Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A072906.15ON25925911861e-166
KLLA0D01023g6.15ON2681866353e-82
Kpol_1045.746.15ON2571776249e-81
CAGL0E02673g6.15ON2632806189e-80
KAFR0A050606.15ON2692136153e-79
TPHA0J002806.15ON2712596153e-79
ZYRO0C07920g6.15ON2931776149e-79
KLTH0C11352g6.15ON2682126102e-78
Skud_15.1656.15ON2572096073e-78
KNAG0F028806.15ON2691795981e-76
ACR011C6.15ON2532125961e-76
Suva_15.1796.15ON2592095943e-76
SAKL0E01056g6.15ON2691775945e-76
Smik_15.1736.15ON2511745901e-75
NCAS0D026606.15ON2611775866e-75
Kwal_56.223996.15ON2742185868e-75
NDAI0I022506.15ON2711775842e-74
Ecym_30196.15ON2661795753e-73
YOR004W (UTP23)6.15ON2542535535e-70
TDEL0G045406.15ON2451745455e-69
ZYRO0A06754g5.392ON1891481643e-13
CAGL0M01056g5.392ON1891461601e-12
Kwal_55.200895.392ON1891461602e-12
KLTH0E02860g5.392ON1891461592e-12
KNAG0C052705.392ON1891461582e-12
TPHA0D023105.392ON1891461583e-12
Kpol_1055.185.392ON1891461573e-12
AEL102W5.392ON1891461565e-12
TDEL0E023305.392ON1891461556e-12
KAFR0D042805.392ON1891461557e-12
NDAI0C045505.392ON1891461549e-12
NCAS0F030905.392ON1891461531e-11
SAKL0G07766g5.392ON1891461531e-11
Ecym_74695.392ON1891461531e-11
YDR339C (FCF1)5.392ON1891461522e-11
TBLA0H017505.392ON1891461512e-11
Skud_4.6065.392ON1891461512e-11
Smik_4.5995.392ON1891461512e-11
Suva_2.5095.392ON1891461513e-11
KLLA0A07018g5.392ON1891431372e-09
Ecym_13651.455ON140041668.3
ZYRO0D06622gna 1ON20545649.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07290
         (259 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6....   461   e-166
KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar t...   249   3e-82
Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {...   244   9e-81
CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar...   242   9e-80
KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {...   241   3e-79
TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15 ...   241   3e-79
ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {O...   241   9e-79
KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {O...   239   2e-78
Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W...   238   3e-78
KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON...   234   1e-76
ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON} Sy...   234   1e-76
Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W...   233   3e-76
SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar t...   233   5e-76
Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W...   231   1e-75
NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON...   230   6e-75
Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W...   230   8e-75
NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15...   229   2e-74
Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to A...   226   3e-73
YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}  UTP23Compo...   217   5e-70
TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON...   214   5e-69
ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly ...    68   3e-13
CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly...    66   1e-12
Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C...    66   2e-12
KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly ...    66   2e-12
KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5....    65   2e-12
TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON...    65   3e-12
Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON...    65   3e-12
AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic hom...    65   5e-12
TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.39...    64   6e-12
KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.39...    64   7e-12
NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {...    64   9e-12
NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON...    64   1e-11
SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly ...    64   1e-11
Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON} ...    64   1e-11
YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON} ...    63   2e-11
TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.39...    63   2e-11
Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {O...    63   2e-11
Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {O...    63   2e-11
Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}...    63   3e-11
KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {O...    57   2e-09
Ecym_1365 Chr1 complement(748590..752792) [4203 bp, 1400 aa] {ON...    30   8.3  
ZYRO0D06622g Chr4 (574866..575483) [618 bp, 205 aa] {ON} no simi...    29   9.3  

>TBLA0A07290 Chr1 (1814724..1815503) [780 bp, 259 aa] {ON} Anc_6.15
           YOR004W
          Length = 259

 Score =  461 bits (1186), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 229/259 (88%), Positives = 229/259 (88%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK
Sbjct: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
           PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI
Sbjct: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKASV 180
           VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKASV
Sbjct: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKASV 180

Query: 181 EGGQENGIXXXXXXGVNPLSMXXXXXXXXXXXXXXXXXXXXXXXXIKHERDNENATDQPA 240
           EGGQENGI      GVNPLSM                        IKHERDNENATDQPA
Sbjct: 181 EGGQENGIKKKKVKGVNPLSMKKKSNSNSNSNSNSNSNSKPKPKPIKHERDNENATDQPA 240

Query: 241 KKRRKRKHTSNANAKKSEE 259
           KKRRKRKHTSNANAKKSEE
Sbjct: 241 KKRRKRKHTSNANAKKSEE 259

>KLLA0D01023g Chr4 (89887..90693) [807 bp, 268 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 268

 Score =  249 bits (635), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 145/186 (77%), Gaps = 2/186 (1%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAKSY+KQ++VYNHTFKFR+PYQV++DD LV ET  + ++ +KGL   L +   +K
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFRQPYQVLVDDQLVLETFNSSFDFVKGLQRTLQAE--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
           PMITQCC+ +LY++ +Q +I  GK FERRRCNH  KEP S  EC+ S+VDVNGKNKHRY+
Sbjct: 59  PMITQCCMQSLYQTNNQGAIDAGKQFERRRCNHDPKEPKSVLