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAVAAGNENQDAC 433

Query: 403 NTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSM 462
           NTSPASA  AITVGASTLSDDRAYFSNWGKCVD+FAPGLNILSTYIGSDDATATLSGTSM
Sbjct: 434 NTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDDATATLSGTSM 493

Query: 463 ASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVL 522
           ASPHVAGLL+YFLSLQP  DSEF    +  +TP QLK +LI Y TKDIL D+PE TPN L
Sbjct: 494 ASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILFDVPEDTPNAL 553

Query: 523 VFNGAGQDLSDFWNISKPADLESNEVYKNLD-LVG---DVLYDQFTGIFKKMNLL 573
           ++NG GQDLS FWN +K +     +   N+D  +G   D++++Q   +  K+N++
Sbjct: 554 IYNGGGQDLSAFWNDTKKSHSSRFKQELNMDEFIGSKTDLIFEQVRDVLDKLNII 608

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/416 (71%), Positives = 345/416 (82%), Gaps = 5/416 (1%)

Query: 124 IIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNS--VEGLDLQQP-II 180
           IIP+RYI+ FKK + PEE+DFH++ IN++Q +S A+LP D  +F++  +E   + Q  I+
Sbjct: 98  IIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAIEDESINQGGIL 157

Query: 181 DSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISHR 240
            +FNI++LL GY+GYFTD+V++ IR+NPLV++VE+DS V   EFD QN APWGLARISHR
Sbjct: 158 TTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEFDNQNNAPWGLARISHR 217

Query: 241 ERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNGHG 300
           ERLNLGSFNKYL+DD AG+GVT YVIDTG+N EHNDF  RA WGKTIP ND+D+DGNGHG
Sbjct: 218 ERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWGKTIPLNDKDIDGNGHG 277

Query: 301 THCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFK 360
           THCAGTIAS HYG            LRSNGSGSMSDV+KGVE+A  SH+   K KK GFK
Sbjct: 278 THCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFAAESHIKAAKEKKKGFK 337

Query: 361 GSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTL 420
           GSTANMSLGGGKSP+LDLAVNAAV AGIHFAVAAGNENQDACNTSPASA+ AITVGASTL
Sbjct: 338 GSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNTSPASAERAITVGASTL 397

Query: 421 SDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQPE 480
           SDDRAYFSNWGKCVD+FAPGLNILSTYIG DDATATLSGTSMASPHVAGLL+YFLSLQP 
Sbjct: 398 SDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMASPHVAGLLTYFLSLQPG 457

Query: 481 QDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFWN 536
            DSEF    +  +TPAQ+KK+LI+Y +KD+L D+PE TPN L+FNGAG +L D WN
Sbjct: 458 SDSEFFDPTE--LTPAQMKKKLINYSSKDVLFDLPEGTPNKLIFNGAGGNLDDLWN 511

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/490 (62%), Positives = 372/490 (75%), Gaps = 26/490 (5%)

Query: 108 SPAIAPLYSQSLHPQ-----NIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPH 162
           +P I P +   +H Q      I+P++YII FK  +  +EI +H++ I+E+QQQS ++LP 
Sbjct: 217 APLITPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPP 276

Query: 163 DHPYFNSVEGLDLQQ----PIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDST 218
            H +F+S    + +      II SFNIN++L GY GYFT +VID IRLNPLV++VE+DS 
Sbjct: 277 HHHFFHSTSEEEEESFRNGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVERDSI 336

Query: 219 VNINEFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFE 278
           V   EF+TQN APWGL+RISHRERLNLGSFNKYL+DD AG+GVT +VIDTG+NV H DF 
Sbjct: 337 VQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHVDFG 396

Query: 279 GRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVL 338
            RA WGKTIP+ND+D+DGNGHGTHCAGTIAS HYG            LRSNGSGSMSDV+
Sbjct: 397 KRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVI 456

Query: 339 KGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNEN 398
           KGVE+A  +HL + KNKK  +KGSTANMSLGGGKSP+LDLAVNAAV+AGIHF+VAAGNEN
Sbjct: 457 KGVEFAAETHLNNEKNKKD-YKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAGNEN 515

Query: 399 QDACNTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DDATATL 457
           QDACN+SPASA+ AITVGASTLSDDRAYFSNWG+CVDVFAPGLNILSTY+G  +D TATL
Sbjct: 516 QDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNTATL 575

Query: 458 SGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGG-ITPAQLKKRLISYGTKDILLDIPE 516
           SGTSMASPHVAGLL+YFLSLQP+  S F  S+  G ITP QLKK+LI+Y T DIL D+P+
Sbjct: 576 SGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYDLPD 635

Query: 517 LTPNVLVFNGAGQDLSDFWN-------ISKPADLESNEVYKNL----DLVG--DVLYDQF 563
            TPN L++NGAG D+SD WN         +PA  E    ++NL     + G  D+ +DQ 
Sbjct: 636 GTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAH-EDKINFENLVDSDSMSGKTDLFFDQI 694

Query: 564 TGIFKKMNLL 573
             +F+KMN++
Sbjct: 695 RNVFEKMNII 704

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/592 (53%), Positives = 387/592 (65%), Gaps = 50/592 (8%)

Query: 1   MKLEKTSLVSLATISVASSFLIPADERMLR--DKLVPQHGKAGADAEHAKHKGGQHSVVK 58
           MK E T L   A  +VA++ +IP   R  +  DK V     A +D +  +H         
Sbjct: 1   MKFENTLLTITALSTVATALVIPEVNRENKHGDKSVAIKDHASSDLDKPQH--------- 51

Query: 59  HNSAKHHKQSRKQMRVHKHXXXXXXXXXXXXXXXXXXXXXXXXXXXNYESPAIAPLYSQS 118
           H + K   +SR +    K                               S  +APL S  
Sbjct: 52  HANGKARSKSRGRCADSKKFDKLRPVDDA--------------------SAILAPL-STV 90

Query: 119 LHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGL----- 173
               N IP+RYII FKKD + +E+ FHQ+ ++    +++  L  + P+F +  G      
Sbjct: 91  NDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSGEHSEFG 150

Query: 174 ----DLQQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNG 229
                L+  I DSF+I   L GY+GYFT +VIDFIR +PLV+FVE+DS V  N F+TQN 
Sbjct: 151 VKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDSMVFSNSFNTQNS 210

Query: 230 APWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPN 289
           APWGLARISHRE+LNLGSFNKYL+DD AG+GVTAYV+DTGVNV H DF+GRA WGKTIP 
Sbjct: 211 APWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDFDGRAVWGKTIPK 270

Query: 290 NDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHL 349
           +D D+DGNGHGTHCAGTI S HYG            LRSNGSG+MSDV+KGVEY   +H 
Sbjct: 271 DDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDVVKGVEYVAEAHK 330

Query: 350 ADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASA 409
             V+ +K GFKGSTANMSLGGGKSP+LDLAVNAAVKAG+HFAVAAGNENQDACNTSPA+A
Sbjct: 331 KAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNENQDACNTSPAAA 390

Query: 410 KYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAG 469
           + AITVGASTLSD+RAYFSNWGKCVD+F PGLNILSTYIGSD ATATLSGTSMA+PHV G
Sbjct: 391 ENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATLSGTSMATPHVVG 450

Query: 470 LLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQ 529
           LL+YFLSLQP+ DSE+  +  GGITP+QLKK+LI + TK++L D+PE T N L++NG GQ
Sbjct: 451 LLTYFLSLQPDADSEYFHA-AGGITPSQLKKKLIDFSTKNVLSDLPEDTVNYLIYNGGGQ 509

Query: 530 DLSDFWNI--------SKPADLESNEVYKNLDLVGDVLYDQFTGIFKKMNLL 573
           DL D W          S   +     +  +LD   D ++D    +  + N++
Sbjct: 510 DLDDLWGKDYSIGKEPSANPEFSLESLINSLDSKTDAIFDDVRQLLDQFNII 561

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/478 (60%), Positives = 359/478 (75%), Gaps = 20/478 (4%)

Query: 107 ESPAIAPLYSQ--SLHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDH 164
           E    APL+S   + +   +IP++YII FKKDV+ +++  H+  I   Q Q  +    D 
Sbjct: 212 EKVKYAPLHSMENTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYAS--VSDE 269

Query: 165 PYFNSVEGLDLQQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEF 224
              + + G++      ++FN+ +L  GYIG+F + ++ FIRL+P+V FVEQDS V+ NE 
Sbjct: 270 TSSSILGGIE------EAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVEQDSIVHANEV 323

Query: 225 DTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWG 284
           DTQN APWGLARISHR+ LNLGS+NKYL+DD AGEGVTAYVIDTG+N++H +F GRA WG
Sbjct: 324 DTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKHKEFGGRAVWG 383

Query: 285 KTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYA 344
           KTIP ND+D+DGNGHGTHCAGTIASK+YG            LRS+GSG+MSDVLKGVEYA
Sbjct: 384 KTIPENDQDVDGNGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTMSDVLKGVEYA 443

Query: 345 TASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNT 404
             SH   ++ KK GFKGSTANMSLGGGKS SLDLAV+AAVK+GIHFAVAAGNENQDACN+
Sbjct: 444 AFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAAGNENQDACNS 503

Query: 405 SPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMAS 464
           SPA+++ AITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSD+ATATLSGTSMAS
Sbjct: 504 SPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEATATLSGTSMAS 563

Query: 465 PHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVF 524
           PHVAGLLSYFLS+QP+ DSEF +S    I+PAQLKK+LI+Y TK++  D+PE TPN+LV+
Sbjct: 564 PHVAGLLSYFLSMQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDLPEKTPNLLVY 623

Query: 525 NGAGQDLSDFWNISKPADLESNEVYKNLDL---------VGDVLYDQFTGIFKKMNLL 573
           N AG ++SDFW     +  E NE  K  +L         + D   +    +F++M+L 
Sbjct: 624 N-AGHNISDFWKPKSESSAEPNERAKEFELEDLVDSAQWIADTWLNGIQQVFERMDLF 680

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/471 (61%), Positives = 354/471 (75%), Gaps = 24/471 (5%)

Query: 124 IIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSV--EGLDLQQPIID 181
           ++PH+YI+  KK V+PE +      ++     +I  LP +H +FN V  EGL  +  I D
Sbjct: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLP-RGGIKD 59

Query: 182 SFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISHRE 241
            FNIN L QG IGYF + V+  +  + +V+FVE+DS V+ + FDTQN APWGLARISHR+
Sbjct: 60  LFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISHRD 119

Query: 242 RLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNGHGT 301
           RLNLG+FNKYL+D+  GEGVTAYVIDTG+NV+H +F+GRA WGKTIP ND D+DGNGHGT
Sbjct: 120 RLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGHGT 179

Query: 302 HCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFKG 361
           HCAGTIASKHYG            L+S+GSG+MSDV+KGVEYA  +HL + KN K  FKG
Sbjct: 180 HCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNNKK-FKG 238

Query: 362 STANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTLS 421
           STANMSLGGGKSP+LD+AVNAAV AGIHFAVAAGNENQDACNTSPASA+ AITVGASTLS
Sbjct: 239 STANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLS 298

Query: 422 DDRAYFSNWGKCVDVFAPGLNILSTYIG-SDDATATLSGTSMASPHVAGLLSYFLSLQPE 480
           DDRAYFSNWGKCVD+FAPGLNILSTYIG ++  TA+LSGTSMASPHVAGLL+YFLSLQP+
Sbjct: 299 DDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPD 358

Query: 481 QDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPEL-TPNVLVFNGAGQDLSDFWNISK 539
            DSEF  + K G+TPAQLKK+LI+Y TK++L D+P+  +PN+L++NGAG DL  FWN S 
Sbjct: 359 SDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWN-ST 417

Query: 540 PADLESNE-------VYKNLD----LVG------DVLYDQFTGIFKKMNLL 573
            AD +S E           LD    +VG      D L+ Q   +  KMN++
Sbjct: 418 SADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/464 (61%), Positives = 344/464 (74%), Gaps = 17/464 (3%)

Query: 124 IIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLD--LQQPI-- 179
           ++ +RYII FKK V P+EI FH++ I ++  Q ++QLP +H +F  +  LD     P+  
Sbjct: 88  VLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIR-LDGVYDSPLGG 146

Query: 180 ID-SFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARIS 238
           ID +F+IN +L GY GYF   V+D IR++PL++ VEQDS V   + DT+NGAPWGLARIS
Sbjct: 147 IDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVVYTQKADTENGAPWGLARIS 206

Query: 239 HRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNG 298
           HRERLNLGS+NKYL+D++ G GVT+YVIDTGVNV HN F GRA WGKTIP  D D DGNG
Sbjct: 207 HRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGGRAKWGKTIPAGDLDEDGNG 266

Query: 299 HGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSG 358
           HGTHCAGTI S  YG            LRSNGSGSMSDVLKGVE+A   H   VK KK G
Sbjct: 267 HGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLKGVEWAAQDHQNAVKQKKPG 326

Query: 359 FKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGAS 418
           FKGSTANMSLGGGKSPSLD AVNAAV AG++FAVAAGNE+QDACNTSPASA   ITVGAS
Sbjct: 327 FKGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQDACNTSPASASGPITVGAS 386

Query: 419 TLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQ 478
           TLSDDRAYFSN+GKCVDVFAPGLNILSTYIGSD +TATLSGTSMASPHVAGLL+YFLSLQ
Sbjct: 387 TLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSGTSMASPHVAGLLAYFLSLQ 446

Query: 479 PEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFW--- 535
           P  DSEF       I+P QLKK+L+++ TKD+L DIP  TPN+L++NG G DLS FW   
Sbjct: 447 PGSDSEFDAGSS--ISPDQLKKKLLAFSTKDVLSDIPSGTPNLLIYNGGGGDLSGFWGSK 504

Query: 536 ------NISKPADLESNEVYKNLDLVGDVLYDQFTGIFKKMNLL 573
                   ++  DLE +++   L    D ++ Q  G+  +++++
Sbjct: 505 EVAQELEFNEKVDLELHDLVDELGSKTDAVFGQIRGLMDRLDII 548

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/438 (63%), Positives = 340/438 (77%), Gaps = 19/438 (4%)

Query: 110 AIAPLYSQSLHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNS 169
           ++AP+++     +NIIPHRYII FK  V+ E+I FH++ I  L  Q  +   +D   F  
Sbjct: 45  SLAPVHNAD--AENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSND---FTE 99

Query: 170 VEGLDLQQP---------IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVN 220
               D+  P         I+  F+I+SLL GYI Y +D+++ FIRLNPL+ F+E D+ V+
Sbjct: 100 YLQTDINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMVH 159

Query: 221 INEFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGR 280
             +F+TQN APWGLARISHRE LNL +FNKYL+DD AG+ V AYVIDTGV+V H +F  R
Sbjct: 160 TTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHSR 219

Query: 281 ASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKG 340
           A WGKTIP ND+D+DGNGHGTH AGTI S+HYG            LRSNGSGSMSDV+KG
Sbjct: 220 AHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVKG 279

Query: 341 VEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQD 400
           VE+A +SHL  +KN+K+  KGS ANMSLGGGKSP+LDLAVNAAVKAGIHFAVAAGNENQ+
Sbjct: 280 VEFAVSSHLERMKNEKN-LKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQN 338

Query: 401 ACNTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DDATATLSG 459
           ACN+SPASA+ A+TVGAST+SD+RAYFSNWG+CVD+FAPGLNILSTYIG+ DD TATLSG
Sbjct: 339 ACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLSG 398

Query: 460 TSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTP 519
           TSMASPHVAGLL+Y+LSLQPE+ SEF+T     I+ +QLKK+LI Y TKD+L D+PE TP
Sbjct: 399 TSMASPHVAGLLAYYLSLQPEKSSEFSTR---AISTSQLKKKLIEYATKDVLEDLPEGTP 455

Query: 520 NVLVFNGAGQDLSDFWNI 537
           NVL++NG GQDLSDFWN+
Sbjct: 456 NVLIYNGGGQDLSDFWNL 473

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/473 (58%), Positives = 339/473 (71%), Gaps = 26/473 (5%)

Query: 125 IPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLD---------L 175
           IPH+YI+ F++ V+ EE  FH + +     +S+A+L   H +F S  G +          
Sbjct: 71  IPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENNEFGIAATRA 130

Query: 176 QQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLA 235
           +  I   F +   L+GY+GYFT+D++  +R NP V FVE+DS V  ++F TQNGAPWGLA
Sbjct: 131 EGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTTQNGAPWGLA 190

Query: 236 RISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLD 295
           R+SHRE+LN GSFNKYL+DD +GEGVT+YVIDTG+N++H DFE RA WGKTIPNND D D
Sbjct: 191 RVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKTIPNNDADYD 250

Query: 296 GNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNK 355
           GNGHGTHCAGTIASK YG            LRSNG+GSMSDVL+GVEYA  +H    +  
Sbjct: 251 GNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVKAHRKAAEKA 310

Query: 356 KSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITV 415
             GFKGSTANMSLGGG+S +LDLAV+AAV AGIHFAVAAGNENQDACNTSPA+++ AITV
Sbjct: 311 DKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSPAASQKAITV 370

Query: 416 GASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFL 475
           GASTL+DDRAYFSNWG+CVD+FAPG+NILSTYIGSD A ATLSGTSMASPHVAGLL+YFL
Sbjct: 371 GASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPHVAGLLTYFL 430

Query: 476 SLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFW 535
           SLQP+ DSEF    K  I+P  LKK++I +GTKD L  +P  T NVL++NG G DLSDFW
Sbjct: 431 SLQPDGDSEF--RNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNGGGADLSDFW 488

Query: 536 -----NISKP----ADLES------NEVYKNLDLVGDVLYDQFTGIFKKMNLL 573
                 +S P    AD E       + +   L+   D ++  F  I  +MN++
Sbjct: 489 GNKPKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRMNII 541

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/589 (51%), Positives = 382/589 (64%), Gaps = 74/589 (12%)

Query: 1   MKLEKTSLVSLATISVASSFLIPA--DERML-------RDKLVPQHGKAGADAEHAKHKG 51
           MK+ +  L ++A   VA + ++P   DER +       R   V +HG+ G       H G
Sbjct: 1   MKITQPVLWAVALNRVAEALVLPEIRDERGVSQGEHGGRRHDVEEHGRRGR-----PHHG 55

Query: 52  GQHSVVKHNSAKHHKQSRKQMRVHKHXXXXXXXXXXXXXXXXXXXXXXXXXXXNYESPAI 111
            +H   +H   KH K++                                     ++   +
Sbjct: 56  PKHEKDEHRPCKHGKEA-------------------------------------HDEEEL 78

Query: 112 APLYS--QSLHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNS 169
           APLY+   +L   +   ++YII FK+ V  E+I  H+Q    L QQ + +        + 
Sbjct: 79  APLYTPGSALSASSSRSNKYIILFKEGVTAEQISAHKQ----LLQQVLLET-------SD 127

Query: 170 VEGLDLQQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNG 229
           V    +   ++DSF++  +L GY+   +  V++ +R +P VQ VEQDS V+ NEFDTQN 
Sbjct: 128 VSAQGIVADVLDSFDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNN 187

Query: 230 APWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPN 289
           APWGLARISHR+ L+LGSFNKYL+DD AGEGV +Y+IDTG+NV+H +FEGRA WGKTIP+
Sbjct: 188 APWGLARISHRDPLSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPD 247

Query: 290 NDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHL 349
           ND D DGNGHGTHCAGTIASKHYG            LRSNGSGSMSDV+ GVE+A   H 
Sbjct: 248 NDFDEDGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHA 307

Query: 350 ADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASA 409
           +  K+    FKGSTANMSLGGGKSPSLD  V+AAVK G+HF+VAAGNENQDACNTSPA++
Sbjct: 308 SKAKSNDKKFKGSTANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAAS 367

Query: 410 KYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAG 469
           + AITVGASTLSDDRAYFSNWG CVD+FAPGLNILSTY GSDDATATLSGTSMASPHVAG
Sbjct: 368 ERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAG 427

Query: 470 LLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQ 529
           LL+YFLSLQPE+ S+F TS +  ITP QLKK+L+ Y TK +L D+PE TPN L++NG G 
Sbjct: 428 LLTYFLSLQPEKSSQFGTSAQ--ITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGA 485

Query: 530 DLSDFWNIS-----KPADLESNEVYKNLDLVGDVLYDQFTGIFKKMNLL 573
           DLSDFW        KP  L ++E Y N+    D +++Q   +F K+N+ 
Sbjct: 486 DLSDFWGDKGKKSHKP--LFAHE-YDNVWASSDAMFEQVRAMFGKLNIF 531

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/456 (59%), Positives = 333/456 (73%), Gaps = 18/456 (3%)

Query: 124 IIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYF-----NSVEGLDLQQP 178
           +IP+ YI+ F + V   EI  H +++++LQ QS+  LP+DH +F     + V    L   
Sbjct: 34  VIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGLLGG 93

Query: 179 IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARIS 238
           + D F I + L GY G FTD+V++F+RL+PLV+F+E+DS V+  E  TQ  APWGLARIS
Sbjct: 94  VRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLARIS 153

Query: 239 HRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNG 298
           HR RLNL +FNKYL+DD  G+GV AYVIDTG+N+ + DF GRA WGKTIP  + ++DGNG
Sbjct: 154 HRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDGNG 213

Query: 299 HGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSG 358
           HGTH AGTIAS HYG            LRSNG+GSMSDVLKGVEY   +H  DV    +G
Sbjct: 214 HGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAHQRDVGT--AG 271

Query: 359 FKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGAS 418
           FKGS ANMSLGGGKS SLDLAVNAAV AG+HFAVAAGNENQDACNTSPA+A+ AITVGAS
Sbjct: 272 FKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERAITVGAS 331

Query: 419 TLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQ 478
           TLSD RAYFSNWG+CV +FAPGLNILSTYIGS DATATLSGTSMASPH+AGL++YFLSLQ
Sbjct: 332 TLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLSLQ 391

Query: 479 PEQDSEF-ATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFWNI 537
           P   S+F +  +   ITP QLKK+++++GTK+ L D+P  TPNV+ +NGAG+ L DFWN 
Sbjct: 392 PAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFWN- 450

Query: 538 SKPADLESNEVYKNLDLVGDVLYDQFTGIFKKMNLL 573
                  +N+  KN   +  V+ +Q   I  KMN+ 
Sbjct: 451 -------ANDYVKNYQSL--VITEQLQFILNKMNIF 477

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/474 (57%), Positives = 332/474 (70%), Gaps = 32/474 (6%)

Query: 125 IPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGL--------DLQ 176
           IPHRYI+ FK  V   ++  HQ  +     ++IAQL   H +F++ EG+         ++
Sbjct: 109 IPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISARSVE 168

Query: 177 QPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLAR 236
             I + F I   L+GY GYFTD ++D IR + LV+ +EQDS V+ ++F+TQ GAPWGLAR
Sbjct: 169 GGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWGLAR 228

Query: 237 ISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDG 296
           +SHRERLNLGSFNKYL+DD AG+GVTAYVIDTG+N++H +FEGRA WGKTIP+ND D DG
Sbjct: 229 VSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDADYDG 288

Query: 297 NGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKK 356
           NGHGTHCAGTIASK YG            LR+NG+G+MSDVL+GVEY  A H      K 
Sbjct: 289 NGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEH-----RKA 343

Query: 357 SG---FKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAI 413
           SG   FKGSTANMSLGGGKS +L+LAV+AAV AGIHFAVAAGNENQDACNTSPAS+K  I
Sbjct: 344 SGDPNFKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403

Query: 414 TVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSY 473
           TV ASTLSDDRAYFSNWG CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL+Y
Sbjct: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463

Query: 474 FLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSD 533
           FLSLQP+  SE+ T     I+P  LKK++++YG+K++L ++P  T N L+FNG G  L  
Sbjct: 464 FLSLQPDSGSEYYTGSS--ISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521

Query: 534 FWNI--------------SKPADLESNEVYKNLDLVGDVLYDQFTGIFKKMNLL 573
           FWN                K  D ES  +   L      L+ +      +++L+
Sbjct: 522 FWNSKCDGCEQEKVSSSHGKADDFESESLMDCLHSTSHSLFGEIRNFLDRLDLI 575

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  491 bits (1263), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 265/465 (56%), Positives = 335/465 (72%), Gaps = 19/465 (4%)

Query: 106 YESPAIAPLYSQSLHPQNIIP---HRYIITFKKDVAPEEIDFHQQSINEL-QQQSIAQLP 161
           + SPA   L   +LH   +      RYII FKK V  E++D H + ++ L ++ S  Q P
Sbjct: 110 HASPASRGLELAALHDNGVGTADHDRYIIVFKKGVFKEQVDQHLKMMSALFRRLSEEQRP 169

Query: 162 HDHPYFNSV-EGLDLQQPIIDSFNINSLLQGYIGYF-TDDVIDFIRLNPLVQFVEQDSTV 219
              P  +++ +G D    ++D+F +     GYI    +  ++DFIRLNPLV +VE+DS V
Sbjct: 170 AAAPGASALRDGFDR---VMDTFEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVV 226

Query: 220 NINEFDTQNGAPWGLARISHRERLNLGSFNKYLF-DDKAGEGVTAYVIDTGVNVEHNDFE 278
           +  + +TQN APWGLARISHRE LNLG+FNKYL+  + AG+GVTAYV+DTG++V H +F 
Sbjct: 227 HSLD-ETQNNAPWGLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFG 285

Query: 279 GRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVL 338
            RA WGKTIP ND D+DGNGHGTHCAGTI S+HYG            LRS+GSG+MSDVL
Sbjct: 286 ERAKWGKTIPINDYDIDGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVL 345

Query: 339 KGVEYATASHLADV----KNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAA 394
           KGVE+    H   +    K+K S +KG+TANMSLGGGKSP+LD AVNAAVKAG+HFAVAA
Sbjct: 346 KGVEWVALEHTKHLEESRKDKNSNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAA 405

Query: 395 GNENQDACNTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDAT 454
           GNENQDACN+SPA+A+ AITVGASTLSDDRAYFSN+GKCVD+FAPGLNILSTYIG++DAT
Sbjct: 406 GNENQDACNSSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDAT 465

Query: 455 ATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDI 514
           ATLSGTSMASPHVAGLL+Y LSLQP++ SEF       +TP Q+KK++I Y TK+ L D+
Sbjct: 466 ATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNS-ELTPLQMKKKIIDYATKNALADL 524

Query: 515 PELTPNVLVFNGAGQDLSDFWNISKPADLESNEVYKNLDLVGDVL 559
           P  TPN L++NG G + +DFW  +  A  +S++V  N   +G  L
Sbjct: 525 PADTPNKLIYNG-GFNSTDFW--ASAAAPQSHKVKTNRYSLGSFL 566

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  482 bits (1241), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 227/415 (54%), Positives = 298/415 (71%), Gaps = 7/415 (1%)

Query: 125 IPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLDLQQP----II 180
           +P+RYII F +D+    I+ H Q I + Q+ S++++  D  +  +V       P    I 
Sbjct: 69  LPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFGGID 128

Query: 181 DSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISHR 240
            SF+IN L +GY GYFTD+VI+ +  +PLV+F+E +STV I+    Q  APWGL RISHR
Sbjct: 129 ISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRISHR 188

Query: 241 ERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNGHG 300
           ER   G   +YL++D AG GVT+YV+DTG++ EH DFEGRA WG  IP NDE  D NGHG
Sbjct: 189 ERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLNGHG 248

Query: 301 THCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFK 360
           THCAG I S+H+G            LRSNG G++SDV+KG+EY   +H+A  K + S FK
Sbjct: 249 THCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKRGSKFK 308

Query: 361 GSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTL 420
           GSTAN+SLG  KSP++++AVNAAV  G+HFA+AAGNE++DAC +SPA A+ +ITVGAST 
Sbjct: 309 GSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 368

Query: 421 SDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQPE 480
           SDDRA+FSNWG CVDVFAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+LSY LSLQP 
Sbjct: 369 SDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSLQPA 428

Query: 481 QDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFW 535
           QDSEF       ++P QLK++++ + T+ +L D+ E TPN LV+NG G+ L +FW
Sbjct: 429 QDSEFFYDT---VSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  475 bits (1223), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 225/413 (54%), Positives = 303/413 (73%), Gaps = 5/413 (1%)

Query: 125 IPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEG-LDLQQPIIDSF 183
           +P+RYII F +D +   I+ H++ I E+Q +S+++L  D  +F S     DLQ   IDSF
Sbjct: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSAPSDLQFGGIDSF 126

Query: 184 -NINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISHRER 242
            +IN L +GY GYFT++VI  +  +P+++F+EQ+STV +     Q  APWGL RISHRE+
Sbjct: 127 FDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHREK 186

Query: 243 LNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNGHGTH 302
              G   +YL++D AG GVT+YV+DTG+++ H DFEGRA WG  IP+NDE  D NGHGTH
Sbjct: 187 AKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHGTH 246

Query: 303 CAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFKGS 362
           CAG I S+H+G            LRSNG G++SDV+KG+EY    H+   K     FKGS
Sbjct: 247 CAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKKGGPKFKGS 306

Query: 363 TANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTLSD 422
           TAN+SLG  KSP++++AVNAAV++G+HFA+AAGNE++DAC +SPA A+ +ITVGAST SD
Sbjct: 307 TANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSD 366

Query: 423 DRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQPEQD 482
           DRA+FS+WG CVDVFAPG+NILSTYIGS +A+ +LSGTSMA+PHVAG+LSYFLSLQP  D
Sbjct: 367 DRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPSSD 426

Query: 483 SEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFW 535
           SEF  S    ++P QLK+++I++ T+ +L D+ E TPN L++NG G+ L +FW
Sbjct: 427 SEFFDST---VSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  472 bits (1214), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 222/420 (52%), Positives = 300/420 (71%), Gaps = 7/420 (1%)

Query: 120 HPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVE---GLDLQ 176
           H   +IP+RYI+ F +D++ + I+ H++ + E    S+++L  D  +   V      DLQ
Sbjct: 62  HKTELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQ 121

Query: 177 QPIIDS-FNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLA 235
              IDS F+IN L +GY GYFTD++++ +  +PL++F+EQ+STV ++    Q  APWGL 
Sbjct: 122 LGGIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLH 181

Query: 236 RISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLD 295
           RISHRE+   G   +YL++D AG GVT+YV+DTG++ EH DFEGRA WG  IP NDE  D
Sbjct: 182 RISHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASD 241

Query: 296 GNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNK 355
            NGHGTHCAG I SKHYG            LRSNG G++SDV+KG+EY    H+   + K
Sbjct: 242 LNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKK 301

Query: 356 KSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITV 415
              FKGSTAN+SLG  KS ++++AV+AAV +G+HFA+AAGNEN+DAC +SPA A+ +ITV
Sbjct: 302 SKEFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITV 361

Query: 416 GASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFL 475
           GAST SDDRA+FSNWG CVDVFAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+LSYFL
Sbjct: 362 GASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFL 421

Query: 476 SLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFW 535
           SLQP  DSE+  +    ++P +LK++++ + T  +L DI + TPN L++NG G+ L D W
Sbjct: 422 SLQPAPDSEYFDN---ALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  461 bits (1185), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 218/420 (51%), Positives = 295/420 (70%), Gaps = 7/420 (1%)

Query: 120 HPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLDLQQP- 178
           H    +P+RY+I F +D++ ++I  H Q + +    S+ +L  +  ++  +      +  
Sbjct: 62  HKTEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSKSQ 121

Query: 179 ---IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLA 235
              I + F+IN L +GY GYFTD++I  I  +P+++FVEQ++TV I+    Q  APWGL 
Sbjct: 122 FGGIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGLH 181

Query: 236 RISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLD 295
           R+SHRE+   G   +YL++D AG+GVT+YV+DTG++ EH DFEGRA WG  IP NDE  D
Sbjct: 182 RVSHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASD 241

Query: 296 GNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNK 355
            NGHGTHCAG I SKH+G            LRSNG G++SDV+KG+EY T  H+   K K
Sbjct: 242 LNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKK 301

Query: 356 KSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITV 415
              FKGSTAN+SLG  KS ++++AVNAAV +G+HFA+AAGNE++DAC +SPA A+ +ITV
Sbjct: 302 NKEFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITV 361

Query: 416 GASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFL 475
           GAST SDDRA+FSNWG CVDVFAPG+NI+STYIGS +AT +LSGTSMASPHVAG+LSYFL
Sbjct: 362 GASTFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFL 421

Query: 476 SLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFW 535
           SLQP  DSEF        +P +LK++++ + T+ +L DI + TPN L++NG G+ L  FW
Sbjct: 422 SLQPAPDSEFFNDAP---SPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  424 bits (1090), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 225/429 (52%), Positives = 285/429 (66%), Gaps = 11/429 (2%)

Query: 112 APLYSQSLHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDH---PYFN 168
           + +Y  S     IIP+RYI+ FK  V  +EI  H  +I E+   SI     D      +N
Sbjct: 61  SKIYFDSAKNDMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSIFLQDSDFGKATQYN 120

Query: 169 --SVEGLDLQQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDT 226
             S  G+ LQ      F+I   + GYIGYFT+    FI  +PLV+ VE DS V IN +  
Sbjct: 121 DISTRGIGLQHE----FSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKM 176

Query: 227 QNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKT 286
           Q   PWGL RIS RE+L +     Y +DD+ G+    +VIDTG+ V+H DFEGRASWGKT
Sbjct: 177 QEHVPWGLGRISQREKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKT 236

Query: 287 IPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATA 346
           I  ND D D NGHGTHCAGTIASKHYG            LRS+GSGSMSDV++GVEY   
Sbjct: 237 IVENDNDYDLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEYTVE 296

Query: 347 SHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSP 406
           ++  D+K  KS  KG+  NMSLG  KS +L+ A++AA  AGI FAVAAGNE+ DACN+SP
Sbjct: 297 AY-NDLKKTKSNLKGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSP 355

Query: 407 ASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPH 466
           ASA   ITVG STLSDD A+FSN+G+CVD+FAPG+NI+STYIGS +AT +LSGTSM+SPH
Sbjct: 356 ASAWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPH 415

Query: 467 VAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNG 526
           VAG+L+Y+LSLQP+  S+F       I+P  LKK++++Y T   L  +P  T N+LV+NG
Sbjct: 416 VAGVLAYYLSLQPDHKSQF-YHEHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNG 474

Query: 527 AGQDLSDFW 535
            G++LS FW
Sbjct: 475 GGKNLSKFW 483

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  395 bits (1016), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 198/413 (47%), Positives = 270/413 (65%), Gaps = 17/413 (4%)

Query: 123 NIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLDLQQPIIDS 182
           +II  +YI+ FK      E + H + +    +           Y    +  D  +  ++ 
Sbjct: 58  DIIKDQYIVIFKNSAMMAEKELHFKQLKNFIKT----------YSYEWDEKDDHKSNLNI 107

Query: 183 FNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISHRER 242
           F I + L GYI     + +  +R +P+VQ +E DS V+  +   Q   PWGL+RIS R R
Sbjct: 108 FKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQRPR 167

Query: 243 LNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNGHGTH 302
           + +G    Y +DD     VTAYV+DTG+ + H  F GRA WGKTI  ND D D +GHGTH
Sbjct: 168 VRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGHGTH 227

Query: 303 CAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFKGS 362
            AG IAS  +G            LRSNG G MSDVLKG+E+    H    KNK    KGS
Sbjct: 228 VAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDH---SKNKNYS-KGS 283

Query: 363 TANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTLSD 422
             N+SLG  KSP+L LA++AA+   IHFAVAAGNEN DAC TSPA A+ AITVGAS  SD
Sbjct: 284 VVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASIFSD 343

Query: 423 DRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQPEQD 482
           +RA+FSNWG+CVDVFAPG+N++STYIGSD+AT +LSGTS A+P+ AGL++Y+LSLQP++D
Sbjct: 344 ERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQPDKD 403

Query: 483 SEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFW 535
           S + T   G +TP++LK++++++G+KD+L ++PE TPN++++NGAG++LS FW
Sbjct: 404 SGYFT---GEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFW 453

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  374 bits (960), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 196/421 (46%), Positives = 260/421 (61%), Gaps = 22/421 (5%)

Query: 120 HPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLDLQQPI 179
           H  + IP++YI+ FK D    + + H  ++N                   +   D Q  I
Sbjct: 48  HAASPIPNQYIVLFKSDTTDIQRETHLATLNSW-----------------LLNTDPQYTI 90

Query: 180 IDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISH 239
           + SF +   LQGY     + +I  +  +P++Q +EQDS V+      Q  +PWGLARIS 
Sbjct: 91  LHSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQ 150

Query: 240 RERLNLGSFNKYLFDDK-AGEGVTAYVIDTGVNVEHNDFEGRASWGKTI-PNNDEDLDGN 297
           RERL L     Y +DD  A      Y++DTG+N  HN+F+GRA WG    P      D N
Sbjct: 151 RERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDEN 210

Query: 298 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNK-K 356
           GHGTHCAG I S  YG            L + G G MS V++G+EY T  H  D+K + +
Sbjct: 211 GHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQ 270

Query: 357 SGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVG 416
           +GFKGS  N+SLG GKSP+L   + AAVK G+HFAVAAGNE+ DAC+TSPA + +A+TVG
Sbjct: 271 TGFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVG 330

Query: 417 ASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DDATATLSGTSMASPHVAGLLSYFL 475
           AS+ SDDR +FSNWG CVDVFAPG+NI+STYIG  ++ T +LSGTSM++P V GL++YFL
Sbjct: 331 ASSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFL 390

Query: 476 SLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQDLSDFW 535
           SLQP+  S+F T      TP QLK ++IS+ T+ +L +IPE TPN +V+NG G  L DFW
Sbjct: 391 SLQPDTKSQFYTGITSP-TPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFW 449

Query: 536 N 536
           N
Sbjct: 450 N 450

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  336 bits (862), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 199/451 (44%), Positives = 273/451 (60%), Gaps = 41/451 (9%)

Query: 109 PAIAPLYSQSLHPQ-NIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYF 167
           P I P +     PQ N IP +YI+ F+ D    +I   +Q ++ L ++   +   +  Y 
Sbjct: 50  PFIIPTHG----PQKNFIPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYS 105

Query: 168 ---------NSVEGLDLQQPIIDSFNINSLLQGYIGYFTDDVIDFI-RLNPLVQFVEQDS 217
                    N  +G+ ++ PI D              F +DV + I     +++ +E+DS
Sbjct: 106 KVLSRFQISNDTKGMIIRAPIDD--------------FLEDVKNNIFNYQKIIKIIERDS 151

Query: 218 TVNINEFDTQNGAPWGLARISHRERLNLGSFNKYLFDDK-AGEGVTAYVIDTGVNVEHND 276
            V++N+F TQ  + WGL+RIS R  L L     Y +DD  +G+GV  Y++DTG+N  H +
Sbjct: 152 YVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIE 211

Query: 277 FEGRASWGKTIPNNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMS 335
           FEGRASWG ++P  +  L D NGHGTHCAG I SK YG            L   G GSMS
Sbjct: 212 FEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMS 271

Query: 336 DVLKGVEYATASHLADVKNKK------SGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIH 389
           DV+ G+E+   SH     N        S FKGS  N+SLG  KSPSLD+A+ +A K GIH
Sbjct: 272 DVILGLEFVANSHTNKTNNISSSSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIH 331

Query: 390 FAVAAGNENQDACNTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG 449
             VAAGNE++DAC TSPA +   ITVGAS+ SDDRA+FSNWG CVDVFAPG+NI STYIG
Sbjct: 332 ITVAAGNEDEDACMTSPADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIG 391

Query: 450 -SDDATATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTK 508
            +++ T +LSG+SM+SP V+GL +Y+LSLQP+  S+F  S    +TP QLK+++I + T 
Sbjct: 392 PNNNETLSLSGSSMSSPFVSGLTAYYLSLQPDVSSQFHDSL---MTPDQLKRKIIDFSTN 448

Query: 509 DILLDIPELTPNVLVFNGAGQDLSDFWNISK 539
            +L ++P  T N LV+NG G+DLS FWN ++
Sbjct: 449 GMLKELPLDTANKLVYNGGGKDLSGFWNATR 479

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  318 bits (816), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 168/403 (41%), Positives = 240/403 (59%), Gaps = 36/403 (8%)

Query: 157 IAQLPHDHPYFNSV------EGLDLQQPIIDSFNINSLLQGYIGYF----------TDDV 200
           +A L  +H +F S       E L + +P++D   +   L    G F           D++
Sbjct: 24  LADLSGEHRFFMSGKSTILNEFLVMFKPMVDREEVEVGLSVLAGRFPLAQFEQFHIADEL 83

Query: 201 IDFIRLN------------PLVQFVEQDSTVNINEFDTQNGAPWGLARISHRERLNLGSF 248
           I F   N            P V+ VE +S V       Q   PWGL R+S R+R+ +G  
Sbjct: 84  IGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQRDRVRIGDE 143

Query: 249 NKYLFDDK-AGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNGHGTHCAGTI 307
             Y +D + + + V  Y++DTG+ V+H +FEGRA WGKTI  ND D D NGHGTHCAG +
Sbjct: 144 QVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNGHGTHCAGIV 203

Query: 308 ASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFKGSTANMS 367
               YG            L + G G MSDV++G+E+A   HL   +++    +GS  N+S
Sbjct: 204 GGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEHLTRNQDE---VRGSIINLS 260

Query: 368 LGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTLSDDRAYF 427
           LG G+SP+L   V AA+  G+HFAVAAGNE+ +AC +SPA+    +TVG ST SDDRA+F
Sbjct: 261 LGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGSTFSDDRAFF 320

Query: 428 SNWGKCVDVFAPGLNILSTYIG-SDDATATLSGTSMASPHVAGLLSYFLSLQPEQDSEFA 486
           SNWG C+DVFAPG+N+ S+Y+G + + T +LSGTS ++PHVAGL++Y LSL+P+  S+F 
Sbjct: 321 SNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLEPDTKSQFH 380

Query: 487 TSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVLVFNGAGQ 529
           T+      PAQLK++L+S  T+  L ++P+ T N+++FNG  Q
Sbjct: 381 TAWS---NPAQLKQKLVSLATEGKLFEVPDDTANLMIFNGVKQ 420

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  300 bits (768), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 161/440 (36%), Positives = 249/440 (56%), Gaps = 14/440 (3%)

Query: 105 NYESPAIAPLYSQSLHPQNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDH 164
           N ++P +APL        NI+P+RYI+ FK      EI  H Q++ +LQ +    L  + 
Sbjct: 49  NVKAPLVAPLGENDEIQNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLAPND 108

Query: 165 PYFNSVEGLDLQQP----IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVN 220
           P+F+     +        ++ +F+I S   GY+GYFTD+V++FIR   +V +VE DS + 
Sbjct: 109 PFFHHTRDKEFSTEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDSILT 168

Query: 221 INEFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGR 280
           I++ +T + + W LARISHR +L L +FN+Y FD   G+ + AY++DTGV   H  +  R
Sbjct: 169 IDDKETDSNSHWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYYIER 228

Query: 281 ASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKG 340
              G  I  N+++ D NGHGT  AG +  +  G            L   G G++S+++KG
Sbjct: 229 TIRGIVITPNEDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNIIKG 288

Query: 341 VEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQD 400
           + +    H   +  +K+G  G+    S+ G KS SL+ A +  V +GIH  V AG +  +
Sbjct: 289 LSFVNHHHPQRI--EKNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTKGIN 346

Query: 401 ACNTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATAT---- 456
           ACN+SPAS+   ITV   +++D+     NWG CVD++ PG  + +TY   +    T    
Sbjct: 347 ACNSSPASSSKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTNEIS 406

Query: 457 LSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPE 516
           ++G+S A+  VAGLL+YF SLQP       T     +TP +LK+RLI +GTK  L ++  
Sbjct: 407 VTGSSAAAAQVAGLLAYFASLQP----GLGTPDVIPLTPEELKERLIDFGTKGKLTNLER 462

Query: 517 LTPNVLVFNGAGQDLSDFWN 536
           ++PN++ FNGAG +L  F+N
Sbjct: 463 MSPNIIAFNGAGGNLDSFFN 482

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  194 bits (493), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 146/395 (36%), Positives = 197/395 (49%), Gaps = 67/395 (16%)

Query: 175 LQQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINE----------- 223
           L+  I  +F+I S  +G+    TDD+++ I+ NPLV  V  +  V+  E           
Sbjct: 54  LRDKIGKTFSIGSF-KGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDG 112

Query: 224 --FD-----------TQNGAPWGLARISHRERL---------NLGSFNKYLFDDKA-GEG 260
             FD            Q GAP  LAR+S R++L          L S  KY +D ++ G  
Sbjct: 113 GQFDNKMQKGKCSVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSL-KYFYDKRSQGAS 171

Query: 261 VTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXX 320
           V AY+ID+G+ +EH +F GRA  G  +       D NGHGTH AG + SK YG       
Sbjct: 172 VNAYIIDSGIYLEHEEFNGRAIPGIDLTGEGSG-DYNGHGTHVAGIVGSKSYGVAKKVKL 230

Query: 321 XXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAV 380
                L   G GS++ VL G+E+A   H  +   K        AN+SLG  ++  L+ A+
Sbjct: 231 IEIKVLNRLGQGSLAMVLGGIEFAV-KHCQETSKKGR----CVANLSLGSMRTAILNKAI 285

Query: 381 NAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTLSDDR----AYFSNWGKCVDV 436
            AA+ AG+   VAAGN N +AC  SPASA  AITVGA    DDR    A FSNWG+C+D+
Sbjct: 286 KAAIDAGLVVVVAAGNNNLNACWYSPASAPEAITVGAF---DDRIDAIAKFSNWGQCLDI 342

Query: 437 FAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPA 496
           FAPG+ I S  I  D    T SGTSMASP VAGL +  L                G++  
Sbjct: 343 FAPGVVIKSLSIFKDKEDVTYSGTSMASPTVAGLAALTLD--------------QGVSAE 388

Query: 497 QLKKRLISYGTKDIL----LDIPELTPNVLVFNGA 527
           ++K  ++  GT ++     L     TPN + FNG 
Sbjct: 389 EVKDYILEMGTDNVFHRRSLLFKPGTPNKICFNGV 423

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  191 bits (486), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 139/384 (36%), Positives = 186/384 (48%), Gaps = 59/384 (15%)

Query: 199 DVIDFIRLNPLV-------QFVEQDS------TVNINEFDTQNGAPWGLARISHRERLNL 245
           D++D IR +PLV       QFV  D         N      Q GAP  L+R+S R +L  
Sbjct: 73  DLVDRIRRSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLPY 132

Query: 246 ----------GSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLD 295
                     GSFN Y  +   G+G+ AY+IDTG+  EH +F GRA +G+ +       D
Sbjct: 133 DFEEEDDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFGEDLTGEGPG-D 191

Query: 296 GNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNK 355
           GNGHGTH AG + S  YG            L + G G+++ V+  +E+A  +H      +
Sbjct: 192 GNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAV-NHC-----R 245

Query: 356 KSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITV 415
            S  KG   N+SLG  ++  ++ AV AA +AGI   VAAGN N +AC  SPASA  AITV
Sbjct: 246 SSEGKGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAITV 305

Query: 416 GA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYF 474
           GA    +D  A FSNWG CVD+FAPG+ + S            SGTSMASP + GL +  
Sbjct: 306 GAFDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGLAAIL 365

Query: 475 LSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDIL----LDIPELTPNVLVFNGAGQD 530
           L                G+   ++K  ++   T D+     L     TPN + FNG    
Sbjct: 366 LD--------------EGVPYDKIKDYILKMATNDVFQRRTLVFKPGTPNRVAFNG---- 407

Query: 531 LSDFWNISKPADLESNEVYKNLDL 554
                 + K  D  SN VY  +DL
Sbjct: 408 ------VKKNDDKFSNAVYPVVDL 425

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  191 bits (484), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 139/391 (35%), Positives = 189/391 (48%), Gaps = 63/391 (16%)

Query: 197 TDDVIDFIRLNPLV-------QFVEQDSTVNINEF---------DTQNG----------- 229
           + DV++ IR NPLV       QF   D  + + E          D ++G           
Sbjct: 69  SQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGDNLDDEDGFNPFKVKVQGE 128

Query: 230 APWGLARISHRERLNLG---------SFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGR 280
           AP  LAR+S R  L            SFN Y +    G  + AY+IDTG+  EH DF GR
Sbjct: 129 APRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYKEHKDFCGR 188

Query: 281 ASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKG 340
           A +G+         D NGHGTH AG + S ++G            L + G G+++ V+  
Sbjct: 189 AIFGRDFTGEGPG-DRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQGNLTTVISA 247

Query: 341 VEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQD 400
           VE+A  +H      K SG KG  AN+SLG  ++  ++ A+ AA +AG+   VAAGN N +
Sbjct: 248 VEFAV-NHC-----KSSGKKGCVANLSLGAVRNSVINQAIKAAHEAGLIIVVAAGNSNIN 301

Query: 401 ACNTSPASAKYAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSG 459
           AC  SPASA  AITVGA    +D  A FSNWG CVD+FA G+ + S            SG
Sbjct: 302 ACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPPHKPIAFSG 361

Query: 460 TSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDIL----LDIP 515
           TSMASP V GL++  L                G+ P  +K +L+   T D+L    L   
Sbjct: 362 TSMASPSVTGLVAILLD--------------KGVEPENIKAKLVELATHDLLQRRTLFFK 407

Query: 516 ELTPNVLVFNGAGQDLSDFWNISKP-ADLES 545
             TPN + FNG  ++  ++ +   P  DLES
Sbjct: 408 PGTPNRIAFNGMEREDDEYDDAVYPIVDLES 438

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  189 bits (479), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 135/389 (34%), Positives = 190/389 (48%), Gaps = 47/389 (12%)

Query: 189 LQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNI------------NEFDTQNGAPWGLAR 236
            +G+   F  D ++ ++ NPLV  V  +S  N+              +  Q  AP  LAR
Sbjct: 61  FEGFTADFPKDFVEKLKKNPLVADVVPNSVFNVFDQKEQIAEEYSRRYKVQEDAPRHLAR 120

Query: 237 ISHRERLNLGS-------FNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPN 289
           +S R  L           FN Y      G+ V AY+IDTG+  +H D  GRA +G  +  
Sbjct: 121 LSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSVNAYIIDTGIYKQHKDLGGRAYFGADMVG 180

Query: 290 NDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHL 349
                D NGHGTH AG + S+ +G            L + G G+++ V+  +E+ + +H 
Sbjct: 181 EGPG-DYNGHGTHVAGIVGSRTFGVAKKVNLVEVKALNAKGQGNLTSVISSIEF-SVNHC 238

Query: 350 ADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASA 409
                KKSG     AN+SLG  ++  L+ AV AAV++G+   VAAGN N +AC  SPASA
Sbjct: 239 -----KKSGML-CVANLSLGSLRNTVLNQAVEAAVESGLVVVVAAGNSNVNACWNSPASA 292

Query: 410 KYAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVA 468
             AITVGA    +D  A FSNWG CVDVFA G+ ++S            SGTSMASP VA
Sbjct: 293 ISAITVGAFDDRTDTIAKFSNWGMCVDVFASGVKVMSLSNMPPFKPVAYSGTSMASPSVA 352

Query: 469 GLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDIL----LDIPELTPNVLVF 524
           GL +  L                GI P  +K+++I   T+++     L     TPN + F
Sbjct: 353 GLAAVLLD--------------SGIDPPDIKQKIIDLATENVFQKRTLVFKPGTPNRIAF 398

Query: 525 NGAGQDLSDFWNISKPADLESNEVYKNLD 553
           NG  ++   F     P  ++ NE+ K L+
Sbjct: 399 NGVRKEDDIFEEAVYPV-VDINELVKELE 426

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  187 bits (474), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 134/368 (36%), Positives = 176/368 (47%), Gaps = 63/368 (17%)

Query: 226 TQNGAPWGLARISHRERLNL---------GSFNKYLFDDKAGEGVTAYVIDTGVNVEHND 276
           TQ+ AP  LAR+S R +L             FN Y +    G  V AYV+D+GV ++H D
Sbjct: 159 TQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCD 218

Query: 277 FEGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSD 336
           FEGRA +G     +    D NGHGTH AG I SK YG            L S GSG++  
Sbjct: 219 FEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDT 278

Query: 337 VLKGVEYATA-----------------------SHLADVKNKKSGFKGSTANMSLGGGKS 373
           V+ G+E+ +                        SH  DV++K+        N+SLG  +S
Sbjct: 279 VMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKR-----CVINLSLGTFRS 333

Query: 374 PSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTLSDDR----AYFSN 429
             ++ A+   +K GI   VAAGN N +AC TSPAS    ITVGA    DDR    A FSN
Sbjct: 334 TIINEAIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSN 390

Query: 430 WGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSR 489
           WG CVD+FAPG+ + S            +GTSMA+P V GL++  L              
Sbjct: 391 WGNCVDIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLLD------------- 437

Query: 490 KGGITPAQLKKRLISYGTKDIL----LDIPELTPNVLVFNGAGQDLSDFWNISKPADLES 545
             GI P Q+KKRL    T +I     L     TPN + FNG  +D  D+ + S P ++  
Sbjct: 438 -SGIKPTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRDDDDYHHYSYP-NITI 495

Query: 546 NEVYKNLD 553
             + K LD
Sbjct: 496 EHILKELD 503

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  186 bits (473), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 130/330 (39%), Positives = 170/330 (51%), Gaps = 44/330 (13%)

Query: 225 DTQNGAPWGLARISHRERL--------NLGSFNKYLFDDK-AGEGVTAYVIDTGVNVEHN 275
           + Q GAP  L RIS R +L            F  Y ++D+  G  + AY++DTG+  EH 
Sbjct: 152 NVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHP 211

Query: 276 DFEGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMS 335
           DFE R   G  +       D NGHGTH AG + SK +G            L   GSG+++
Sbjct: 212 DFENRVIVGADMTGEGPG-DSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLT 270

Query: 336 DVLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAG 395
            VL G+++A   H   ++  +   K   ANMSLG  ++  ++ A++ A KAG+   VAAG
Sbjct: 271 TVLSGIQFAV-DHCRLMRETQG--KQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAG 327

Query: 396 NENQDACNTSPASAKYAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNI--LSTYIG 449
           N N  AC TSPASAK AITVGA    DDR    AYFSNWG CVD+FAPG+ I  LS    
Sbjct: 328 NSNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPE 384

Query: 450 SDDATATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKD 509
           S     T SGTSMASP VAGL +  L                G+ P  +K +L+   TKD
Sbjct: 385 SHHKHVTHSGTSMASPVVAGLAAILLD--------------KGVEPFDVKDKLLHLSTKD 430

Query: 510 IL----LDIPELTPNVLVFNGAGQDLSDFW 535
           +     L     TPN + +NG    + DF+
Sbjct: 431 VFNKLTLFFKYGTPNKIAYNG----IEDFF 456

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  184 bits (467), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 128/319 (40%), Positives = 166/319 (52%), Gaps = 45/319 (14%)

Query: 227 QNGAPWGLARISHRERL-----NLGSFNK---YLFDDK-AGEGVTAYVIDTGVNVEHNDF 277
           Q  AP  L+R+S R +L     N+  ++    Y FD K  G  V AY+IDTG+  EH +F
Sbjct: 115 QREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEF 174

Query: 278 EGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDV 337
           EGR  +   +       D NGHGTH AG + SK +G            L   G G +S +
Sbjct: 175 EGRVKFAIDLTQEGPG-DENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLSTI 233

Query: 338 LKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNE 397
           LK +E+ T  H  +  +KK       AN+S G  ++  +D A+  A  AGI   VAAGN 
Sbjct: 234 LKALEF-TIRHCKESVDKKC-----VANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGNS 287

Query: 398 NQDACNTSPASAKYAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNI--LSTYIGSD 451
           N DAC  SPAS+K  ITVGA    DDR    A FSNWG CVDVFAPG+ +  LS   GSD
Sbjct: 288 NIDACWNSPASSKDVITVGA---FDDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGSD 344

Query: 452 DATATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDIL 511
                LSGTSMASP V+G+ +  L                G+ P  +K ++I   TK+I 
Sbjct: 345 --VLLLSGTSMASPSVSGIAAILLD--------------KGLNPKFVKSKIIESSTKNIF 388

Query: 512 ----LDIPELTPNVLVFNG 526
               + I   TPN++VFNG
Sbjct: 389 HQGTIMIKPNTPNLIVFNG 407

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  184 bits (467), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 124/321 (38%), Positives = 158/321 (49%), Gaps = 40/321 (12%)

Query: 223 EFDTQNGAPWGLARISHRERL-----NLGSF----NKYLFDDKAGEGVTAYVIDTGVNVE 273
           +F  Q GAP  LARIS R++L     N   F    N Y  D+  GEGV AYVIDTG+  E
Sbjct: 283 KFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILKE 342

Query: 274 HNDFEGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGS 333
           H DFE R  +G  +       D NGHGTH AG I SK YG            +   GS  
Sbjct: 343 HKDFEDRVEFGTDLTGEGAG-DLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAVSLTGSTQ 401

Query: 334 MSDVLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVA 393
           +S +++ +EY          N +   K    NMSLG      ++ AV +A+  G+ F VA
Sbjct: 402 LSHIIEAIEYTVNDC-----NSRVDKKACVVNMSLGSFYVKVINEAVESAIAEGVVFVVA 456

Query: 394 AGNENQDACNTSPASAKYAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIG 449
           AGN N DAC +SP S+K AITVGA    DDR    A FSNWG+CVD+FA G+ + S    
Sbjct: 457 AGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVEVKSLSSQ 513

Query: 450 SDDATATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKD 509
                   SGTSMASP V G +S  LS               G+ P  +++ ++   TK 
Sbjct: 514 VPYKYIKYSGTSMASPIVCGFVSILLS--------------QGVKPNDVQEEMVKLSTKG 559

Query: 510 IL----LDIPELTPNVLVFNG 526
                 L     T N ++FNG
Sbjct: 560 DFTRRSLIFKPFTSNRILFNG 580

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  179 bits (454), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 132/346 (38%), Positives = 175/346 (50%), Gaps = 54/346 (15%)

Query: 227 QNGAPWGLARISHRERL-----NLG----SFNKYLFDDKAGEGVTAYVIDTGVNVEHNDF 277
           Q  AP  LARIS R  L     N+     +F+ Y  D+ +G  V AYVIDTG+  EH   
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 278 EGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDV 337
           EGRA +G  +       D NGHGTH AG I S+ +G            L + G G+++ V
Sbjct: 195 EGRAKFGADLVGEGPG-DFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 338 LKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNE 397
           +  +E+        V + +   +G  AN+SLG  ++  L+ AV AA++AG+   VAAGN 
Sbjct: 254 ISAIEFT-------VNHCRKSRRGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 398 NQDACNTSPASAKYAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIGSDDA 453
           N +AC +SPAS+  AITVGA    DDR    A FSNWG CVD+FAPG+ I S        
Sbjct: 307 NANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFK 363

Query: 454 TATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGT-----K 508
               SGTSMASP V+G+++  L      DS        GI P  +K  LI   T     K
Sbjct: 364 PVAFSGTSMASPIVSGMVANLL------DS--------GIHPFDIKTELIDLATDSVFHK 409

Query: 509 DILLDIPELTPNVLVFNGAGQDLSDFWNISKPADLESNEVYKNLDL 554
             LL  P  TPN + F G          I K  D+  + VY ++D+
Sbjct: 410 RTLLFKPG-TPNRVAFTG----------IDKTDDVYEDAVYPSVDI 444

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  179 bits (453), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 132/359 (36%), Positives = 182/359 (50%), Gaps = 42/359 (11%)

Query: 227 QNGAPWGLARISHRERLNLGS-------FNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEG 279
           Q+GAP  LAR   R  L   +       FN Y   +  GE V  Y++D+G++  H +FEG
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 280 RASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLK 339
           RA +G     N+   D NGHGTH AG + SK YG            +  +G GS S+++ 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 340 GVEYATASHLADVKNKKSGFKGSTANMSLGG---GKSPSLDLAVNAAVKAGIHFAVAAGN 396
           GVE+A       VK+ +   K   ANMSLGG   G S +LD AV AA++ G+ F VAAGN
Sbjct: 389 GVEFA-------VKHCQQSGKKCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGN 440

Query: 397 ENQDACNTSPASAKYAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATA 455
             + AC  SPA  K AITVGA    SD  A FSN+GKCVD+FAPG+ + S      +   
Sbjct: 441 SKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVR 500

Query: 456 TLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLD-- 513
            L+GTSM++P  AG+++  L                G+    +K+RLI   TK +     
Sbjct: 501 VLNGTSMSAPITAGVVAVLLDQ--------------GVKHEDVKERLIDLSTKGVFHRRR 546

Query: 514 -IPELTPNVLVFNGAGQDLSDFWNISKPADLESNEVYKNLDLVGDVLYD-QFTGIFKKM 570
            +   TP+  +FNG  Q+   F  I  P   E  + Y  +  +GD     Q   +F+K+
Sbjct: 547 LVSSRTPDRTLFNGVPQEDDVFNAIEYP--FEDEDTY--IKFIGDDFKKVQGPSLFRKV 601

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  177 bits (448), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 161/315 (51%), Gaps = 32/315 (10%)

Query: 227 QNGAPWGLARISHRERLNL---------GSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDF 277
           Q  AP  LARIS   +L             FN Y  D+  G+GV AY++DTG++ EH +F
Sbjct: 161 QPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDTGIHAEHPEF 220

Query: 278 EGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDV 337
           E R   G  +       D NGHGTH AG + S+ +G            L  +GSG  S+V
Sbjct: 221 EDRVIQGVDLTKEGFG-DENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLGKDGSGEASNV 279

Query: 338 LKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNE 397
           L G+E+    H   V   +   K   AN+SLG  +SP +++AV  A++ GI F  AAGN 
Sbjct: 280 LSGLEF-IVEHCTKVSRPQG--KKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNF 336

Query: 398 NQDACNTSPASAKYAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATAT 456
           N DA   SPASA+  ITVGA     D  A FSNWG CV++FAPG+ I S    +D+ +  
Sbjct: 337 NLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNDNESLV 396

Query: 457 LSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDIL----L 512
           LSGTSM++P V G+ +  LS               GI P  + + +    T+++     L
Sbjct: 397 LSGTSMSTPIVTGVAAVLLS--------------KGIEPELIAQEIEYLSTRNVFHRRTL 442

Query: 513 DIPELTPNVLVFNGA 527
                TPN +++NG 
Sbjct: 443 FFKPSTPNQILYNGV 457

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  174 bits (441), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 141/394 (35%), Positives = 189/394 (47%), Gaps = 58/394 (14%)

Query: 166 YFNSVEGLDLQQ----PIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNI 221
           + NSV   DL+      I   F I  L +G     + DV+D I+ +P V+ V  +  V  
Sbjct: 35  FMNSVLSKDLKWFMGGKINKRFQIGEL-KGLTMNLSHDVLDKIKRHPFVKEVVPNIMVKA 93

Query: 222 NEFDT------------QNGAPWGLARISHRERLNLG---------SFNKYLFDDKAGEG 260
            E D             Q GAP  LARIS R +L            SFN Y   D+  +G
Sbjct: 94  FEGDAVEDESWLPKMKRQRGAPRHLARISRRMQLPYDMNNKTRYRDSFNYYY--DRWAQG 151

Query: 261 VT--AYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXX 318
            T  AY++DTGV  +H +FE R  +G       E  D NGHGTH AG + SK +G     
Sbjct: 152 ATTRAYILDTGVMRDHKEFEDRVEFGTDCTGEGEG-DLNGHGTHVAGLVGSKTFGVAKHV 210

Query: 319 XXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDL 378
                  L + G+G++  +L  +E+A    + D +  +        NMSLG  KS  L+ 
Sbjct: 211 QLVDVKCLDALGAGTLVSILSALEFA----VQDCQEHEDS--QCVLNMSLGSVKSNILNQ 264

Query: 379 AVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTLSDDR----AYFSNWGKCV 434
           A+N   K GI   VAAGN N +AC TSP+SA  AITVGA    DDR    A FSNWG CV
Sbjct: 265 AINEVEKKGIVVVVAAGNFNMNACWTSPSSATGAITVGA---FDDRFDTIAKFSNWGPCV 321

Query: 435 DVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLS--LQPEQDSEFATSRKGG 492
           D+FAPG+N+ S       +    SGTSMASP V G+++  L   + PE   ++       
Sbjct: 322 DIFAPGVNVASLVNRDWPSFVKYSGTSMASPIVCGMVALLLDDGVPPEDIRDYLQELA-- 379

Query: 493 ITPAQLKKRLISYGTKDILLDIPELTPNVLVFNG 526
            T    KKR + +            TPN +++NG
Sbjct: 380 -TDGVFKKRTLVFKPG---------TPNSVLYNG 403

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  174 bits (441), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 146/410 (35%), Positives = 189/410 (46%), Gaps = 82/410 (20%)

Query: 175 LQQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFD--------- 225
           L   I  +F+  S  +G     T DV+  I+ NPLV  V  +  ++  ++D         
Sbjct: 52  LHGKISKTFSFGSF-RGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYD 110

Query: 226 -----------------TQNGAPWGLARISHRERLNLGSFNKYLFDDK------------ 256
                             QNGAP  LAR+S R  L       Y FDDK            
Sbjct: 111 DIKQPEELFDKNSYLVKVQNGAPRHLARLSRRMPL------PYDFDDKDAYNDSLSYYYS 164

Query: 257 ---AGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYG 313
               G  V AY+ID+G+++   +FEGRA+ G  +       D NGHGTH AG + SK YG
Sbjct: 165 KWHQGTDVNAYIIDSGIDINQEEFEGRATHGLDLTGEGPG-DRNGHGTHVAGLVGSKTYG 223

Query: 314 XXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKS 373
                       L   GSGS+  V+  +E+   +H    K+KK       AN+SLG    
Sbjct: 224 VAKNVTLVEVKALDRQGSGSLITVISALEFVV-NHCGKSKSKKC-----VANLSLGAFMM 277

Query: 374 PSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAITVGASTLSDDR----AYFSN 429
           P L+ A+ A V +G+   VAAGN N DAC  SPAS K AITVGA    DDR    A FSN
Sbjct: 278 PLLNEAIKATVDSGVVVVVAAGNGNIDACWCSPASEKSAITVGAF---DDRIDTIAKFSN 334

Query: 430 WGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSR 489
           WG CVD+FAPG+ I S  I  +  +   SGTSMASP VAG++S  L              
Sbjct: 335 WGSCVDIFAPGVAISSLSIKDNQKSVEFSGTSMASPQVAGIVSILLD------------- 381

Query: 490 KGGITPAQLKKRLISYGTKDI-----LLDIPELTPNVLVFNGAGQDLSDF 534
             G+    ++  L    T D+     LL  P  TPN + FNG  +   DF
Sbjct: 382 -QGVENEDIRDYLFELATDDVFQKRTLLFKPR-TPNRITFNGISKKDEDF 429

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  174 bits (440), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 121/316 (38%), Positives = 160/316 (50%), Gaps = 34/316 (10%)

Query: 227 QNGAPWGLARISHRERLNL---------GSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDF 277
           Q+ AP  LARIS   +L             FN Y  DD  G+ V AY++DTG+  +H +F
Sbjct: 125 QSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFADHPEF 184

Query: 278 EGRASWGKTIPNNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSD 336
           E R   G  I    E   D NGHGTH AG + SK YG            L  +GSG  S+
Sbjct: 185 EDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASN 242

Query: 337 VLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGN 396
           VL G+E+    H   V   +   K   AN+SLG  +SP +++AV  A++ GI F  AAGN
Sbjct: 243 VLSGLEF-IVEHCTRVSRPQG--KKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGN 299

Query: 397 ENQDACNTSPASAKYAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATA 455
            N DA   SPASA+  ITVGA     D  A FSNWG CV++FAPG+ I S    + + T 
Sbjct: 300 FNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFNDTL 359

Query: 456 TLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDIL---- 511
            LSGTSM++P V G+ +  LS               GI P  + + L    T+++     
Sbjct: 360 VLSGTSMSTPIVTGVAAVLLS--------------KGIEPEMIAQELEYLSTRNVFHRRT 405

Query: 512 LDIPELTPNVLVFNGA 527
           L     TPN +++NG 
Sbjct: 406 LFFKPSTPNQILYNGV 421

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  178 bits (451), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 131/366 (35%), Positives = 185/366 (50%), Gaps = 44/366 (12%)

Query: 221 INEFDTQNGAPWGLARISHRERLNLG-------SFNKYLFDDKAGEGVTAYVIDTGVNVE 273
           ++++  Q  AP  LAR   R  L          +FN Y  ++  GEGV  YV+D+G+   
Sbjct: 422 LHQYAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKS 481

Query: 274 HNDFEGRASWG-KTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG 332
           H +F+GRA +G  T      DL  NGHGTH AG + S+ +G            +  +G G
Sbjct: 482 HPEFDGRAHFGIDTTKEGPGDL--NGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRG 539

Query: 333 SMSDVLKGVEYATASHLADVKNKKSGFKGSTANMSLGG---GKSPSLDLAVNAAVKAGIH 389
           S S+++ GVE+A       VK+ +   K   ANMSLGG   G S +LD AV AA++ G+ 
Sbjct: 540 STSNIIAGVEFA-------VKHCQQSGKRCVANMSLGGLSFGHS-ALDSAVEAAIEEGLV 591

Query: 390 FAVAAGNENQDACNTSPASAKYAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYI 448
           F VAAGN  + AC  SPA  K AITVGA    SD  A FSN+GKCVD+FAPG+ + S   
Sbjct: 592 FVVAAGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSN 651

Query: 449 GSDDATATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTK 508
              +    L+GTSM++P  AG+++  L                GI P ++K  L+S  TK
Sbjct: 652 SPSNTMRVLNGTSMSAPITAGVVAVLLDQ--------------GIEPHEVKDHLLSISTK 697

Query: 509 DILLD---IPELTPNVLVFNGAGQDLSDFWNISKPADLESNEVYKNLDLVGDVLYD-QFT 564
            +      +   TP+  +F G  ++   F     P    + E Y  L  +GD L   Q  
Sbjct: 698 GLFHKRRLVSSRTPDRALFTGVKREDDSFSTEKFP--FVNEEAY--LKFIGDDLKKVQGP 753

Query: 565 GIFKKM 570
            +F+K+
Sbjct: 754 SLFRKV 759

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  170 bits (430), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 132/356 (37%), Positives = 174/356 (48%), Gaps = 55/356 (15%)

Query: 226 TQNGAPWGLARISHRERL-----NLGS----FNKYLFDDKAGEGVTAYVIDTGVNVEHND 276
            Q+ AP  LARIS R++L     N+ S    FN Y   +  G  V AY++D+GV+    D
Sbjct: 118 VQSEAPRHLARISRRDKLPYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTD 177

Query: 277 FEGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSD 336
           FEGR  +G     + E  D NGHGTH AG + SK YG            L   G G++  
Sbjct: 178 FEGRVEFGFDFTGDGEG-DSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLIT 236

Query: 337 VLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGN 396
           VL  +E+A    + D        K   AN+SLG  K+  ++ A+ AA + G+   VAAGN
Sbjct: 237 VLSAIEFA----VNDCHEHPE--KRCVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGN 290

Query: 397 ENQDACNTSPASAKYAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIGSDD 452
            N +AC TSPASA+ AITVGA    DDR    A FSNWG CVD++APG+ + S       
Sbjct: 291 FNINACWTSPASAEEAITVGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMV 347

Query: 453 ATATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDI-- 510
              + SGTSMASP V G ++  L                GI    +K  LI   T D+  
Sbjct: 348 KNISYSGTSMASPIVCGQVAILLD--------------KGIPNDDIKSTLIKMATDDVFQ 393

Query: 511 ---LLDIPELTPNVLVFNGAGQDLSDFWNISKPADLESNEVYKNLDLVGDVLYDQF 563
              LL  P  TPN ++FNG          I K  D     +Y  +DL  D+L ++ 
Sbjct: 394 KRTLLFKPN-TPNRVLFNG----------IEKEDDQYKEYIYPQVDL--DILVEEL 436

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  169 bits (427), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 120/316 (37%), Positives = 161/316 (50%), Gaps = 34/316 (10%)

Query: 227 QNGAPWGLARISHRERL--NLGS-------FNKYLFDDKAGEGVTAYVIDTGVNVEHNDF 277
           Q  AP  LARIS   +L  ++G        FN Y   D  G+ V AY++DTG+  +H +F
Sbjct: 125 QPDAPRHLARISRHYQLPFDVGDKDRYKSWFNYYYEHDYQGQDVNAYIMDTGIFADHPEF 184

Query: 278 EGRASWGKTIPNNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSD 336
           E R   G  I    E   D NGHGTH AG + SK YG            L  +GSG  S+
Sbjct: 185 EDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKRVNLVEVKVLGKDGSGEASN 242

Query: 337 VLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGN 396
           VL G+E+    H   V   +   K   AN+SLG  +SP +++AV  A++ GI F  AAGN
Sbjct: 243 VLSGLEF-IVEHCTKVSRPQG--KKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGN 299

Query: 397 ENQDACNTSPASAKYAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATA 455
            N DA   SPASA+  ITVGA     D  A FSNWG CV++FAPG+ I S    + + T 
Sbjct: 300 FNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYNDTL 359

Query: 456 TLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDIL---- 511
            LSGTSM++P V G+ +  LS               GI P  + + +    T+++     
Sbjct: 360 ILSGTSMSTPIVTGVAAILLS--------------KGIEPEMIAQEIEYLSTRNVFHRRT 405

Query: 512 LDIPELTPNVLVFNGA 527
           L     TPN +++NG 
Sbjct: 406 LFFKPSTPNQILYNGV 421

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  169 bits (429), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 126/342 (36%), Positives = 170/342 (49%), Gaps = 35/342 (10%)

Query: 227 QNGAPWGLARISHRERLNL---------GSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDF 277
           Q+ AP  LARIS   +L             FN Y  DD  G+ V AY++DTG+  +H +F
Sbjct: 174 QSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIMDTGIFSDHPEF 233

Query: 278 EGRASWGKTIPNNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSD 336
           E R   G  I    E   D NGHGTH AG + SK YG            L  +GSG  S+
Sbjct: 234 EDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASN 291

Query: 337 VLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGN 396
           VL G+E+    H   V   +   K   AN+SLG  +SP +++AV  A++ GI F  AAGN
Sbjct: 292 VLSGLEF-IVEHCTRVSRPQG--KKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGN 348

Query: 397 ENQDACNTSPASAKYAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATA 455
            N DA   SPASA+  ITVGA     D  A FSNWG CV++FAPG+ I S    + + T 
Sbjct: 349 FNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNYEDTL 408

Query: 456 TLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDIL---- 511
            LSGTSM++P V G+ +  LS               GI PA + + +    T+++     
Sbjct: 409 ILSGTSMSTPIVTGVAAVLLS--------------KGIEPALIAQEIEYLSTRNVFHRRT 454

Query: 512 LDIPELTPNVLVFNGAGQDLSDFWNISKPADLESNEVYKNLD 553
           L     T N +++NG  + L D +N      L    + K L+
Sbjct: 455 LFFKPSTANQILYNGVDK-LDDPYNDETFPRLNIEAIAKELE 495

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  168 bits (426), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 120/348 (34%), Positives = 176/348 (50%), Gaps = 33/348 (9%)

Query: 225 DTQNGAPWGLARISHRERL--------NLGSFNKYLFDDK-AGEGVTAYVIDTGVNVEHN 275
           D Q GAP  L ++S R +L            F  Y +D    G     Y+IDTGV  EH 
Sbjct: 148 DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 276 DFEGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMS 335
           +F  R  +G       +  D NGHGTH AG I SK +G            L   G G+++
Sbjct: 208 EFGNRVHFGGDFIGEGKG-DYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLT 266

Query: 336 DVLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAG 395
            VL+G+E+A  +    +K +  G K    NMSLG  ++P ++ A+  A  +GI   VAAG
Sbjct: 267 SVLEGIEFAVNN--CKLKQQPMG-KNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAG 323

Query: 396 NENQDACNTSPASAKYAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDAT 454
           N N  AC TSPAS+ +AITVGA    +D  A FSNWG+CVD+FAPG+ I S      +  
Sbjct: 324 NNNFSACWTSPASSNFAITVGAMDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRMLENG 383

Query: 455 ATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDI 514
              SGTSMASP VAGL++  +              + G    ++K++LI   +K I   +
Sbjct: 384 VIHSGTSMASPIVAGLVAILM--------------EKGYKCDEIKQKLIDDSSKSIFSKL 429

Query: 515 PEL----TPNVLVFNGAGQDLS-DFWNISKPADLESNEVYKNLDLVGD 557
                  TPN +++NG  + ++ +  NI +  + + ++ Y  ++ + D
Sbjct: 430 TLFFKYGTPNRVIYNGIEEVINVNKENIRQREETDESKEYDTIEDIDD 477

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  164 bits (415), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 129/347 (37%), Positives = 173/347 (49%), Gaps = 48/347 (13%)

Query: 223 EFDTQNGAPWGLARISHRERL---------NLGSFNKYLFDDKAGEGVTAYVIDTGVNVE 273
           +F  Q  AP  LARIS R  L            +F+ Y  D   G  V AYVIDTG+  E
Sbjct: 129 DFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGIFKE 188

Query: 274 HNDFEGRASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGS 333
           H  F+GRA +G  +       D NGHGTH AG I S+ YG            L + G G+
Sbjct: 189 HRQFQGRAKFGADLVGEGPG-DLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKGQGN 247

Query: 334 MSDVLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVA 393
           ++ V+  +E+ T +H    K      +G  AN+SLG  ++  L+ AV AA++AG+   VA
Sbjct: 248 LTSVISAIEF-TVNHCRKSK------RGCVANLSLGSFRNSVLNQAVEAALEAGVVVVVA 300

Query: 394 AGNENQDACNTSPASAKYAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDD 452
           AGN N +AC +SPAS+  AI+VGA    +D  A FSNWG CVD+FAPG+ I S       
Sbjct: 301 AGNSNANACWSSPASSLSAISVGAFDDRTDTIARFSNWGNCVDLFAPGVKIASLSNIPPF 360

Query: 453 ATATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGT----- 507
            +   SGTSMASP V G+++  L                GI P  +K+ LI+  T     
Sbjct: 361 KSVAYSGTSMASPLVTGMVAVLLD--------------SGIHPFDIKEELINTATDSVFH 406

Query: 508 KDILLDIPELTPNVLVFNGAGQDLSDFWNISKPADLESNEVYKNLDL 554
           K  LL  P  TPN + F G          + K  D+  + VY  +D+
Sbjct: 407 KRALLFKPG-TPNRVAFTG----------VEKEDDIFEDAVYPGVDI 442

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  154 bits (390), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 124/330 (37%), Positives = 171/330 (51%), Gaps = 44/330 (13%)

Query: 222 NEFDTQNGAPWGLARISHRERL------NLGSFNKYLF-DDKAGEGVTAYVIDTGVNVEH 274
           ++F +Q+ AP  LARIS R +L      +  S  KY + ++  GEGV  YV+D+GVN +H
Sbjct: 149 DDFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDH 208

Query: 275 NDFEGRASWG-KTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGS 333
            DFEGRA  G  T      DL   GHGTH AG I SK YG            L S G G+
Sbjct: 209 PDFEGRAMKGIDTTGEGSGDL--VGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGT 266

Query: 334 MSDVLKGVEYATASHLADVKNKKSGFKGSTANMSLGG-GKSPSLDLAVNAAVKAGIHFAV 392
           ++++++G+EY     +   K +K        NMSLG  G    LD AV+A ++ G+   V
Sbjct: 267 VTNIIEGLEYVVNQCIG--KKRK-----CVINMSLGAPGTHSILDKAVSAVIEEGVVVVV 319

Query: 393 AAGNENQDACNTSPASAKYAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYI 448
           A GN   +AC  SPA  + AITV A    DDR    A FSNWG C+D++APG+N+ S   
Sbjct: 320 AGGNSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLS- 375

Query: 449 GSDDATATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTK 508
                T  LSGTSMASP VAG  + +L                G  PA+++K L    T+
Sbjct: 376 NKGRGTFVLSGTSMASPIVAGAAAIYLD--------------QGADPAEVRKILSKTATR 421

Query: 509 DIL----LDIPELTPNVLVFNGAGQDLSDF 534
            +     + +   TPN +++ G  Q+  +F
Sbjct: 422 GVFKKRAIAVRPRTPNKVLYTGNNQEDDEF 451

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  132 bits (333), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 92/274 (33%), Positives = 134/274 (48%), Gaps = 11/274 (4%)

Query: 223 EFDTQNGAPWGLARISHRERLNLGS---FNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEG 279
           ++ TQ  AP  L+R S   +L   S   +N Y   D  G  VT YV+D+G+ ++H +FEG
Sbjct: 141 KYSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEG 200

Query: 280 RASWGKTIPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLK 339
           R        ++    D  GHGT  AG I SK YG            L + G G++  +L+
Sbjct: 201 RILEAYDFTDSGVG-DNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSILQ 259

Query: 340 GVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQ 399
           G+++ T  H  +  N          N SLG      L+ A      AGI    AAGN   
Sbjct: 260 GLQFIT-KHCEENTNG-----NCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNAV 313

Query: 400 DACNTSPASAKYAITVGASTLSDDR-AYFSNWGKCVDVFAPGLNILSTYIGSDDATATLS 458
           +AC  +PA +K   TVG+    DD  A FSNWG+CVD+ APG+ + +    +   +   S
Sbjct: 314 NACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRESS 373

Query: 459 GTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGG 492
           GTS+++P V GL +  LS    +++ +   RK G
Sbjct: 374 GTSVSTPIVTGLAAILLSKGVPKENLYDEIRKMG 407

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  128 bits (321), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 90/302 (29%), Positives = 154/302 (50%), Gaps = 12/302 (3%)

Query: 180 IDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISH 239
           + + ++ +  +   G F   +++ +  +  +  +  D  +   E+  Q  AP  LAR+S 
Sbjct: 46  VGAISLGNSFRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAHLARLSQ 105

Query: 240 RERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNND-EDLDGNG 298
           +  L  GS   Y++    G GV  Y++DTG++  H + EGR      + +N     D +G
Sbjct: 106 KSTLR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRVQKIADLTSNPVSHGDPHG 164

Query: 299 HGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSG 358
           HGT  AG I S  +G              S G+ ++  V++ +E+A  S LA V  + S 
Sbjct: 165 HGTAVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRALEHA--SKLASVTQRPS- 221

Query: 359 FKGSTANMSLGGGKSPSLDLAVNAAVK-AGIHFAVAAGNENQDACNTSPASAKYAITVGA 417
                  +     K+  L+ A+ A ++   +   VA GN NQ+AC++SPASA  A+T+G+
Sbjct: 222 ----VVVIPFTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASAYGALTIGS 277

Query: 418 --STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLSYFL 475
              T  D  A F+N+G C+D FA G+NI S   G  ++    SGTS+++   +G+++Y++
Sbjct: 278 IDVTKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIASGVVAYYM 337

Query: 476 SL 477
           SL
Sbjct: 338 SL 339

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  124 bits (311), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 96/307 (31%), Positives = 159/307 (51%), Gaps = 19/307 (6%)

Query: 180 IDSFNINSLLQGYIGYFTDDVI-DFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARIS 238
           + +  + +  +   G F   ++ DF R   +V  +  D  + + E+  Q  AP  LAR+S
Sbjct: 46  VGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVA-MSMDRPLGVAEYMVQQHAPNHLARLS 104

Query: 239 HRERLNLGSFN---KYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWGKTIPNNDEDL- 294
            +  L  G+ +    Y++   AG GV  Y++DTG++  H  FEGR        ++     
Sbjct: 105 QKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRVQKAADFSSDPVATG 164

Query: 295 DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKN 354
           D +GHGT  AG I S  +G              S G  S+  VL+ +E+A  S LA V  
Sbjct: 165 DPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHA--SKLAAVTK 222

Query: 355 KKSGFKGSTANMSLGGGKSPSLDLAVNAAVK-AGIHFAVAAGNENQDACNTSPASAKYAI 413
           + S        + L   ++  L+ AV A V+   I   VAAGNEN+ AC+ SPA A  A+
Sbjct: 223 RPS-----LITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSVSPAGAYGAL 277

Query: 414 TVGASTLS--DDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATA-TLSGTSMASPHVAGL 470
           T+G+  ++  D  A F+N+ +CVD+F  G+++ +  +G D ++   LSGTS+++   +GL
Sbjct: 278 TIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTSISAGVASGL 335

Query: 471 LSYFLSL 477
           ++Y++S+
Sbjct: 336 VAYYMSI 342

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  122 bits (306), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 99/325 (30%), Positives = 163/325 (50%), Gaps = 27/325 (8%)

Query: 168 NSVEGLDLQQPIIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQ 227
           NS+  LD  +P+ D   I S   G+ G F D+V+  +  +P V  +  D  + + E+  Q
Sbjct: 43  NSLNNLD--EPV-DKIVIGSDFHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQ 99

Query: 228 NGAPWGLARISH---RERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRASWG 284
           N AP  LAR+S+     R++  + N ++F   AG GV  Y++D+G++ +H  F  R    
Sbjct: 100 NDAPEHLARLSNGVSNSRVSAKNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNR-HIS 158

Query: 285 KTIPNNDEDL---DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG-SMSDVLKG 340
           K I   D  +   D +GHGT  AG + S  +G            + +  +G  +S +LK 
Sbjct: 159 KLIDLTDNPIPVGDPHGHGTAIAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKS 218

Query: 341 VEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQD 400
           +E+          + ++  + S A +     K+  L+ A+  ++   I   V AGN++  
Sbjct: 219 LEFIE-------NHSRATMRPSVAVLPFSMSKNAILNSAIE-SMPNSIAIVVPAGNQHHM 270

Query: 401 ACNTSPASAKYAITVGASTLSDDR-----AYFSNWGKCVDVFAPG--LNILSTYIGSDD- 452
           ACN SPASA+ + ++ +    D R     A FSN+G+CVDVF  G  ++ L     SD+ 
Sbjct: 271 ACNFSPASARNSQSILSVGSLDYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDEN 330

Query: 453 ATATLSGTSMASPHVAGLLSYFLSL 477
             + +SGTSM+    AG + Y++SL
Sbjct: 331 YISKVSGTSMSCAIAAGTVGYYMSL 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  102 bits (253), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 91/322 (28%), Positives = 146/322 (45%), Gaps = 31/322 (9%)

Query: 174 DLQQP-IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPW 232
           D Q P I D F + S  + + G F+  ++  +  +P V  + +D ++ + E   QN AP 
Sbjct: 39  DQQGPEITDIFELGSF-RAFTGDFSGPILQKLYNDPNVLAISRDGSLKLQEIVLQNNAPS 97

Query: 233 GLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEH------NDFEGRASWGKT 286
            L  +S    L   S   +++    G GV  Y++DTG++++H      N           
Sbjct: 98  HLVGLSSISPL---SHQPFIYRSNGGNGVDVYLLDTGIDIKHPNLSKLNILRMADLTQSP 154

Query: 287 IPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATA 346
           +P   +  D  GHGT  AG IAS+ +G              SNG   +S +L+ +   T 
Sbjct: 155 VP---QGTDPQGHGTAMAGIIASETFGVLKKCNLVDVRVADSNGDVKLSTILQALTL-TQ 210

Query: 347 SHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSP 406
            H+   K            + +  G +P L  A+ A+    +   + AGN  QDA N SP
Sbjct: 211 RHIEGTKRPSV----VVIPLEVEDGNNPILTEAI-ASFDQSVPIIIPAGNNAQDALNFSP 265

Query: 407 ASA----KYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNI-------LSTYIGSDDATA 455
           A+     K  I VG+  ++++   F+N+G  VDVF  G  I       L +   S+  T 
Sbjct: 266 ANVNPKPKNIIVVGSVDVNNNPTKFTNYGSNVDVFTVGEQITTLQSTDLDSQGLSNSLTR 325

Query: 456 TLSGTSMASPHVAGLLSYFLSL 477
            +SGTS +S   AG++ Y++SL
Sbjct: 326 QVSGTSASSAITAGVIGYYMSL 347

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 94.0 bits (232), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 85/307 (27%), Positives = 147/307 (47%), Gaps = 27/307 (8%)

Query: 180 IDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISH 239
           I+   +    +   G F+ + ++++  +  V  + +D  + + E+  Q G+P  L+++S 
Sbjct: 44  IEMITVGDQFKALAGEFSVEDLEYLYHDERVVAISRDRDLKLQEYKVQYGSPRHLSQLSS 103

Query: 240 RERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEG-----RASWGKT-IPNNDED 293
                 GSF    FD  +G  V  YV DTG++ +H   +       A +  + +P     
Sbjct: 104 G-----GSFT---FDPVSGNLVDVYVFDTGIDFKHPGLQNVNPHKLADFTSSPVPRG--- 152

Query: 294 LDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVK 353
            D +GHGT  AG IAS+ +G               +G   +S ++KG+  A+ +H A   
Sbjct: 153 ADPHGHGTMMAGLIASETFGVLKSCSLVDVRVADKDGEVKLSTLMKGIS-ASVAH-ARFT 210

Query: 354 NKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDACNTSPASAKYAI 413
            + S F      M++G  K+  LD  + A  K  I   + AGN+  DAC+ SP +    +
Sbjct: 211 KRPSVF---VLPMTIGK-KNHILDNFLQAIPK-DIAIVLPAGNQQTDACDLSPPNDHNIL 265

Query: 414 TVGASTLSDDRAYFSNWGKCVDVFAPGLNIL---STYIGSDDATATLSGTSMASPHVAGL 470
            +G+    +  A FSN+G CVDV+  G +IL   ST  G++    + +GTS +    AG+
Sbjct: 266 VIGSLDRDNRLADFSNYGNCVDVYTSGTDILTLRSTDSGNEVLLQSSNGTSASCAIGAGI 325

Query: 471 LSYFLSL 477
           + Y +S+
Sbjct: 326 VGYHMSM 332

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 129/272 (47%), Gaps = 35/272 (12%)

Query: 227 QNGAPWGLARISHRERLNLGSF----NKYLFDDKAGEGVTAYVIDTGVNVEH-----NDF 277
           Q  AP  L R++ ++ +    +    N+Y+F D +G GV  Y++DTG++++H     N+ 
Sbjct: 97  QTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSGNGVDIYIVDTGIDIQHPIYLQNNI 155

Query: 278 EGRASWGKT-IPNNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGS-GSMS 335
                   + IP+     D NGHGT  AG I S  +G            + +N    +MS
Sbjct: 156 HKLIDLTTSPIPSG----DFNGHGTAMAGIINSDPFGVLKSANLVDVRVVDANTKHATMS 211

Query: 336 DVLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAG 395
            VL  +           K+++   + S   +     K+  L+ A+    K  I   + AG
Sbjct: 212 RVLSALSLIE-------KHEQKTMRPSIIVLPFQTEKNTILESAIENISKK-IPVIIPAG 263

Query: 396 NENQDACNTSPASAKY---AITVGASTLSDDRAY-----FSNWGKCVDVFAPGLNILSTY 447
           N++Q+AC  SP   K     + VG+   S+++ Y     FSN+G CVD++  G++I +  
Sbjct: 264 NKHQNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNYGSCVDIYTSGVDISTLK 323

Query: 448 IGSD---DATATLSGTSMASPHVAGLLSYFLS 476
             S+   +    ++GTS +   VAG++ Y++S
Sbjct: 324 TSSNGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 80/283 (28%), Positives = 122/283 (43%), Gaps = 36/283 (12%)

Query: 213 VEQDSTVNINEFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNV 272
           +  D  +   E   Q  AP  L ++   E  +    N++++D  AG GV  Y+ DTG  +
Sbjct: 83  ISIDRQLEPQEMIVQKDAPRHLTKLLETEAGD----NEFVYDSTAGNGVDIYIFDTG--I 136

Query: 273 EHNDFEGRASWGKTIP-------NNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXX 325
             N     AS    +P        + E L+   HGT  +G I S  +G            
Sbjct: 137 ARNSPGLSASRIHDMPGMPGPPIRDQEILE---HGTAMSGLIGSPAFGVLKKCNLIDVNV 193

Query: 326 LRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVK 385
              NG   MS VLKG+           ++ K   + S  N S    K+  L+ A +   +
Sbjct: 194 GDENGKVFMSKVLKGLNLVQ-------QHVKHTNRPSVINFSYCTLKNAILNSAFDNFPR 246

Query: 386 AGIHFAVAAGNENQDACNTSPASA---KYAITVGASTLSDD---RAYFSNWGKCVDVFAP 439
             +  AVAAGN  Q  C+ SP      K  +  G+  ++DD    + FSN+G CV  +AP
Sbjct: 247 -DVPIAVAAGNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAP 305

Query: 440 GLNILSTYI------GSDDATATLSGTSMASPHVAGLLSYFLS 476
           G  +L+  I       S D    +SGTS +S   AG++ Y+++
Sbjct: 306 GEGLLTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 103/254 (40%), Gaps = 30/254 (11%)

Query: 250 KYLFDDKAGEGVTAYVIDTGVNVEHNDF------EGRASWGKTIPNNDEDLDGNGHGTHC 303
           +  +++  G G+ A ++D GV+ ++++       EG   +    P     L  + HGT C
Sbjct: 183 QLWYENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDYHGTRC 242

Query: 304 AGTI-ASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGV-EYATASHLADVKNKKSGFKG 361
           AG I ASK+ G             +  G   +S  L    E A+  H  DV +  S   G
Sbjct: 243 AGEIAASKNNGICGVGVAYDA---KVAGIRILSGELTAEDEAASLVHALDVNDIYSCSWG 299

Query: 362 STANMSLGGGKSPSLDLAVNAAVKA--------GIHFAVAAGNENQ--DACNTSP-ASAK 410
              + +   G +   DL   A ++         G  +  A+GN     D CN     ++ 
Sbjct: 300 PRDDGTHLQGPT---DLVKKAMIRGVTEGRDQKGALYVFASGNGGAYGDNCNYDGYTNSI 356

Query: 411 YAITVGASTLSDDRAYFSNWGKCVDVFA----PGLNILSTYIGSDDATATLSGTSMASPH 466
           Y+ITVGA         +S     V V       G  I +T IG D  + T  GTS A+P 
Sbjct: 357 YSITVGAIDHKGLHPPYSESCSAVMVVTCSSGSGEFIHTTDIG-DKCSNTHGGTSAAAPL 415

Query: 467 VAGLLSYFLSLQPE 480
            AG+ +  L   PE
Sbjct: 416 AAGVYTLVLQANPE 429

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 96/249 (38%), Gaps = 28/249 (11%)

Query: 253 FDDKAGEGVTAYVIDTGVNVEHND----FEGRASWGKTIPNN--DEDLDGNGHGTHCAGT 306
           +++  G GV A ++D G++ E+ D    F    SW      N     L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGE 220

Query: 307 IASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFKGSTANM 366
           IA+K  G              S       D+    E A+  +  DV +  S   G   + 
Sbjct: 221 IAAKK-GNNFCGVGVGYNAKISGIRILSGDITTEDEAASLIYGLDVNDIYSCSWGPADDG 279

Query: 367 SLGGGKSPSLDLAVNAAVKA--------GIHFAVAAGN--ENQDACNTSP-ASAKYAITV 415
               G S   DL   A VK         G  +  A+GN     D CN     ++ Y+IT+
Sbjct: 280 RHLQGPS---DLVKKALVKGVTEGRDSKGAIYVFASGNGGTRGDNCNYDGYTNSIYSITI 336

Query: 416 GASTLSDDRAYFSNWGKCVDVFAPGLNILS-TYIGSDDATATLS----GTSMASPHVAGL 470
           GA    D    +S    C  V A   +  S  YI S D     S    GTS A+P  AG+
Sbjct: 337 GAIDHKDLHPPYSE--GCSAVMAVTYSSGSGEYIHSSDINGRCSNSHGGTSAAAPLAAGV 394

Query: 471 LSYFLSLQP 479
            +  L   P
Sbjct: 395 YTLLLEANP 403

>CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa]
           {ON} similar to uniprot|P13134 Saccharomyces cerevisiae
           YNL238w KEX2 endoproteinase of late golgi compartment
          Length = 789

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 96/248 (38%), Gaps = 34/248 (13%)

Query: 257 AGEGVTAYVIDTGVNVEHND----FEGRASW----GKTIPNNDEDLDGNGHGTHCAGTIA 308
            G+GV A +ID GV+    D    F    SW     + +P     L  + HGT CAG IA
Sbjct: 169 TGKGVVAAIIDDGVDYTSPDLKDNFCKEGSWDFNENQQLPM--PLLSDDNHGTRCAGEIA 226

Query: 309 S---KHYGXXXXXXXXXXXXLRS-NGSGSMSDVLKGVEYATASHLADVKNKKSGFKGSTA 364
           +    +Y             +R  +G  +  D     E A+  H  DV +  S   G T 
Sbjct: 227 AIRNNNYCGVGVAYDAKVSGIRILSGPLTAED-----EAASLVHALDVNDIYSCSWGPTD 281

Query: 365 NMSLGGGKSPSLDLAVNAAV------KAGIH-FAVAAGNENQDACNTSP-ASAKYAITVG 416
           +     G SP +  A+   V      K  I+ FA   G  + D CN     ++ Y+ITVG
Sbjct: 282 DGKHLQGPSPLVKKAMKKGVTEGRGNKGAIYVFASGNGGMHGDNCNYDGYTNSIYSITVG 341

Query: 417 ASTLSDDRAYFSNWGKCVDVFAPGLNILS-TYIGSDDATATL----SGTSMASPHVAGLL 471
           A         +S    C  V     +  S  YI S D          GTS A+P  AG+ 
Sbjct: 342 AIDHKGLHPPYSE--SCSAVLVVTYSSGSGEYIHSTDINGGCYDRHGGTSAAAPIAAGIY 399

Query: 472 SYFLSLQP 479
           +  L   P
Sbjct: 400 ALVLEANP 407

>NDAI0F03890 Chr6 complement(921561..924062) [2502 bp, 833 aa] {ON}
           Anc_2.6 YNL238W
          Length = 833

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 68/259 (26%), Positives = 100/259 (38%), Gaps = 42/259 (16%)

Query: 250 KYLFDDKAGEGVTAYVIDTGVNVEHND----FEGRASW----GKTIPNNDEDLDGNGHGT 301
           K  +++  GEG+   ++D G++ E+ D    F    SW       +P     L  + HGT
Sbjct: 172 KLWYENITGEGIVVAIVDDGLDYENPDLKDNFSAEGSWDFNDNTQLPK--PRLADDYHGT 229

Query: 302 HCAGTIASKH----YGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKS 357
            CAG IA+       G               +G  +  D     E A+  H  DV +  S
Sbjct: 230 RCAGEIAATKDNGFCGIGVAYNAKVAGIRILSGELTAED-----EAASLVHALDVNDIYS 284

Query: 358 GFKGSTANMSLGGGKSPSLDLAVNAAV--------KAGIHFAVAAGNENQ--DACNTSP- 406
              G   + +   G +   DL   A +        K G  +  A+GN     D CN    
Sbjct: 285 CSWGPKDDGTHLQGPT---DLVKKAMIRGTSDGRDKKGAIYVFASGNGGAFGDNCNYDGY 341

Query: 407 ASAKYAITVGASTLSDDRAYFSNWGKCVDVFA------PGLNILSTYIGSDDATATLSGT 460
            ++ Y+IT+GA         +S    C  V A       G  I ST IG +  +    GT
Sbjct: 342 TNSIYSITIGALDHKGLHPPYSE--SCSAVMAVTYSSGSGEYIHSTDIG-NKCSDHHGGT 398

Query: 461 SMASPHVAGLLSYFLSLQP 479
           S A+P  AG+ S  L + P
Sbjct: 399 SAAAPLAAGIFSLVLQVNP 417

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 97/254 (38%), Gaps = 38/254 (14%)

Query: 253 FDDKAGEGVTAYVIDTGVNVEHND----FEGRASWGKTIPNN--DEDLDGNGHGTHCAGT 306
           +++  G GV A ++D G++ E+ D    F    SW      N     L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGE 220

Query: 307 IASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGV-----EYATASHLADVKNKKSGFKG 361
           IA+K               +  N   S   +L G      E A+  +  D  +  S   G
Sbjct: 221 IAAKK------GNDFCGVGVGYNAKISGIRILSGEITTEDEAASLIYGLDTNDIYSCSWG 274

Query: 362 STANMSLGGGKSPSLDLAVNAAVKA--------GIHFAVAAGN--ENQDACNTSP-ASAK 410
              +     G S   DL   A VK         G  +  A+GN     D CN     ++ 
Sbjct: 275 PADDGRHLQGPS---DLVKKALVKGVTEGRDSKGAIYVFASGNGGARGDNCNYDGYTNSI 331

Query: 411 YAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILS-TYIGSDDATATLS----GTSMASP 465
           Y+IT+GA    D    +S    C  V A   +  S  YI S D     S    GTS A+P
Sbjct: 332 YSITIGAIDHKDLHPPYSE--SCSAVMAVTYSSGSGEYIHSSDINGKCSDSHGGTSAAAP 389

Query: 466 HVAGLLSYFLSLQP 479
             AG+ +  L   P
Sbjct: 390 LAAGVYTLLLEANP 403

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 37.7 bits (86), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 97/253 (38%), Gaps = 30/253 (11%)

Query: 250 KYLFDDKAGEGVTAYVIDTGVNVEHND----FEGRASWGKTIPNN--DEDLDGNGHGTHC 303
           K  +++  G GV A ++D G++ E+ D    F    SW      N     L  + HGT C
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRC 217

Query: 304 AGTIASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFKGST 363
           AG IA+K  G              S       D+    E A+  +  D  +  S   G  
Sbjct: 218 AGEIAAKK-GNNFCGVGVGYNAKISGIRILSGDITTEDEAASLIYGLDTNDIYSCSWGPA 276

Query: 364 ANMSLGGGKSPSLDLAVNAAVKA--------GIHFAVAAGN--ENQDACNTSP-ASAKYA 412
            +     G +   DL   A VK         G  +  A+GN     D CN     ++ Y+
Sbjct: 277 DDGRHLQGPN---DLVKKALVKGVTQGRDSKGAIYVFASGNGGARGDNCNYDGYTNSIYS 333

Query: 413 ITVGASTLSDDRAYFSNWGKCVDV--FAPGLNILSTYIGSDD----ATATLSGTSMASPH 466
           IT+GA    D    +S     V V  ++ G      YI S D     + T  GTS A+P 
Sbjct: 334 ITIGAIDHKDLHPPYSEGCSAVMVVTYSSGSG---EYIHSSDINGGCSNTHGGTSAAAPL 390

Query: 467 VAGLLSYFLSLQP 479
            AG+ +  L   P
Sbjct: 391 AAGVYTLLLEANP 403

>KNAG0F00770 Chr6 (137641..140121) [2481 bp, 826 aa] {ON} Anc_2.6
           YNL238W
          Length = 826

 Score = 37.4 bits (85), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 72/252 (28%), Positives = 99/252 (39%), Gaps = 40/252 (15%)

Query: 257 AGEGVTAYVIDTGVNVEHND----FEGRASW----GKTIPNNDEDLDGNGHGTHCAGTI- 307
            G GV   ++D GV+ E+ D    F    SW      T+P     L  + HGT CAG I 
Sbjct: 169 TGSGVVVAIVDDGVDYENPDIADNFCAEGSWDFNDNTTLPK--PRLADDYHGTRCAGEIA 226

Query: 308 ASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGV-----EYATASHLADVKNKKSGFKGS 362
           ASK+ G            +  N   S   +L G      E A+  +  DV +  S   G 
Sbjct: 227 ASKNNG-------FCGIGVAYNSKVSGLRILSGPLTPEDEAASLMYALDVNDIFSCSWGP 279

Query: 363 TANMSLGGGKSPSLDLAVNAAV-----KAGIHFAVAAGNENQ--DACNTSP-ASAKYAIT 414
             +     G S  +  A+   V     K G  +  A+GN     D CN     ++ Y+IT
Sbjct: 280 QDDGRHLQGPSELVRKALIKGVTEGRQKKGSVYVFASGNGGHFGDNCNYDGYTNSIYSIT 339

Query: 415 VGASTLSDDRAYFSNWGKCVDVFA------PGLNILSTYIGSDDATATLSGTSMASPHVA 468
           +GA         +S    C  V A       G  I ST I +D  +    GTS A+P  A
Sbjct: 340 IGAIDHKGLHPPYSE--SCSAVMAVTYSSGSGEFIHSTDI-NDQCSDRHGGTSAAAPLAA 396

Query: 469 GLLSYFLSLQPE 480
           G+ +  L   PE
Sbjct: 397 GIYALLLEANPE 408

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 67/249 (26%), Positives = 96/249 (38%), Gaps = 35/249 (14%)

Query: 257 AGEGVTAYVIDTGVNVEHND------FEGRASWGKTIPNNDEDLDGNGHGTHCAGTIAS- 309
            G+ VT  ++D GV+ E+ D      FEG   +          L  + HGT CAG IA+ 
Sbjct: 166 TGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAAV 225

Query: 310 -KHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFKGSTANMSL 368
              Y             LR   SG ++     VE   A+ +  +K     F  S      
Sbjct: 226 RNDYCGVGVAFDAHISGLRI-LSGELT-----VEDEAAALIYGLK-YNDIFSCSWGPPDD 278

Query: 369 GGGKSPSLDLAVNAAVKA--------GIHFAVAAGNE--NQDACNTSP-ASAKYAITVGA 417
           G       DL   A +K         G  +  A+GN   + D CN     ++ Y+IT+GA
Sbjct: 279 GQHLQGPYDLVKKAFIKGIQDGRDEKGAIYVFASGNGAISGDNCNYDGYTNSIYSITIGA 338

Query: 418 STLSDDRAYFSNWGK-CVDVFAPGLNILS-TYIGSDDATATLS----GTSMASPHVAGLL 471
               D R     + + C  V A   +  S  +I + D     S    GTS A+P  AG+ 
Sbjct: 339 ---IDHRGLHPAYSESCSAVMAVTYSSGSGKFIETTDINGKCSTHHGGTSAAAPLAAGVY 395

Query: 472 SYFLSLQPE 480
           +  L   PE
Sbjct: 396 ALLLEANPE 404

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 70/254 (27%), Positives = 98/254 (38%), Gaps = 38/254 (14%)

Query: 253 FDDKAGEGVTAYVIDTGVNVEHND----FEGRASWGKTIPNN--DEDLDGNGHGTHCAGT 306
           +++  G GV A ++D G++ E+ D    F    SW      N     L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDDYHGTRCAGE 220

Query: 307 IASKHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGV-----EYATASHLADVKNKKSGFKG 361
           IA+K               +  N   S   +L G      E A+  +  D  +  S   G
Sbjct: 221 IAAKK------GNNFCGIGVGYNAKISGIRILSGELTTEDEAASLIYGLDTNDIYSCSWG 274

Query: 362 STANMSLGGGKSPSLDLAVNAAVKA--------GIHFAVAAGN--ENQDACNTSP-ASAK 410
              +     G S   DL   A VK         G  +  A+GN   + D CN     ++ 
Sbjct: 275 PADDGRHLQGPS---DLVKKALVKGVTEGRDSKGAIYVFASGNGGAHGDNCNYDGYTNSI 331

Query: 411 YAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILS-TYIGSDDATATLS----GTSMASP 465
           Y+IT+GA    D    +S    C  V A   +  S  YI S D     S    GTS A+P
Sbjct: 332 YSITIGAIDHKDLHPPYSE--GCSAVMAVTYSSGSGEYIHSSDINGRCSNSHGGTSAAAP 389

Query: 466 HVAGLLSYFLSLQP 479
             AG+ +  L   P
Sbjct: 390 LAAGVYTLLLEANP 403

>Kwal_56.24800 s56 complement(1150009..1152420) [2412 bp, 803 aa]
           {ON} YNL238W (KEX2) - Ca2+-dependent serine protease
           [contig 160] FULL
          Length = 803

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 93/246 (37%), Gaps = 23/246 (9%)

Query: 253 FDDKAGEGVTAYVIDTGVNVEHND----FEGRASW--GKTIPNNDEDLDGNGHGTHCAGT 306
           +++  G  V   V+D G++ E  D    F    SW     +      L  + HGT CAG 
Sbjct: 156 YENITGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNVALPKPRLSDDYHGTRCAGE 215

Query: 307 IASKHYGXXXXXXXXXXXXLRSNGSGSMS-DVLKGVEYATASHLADVKNKKSGFKG-STA 364
           IA+   G             +  G   +S +V    E A+  H  DV +  S   G S  
Sbjct: 216 IAA---GKNQFCGVGVAYNAKVAGLRILSAEVTSEDEAASLIHALDVNDIYSCSWGPSDD 272

Query: 365 NMSLGGGKSPSLDLAVNAAVKA----GIHFAVAAGNENQ--DACNTSP-ASAKYAITVGA 417
             SL G         V   +K     G  +  A+GN     D CN     ++ Y+ITVGA
Sbjct: 273 GRSLQGPDDLVKKALVTGVLKGRDEKGALYVFASGNGGMFDDNCNYDGYTNSIYSITVGA 332

Query: 418 STLSDDRAYFSNWGKCVDVFA----PGLNILSTYIGSDDATATLSGTSMASPHVAGLLSY 473
                    +S     V V       G +I ST I     + T  GTS A+P  AG+ S 
Sbjct: 333 IDHKGLHPPYSESCSAVMVVTYSSGSGEHIHSTDIHG-RCSDTHGGTSAAAPLAAGVYSL 391

Query: 474 FLSLQP 479
            L   P
Sbjct: 392 VLEANP 397

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 253 FDDKAGEGVTAYVIDTGVNVEHNDF------EGRASWGKTIPNNDEDLDGNGHGTHCAGT 306
           +++  G GV A ++D G++ E+ D       EG   +    P     L  + HGT CAG 
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGTRCAGE 244

Query: 307 IAS 309
           IA+
Sbjct: 245 IAA 247

>KLTH0H00418g Chr8 (46022..48457) [2436 bp, 811 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 811

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 90/248 (36%), Gaps = 27/248 (10%)

Query: 253 FDDKAGEGVTAYVIDTGVNVEHND----FEGRASW--GKTIPNNDEDLDGNGHGTHCAGT 306
           +++  G  V   V+D G++ E  D    F    SW      P     L  + HGT CAG 
Sbjct: 155 YENVTGHNVVVAVVDDGLDYESEDLKDNFSAEGSWDFNDNGPMPKPRLSDDYHGTRCAGE 214

Query: 307 IAS---KHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFKGST 363
           IA+   K  G               +   +  D     E A+  H  DV +  S   G  
Sbjct: 215 IAAVKNKACGIGVAYNAKVAGIRILSAEVTAED-----EAASLIHALDVNDIYSCSWGPL 269

Query: 364 ANMSLGGGKSPSLDLAVNAAVKAGIH-------FAVAAGNENQDACNTSP-ASAKYAITV 415
            +  +  G    +  A+   V  G +       FA   G    D CN     ++ Y+ITV
Sbjct: 270 DDGRVLQGPDDLVRKALVTGVTKGRNEKGALYVFASGNGGMYDDNCNYDGYTNSIYSITV 329

Query: 416 GASTLSDDRAYFSNWGKCVDVF----APGLNILSTYIGSDDATATLSGTSMASPHVAGLL 471
           GA         +S     V V       G +I ST I     + T  GTS A+P  AG+ 
Sbjct: 330 GAIDHKGLHPPYSESCSAVMVVTYSSGSGEHIHSTDIHG-KCSDTHGGTSAAAPLAAGVY 388

Query: 472 SYFLSLQP 479
           S  L   P
Sbjct: 389 SLVLEANP 396

>NCAS0F00490 Chr6 (89926..92889) [2964 bp, 987 aa] {ON} Anc_5.85
           YGR240C
          Length = 987

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 3/65 (4%)

Query: 328 SNGSGSMSDVLKGVEYATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAG 387
           +N S S SDV +    A+ S +  +K   SG K     +   GG SP ++ AV A V+ G
Sbjct: 174 ANVSESSSDVSRD---ASLSAINMLKQTLSGQKKKKIAVMTSGGDSPGMNAAVRAVVRTG 230

Query: 388 IHFAV 392
           IHF  
Sbjct: 231 IHFGC 235

>TPHA0P01790 Chr16 complement(373247..375646) [2400 bp, 799 aa] {ON}
           Anc_2.6 YNL238W
          Length = 799

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 98/255 (38%), Gaps = 39/255 (15%)

Query: 253 FDDKAGEGVTAYVIDTGVNVEHND----FEGRASW----GKTIPNNDEDLDGNGHGTHCA 304
           F    G+GV A ++D G++    D    F    SW     K +P     L  + HGT CA
Sbjct: 158 FSGITGKGVVAAIVDDGLDHNSEDLKDNFCEEGSWDFNENKKLPT--PKLIDDYHGTRCA 215

Query: 305 GTIAS---KHYGXXXXXXXXXXXXLRSNGSGSMSDVLKGVEYATASHLADVKNKKSGFKG 361
           G IA+   ++ G               +G  +  D     E A+  +  D+ +  S   G
Sbjct: 216 GEIAAVKNEYCGLGVAYGAKVAGIRILSGQITAED-----EAASLMYGLDINDIFSCSWG 270

Query: 362 STANMSLGGGKSPSLDLAVNAAVKA--------GIHFAVAAGNENQ--DACNTSP-ASAK 410
              +     G S   DL   A +K         G  +  A+GN     D CN     ++ 
Sbjct: 271 PPDDGKHLQGPS---DLVKKAMIKGTQEGRNEKGSIYVFASGNGGHYGDNCNYDGYTNSI 327

Query: 411 YAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILS-TYIGSDDATATLS----GTSMASP 465
           Y+IT+GA         +S    C  V A   +  S  YI S D  +  S    GTS A+P
Sbjct: 328 YSITIGAIDHKGLHPPYSE--SCSAVLAVTYSSGSGEYIHSTDIKSQCSDRHGGTSAAAP 385

Query: 466 HVAGLLSYFLSLQPE 480
             AG+ +  L   PE
Sbjct: 386 LAAGIYALVLEANPE 400

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 10/65 (15%)

Query: 253 FDDKAGEGVTAYVIDTGVNVEHND----FEGRASW----GKTIPNNDEDLDGNGHGTHCA 304
           +++  G GV A ++D G++ E  D    F    SW       +P     LD + HGT CA
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPK--PRLDDDYHGTRCA 211

Query: 305 GTIAS 309
           G IA+
Sbjct: 212 GEIAA 216

>KLLA0D19811g Chr4 complement(1672338..1674608) [2271 bp, 756 aa]
           {ON} uniprot|P09231 Kluyveromyces lactis KLLA0D19811g
           KEX1 protease precursor
          Length = 756

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 94/249 (37%), Gaps = 37/249 (14%)

Query: 257 AGEGVTAYVIDTGVNVEHNDF------EGRASWGKTIPNNDEDLDGNGHGTHCAGTIASK 310
            G GV A ++D G++ E+ D       EG   +    P     L  + HGT CAG IA+ 
Sbjct: 154 TGYGVVAALVDDGLDYENEDLKDNFCVEGSWDFNDNNPLPKPRLKDDYHGTRCAGEIAA- 212

Query: 311 HYGXXXXXXXXXXXXLRSNGSGSMSDVLKGV-----EYATASHLADVKNKKSGFKGSTAN 365
                          +  N   S   +L G      E A+  +  DV +  S   G + +
Sbjct: 213 ------FRNDICGVGVAYNSKVSGIRILSGQITAEDEAASLIYGLDVNDIYSCSWGPSDD 266

Query: 366 MSLGGGKSPSLDLAVNAAVKAGIH-----------FAVAAGNENQDACN-TSPASAKYAI 413
               G    + D  V  A+  G+            FA   G    D+CN     ++ ++I
Sbjct: 267 ----GKTMQAPDTLVKKAIIKGVTEGRDAKGALYVFASGNGGMFGDSCNFDGYTNSIFSI 322

Query: 414 TVGASTLSDDRAYFSNWGKCVDV--FAPGL-NILSTYIGSDDATATLSGTSMASPHVAGL 470
           TVGA         +S     V V  ++ G  N + T    +  + T  GTS A+P  AG+
Sbjct: 323 TVGAIDWKGLHPPYSESCSAVMVVTYSSGSGNYIKTTDLDEKCSNTHGGTSAAAPLAAGI 382

Query: 471 LSYFLSLQP 479
            +  L   P
Sbjct: 383 YTLVLEANP 391

>NDAI0D02620 Chr4 complement(606774..609737) [2964 bp, 987 aa] {ON}
           Anc_5.85
          Length = 987

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%)

Query: 344 ATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAV 392
           A+ S +  +K   +G K     +   GG SP ++ AV A V+ GIHF  
Sbjct: 187 ASTSAINLLKQSLAGQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGC 235

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 29/59 (49%), Gaps = 6/59 (10%)

Query: 257 AGEGVTAYVIDTGVNVEHND----FEGRASWGKTIPNN--DEDLDGNGHGTHCAGTIAS 309
            G+GV A V+D G++ E+ D    F    SW      N     L  + HGT CAG IA+
Sbjct: 156 TGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDYHGTRCAGEIAA 214

>ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKR064W
          Length = 795

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 5/97 (5%)

Query: 128 RYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLDLQQPIIDSFNINS 187
           R+ + F  ++ P E+D   +S+ +L QQ  A + H     + + GL+   PII +    +
Sbjct: 388 RFTMAFA-EMEPGEVDSANESVVKLYQQIWAVVLHWDRNVSMLTGLE---PIIGTSMKPA 443

Query: 188 LLQGYIGYFTDDV-IDFIRLNPLVQFVEQDSTVNINE 223
            +  Y  ++ D + +D+++   L +  E  S VN+ E
Sbjct: 444 AMSSYNNWYADMISLDYLKWQLLTRINEDPSEVNLEE 480

>Kpol_1050.72 s1050 complement(157470..160439) [2970 bp, 989 aa]
           {ON} complement(157470..160439) [2970 nt, 990 aa]
          Length = 989

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 358 GFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAV 392
           G K   A M+  GG SP ++ AV A V+AGIH+  
Sbjct: 204 GIKKKLAVMT-SGGDSPGMNAAVRAVVRAGIHYGC 237

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 10/65 (15%)

Query: 253 FDDKAGEGVTAYVIDTGVNVEHND----FEGRASW----GKTIPNNDEDLDGNGHGTHCA 304
           +++  G GV A ++D G++ E  D    F    SW       +P     L  + HGT CA
Sbjct: 154 YNNITGHGVVAAIVDDGLDYESEDLKDNFCAEGSWDFNANTALPK--PILGDDNHGTRCA 211

Query: 305 GTIAS 309
           G IA+
Sbjct: 212 GEIAA 216

>TDEL0G01090 Chr7 (223036..225987) [2952 bp, 983 aa] {ON} Anc_5.85
           YGR240C
          Length = 983

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 352 VKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAV 392
           ++   SG K     +   GG SP ++ AV A V+ GIHF  
Sbjct: 192 LRQTLSGQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGC 232

>TPHA0A05200 Chr1 complement(1168851..1171826) [2976 bp, 991 aa]
           {ON} Anc_5.85 YGR240C
          Length = 991

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 353 KNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAV 392
           K+K    K   A M+  GG SP ++ AV A V+ GIH+  
Sbjct: 203 KSKNGSIKKKIAVMT-SGGDSPGMNAAVRAVVRTGIHYGC 241

>Ecym_2019 Chr2 (28247..29518) [1272 bp, 423 aa] {ON} similar to
           Ashbya gossypii ADL191W
          Length = 423

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%)

Query: 125 IPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEGLDLQQPIIDS 182
           I ++  I F   +A   +      I E+ Q+   +L H    FN++EGL L Q +I++
Sbjct: 49  INNKQYIDFTSGIAVASLGHANPKIAEVIQKQSTKLLHTSNLFNNIEGLQLCQSLIET 106

>ABL203W Chr2 (26256..28562) [2307 bp, 768 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL238W (KEX2)
          Length = 768

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 91/247 (36%), Gaps = 35/247 (14%)

Query: 258 GEGVTAYVIDTGVNVEHND----FEGRASW----GKTIPNNDEDLDGNGHGTHCAGTIAS 309
           G G+   V+D G++ E  D    F    SW       +P     L  + HGT CAG IA+
Sbjct: 156 GHGIVVAVVDDGLDYESEDLKDNFCAEGSWDFNSNTALPK--PMLSDDTHGTRCAGEIAA 213

Query: 310 KHYGXXXXXXXXXXXXLRSNGSGSM---SDVLKGVEYATASHLADVKNKKSGFKGSTANM 366
                             S  SG      D+    E A+  +  D+ +  S   G T N 
Sbjct: 214 -----AKNQFCGLGVAFNSKVSGIRILSEDITPEDEAASLVYGLDINDIYSCSWGPTDNG 268

Query: 367 SLGGGKSPSLDLAVNAAV-----KAGIHFAVAAGNENQ--DACNTSP-ASAKYAITVGAS 418
                 S  +  A+   V     + G  +  A+GN     D CN     ++ Y+ITV A 
Sbjct: 269 EELQAPSDLVKKAIIRGVTEGRDRKGALYVFASGNGGALGDNCNYDGYTNSIYSITVSA- 327

Query: 419 TLSDDRAYFSNWGK-CVDVFAPGLNILS-TYIGSDDATATL----SGTSMASPHVAGLLS 472
              D R     + + C  V     +  S  +I + D          GTS A+P  AG+ +
Sbjct: 328 --LDHRGLHPTYAESCSAVLVVAHSSGSGNFIRTTDVNGQCFDHHGGTSAAAPLAAGVYA 385

Query: 473 YFLSLQP 479
             L + P
Sbjct: 386 LLLQVNP 392

>NDAI0H02910 Chr8 complement(711397..713661) [2265 bp, 754 aa] {ON}
           Anc_2.394 YMR137C
          Length = 754

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%)

Query: 187 SLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNINEFDTQNGAPWGLARISHRERLNLG 246
           S LQ     F    +D   LNPL +F  Q S VNI     +N    GL +  + E+ ++ 
Sbjct: 439 SKLQKQFKKFDAVYLDTTYLNPLYEFPNQKSVVNITSQFAKNVTQMGLKKFFNNEQKSIM 498

Query: 247 SF 248
           S+
Sbjct: 499 SY 500

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,432,719
Number of extensions: 2656108
Number of successful extensions: 5476
Number of sequences better than 10.0: 100
Number of HSP's gapped: 5438
Number of HSP's successfully gapped: 102
Length of query: 573
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 458
Effective length of database: 40,294,809
Effective search space: 18455022522
Effective search space used: 18455022522
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)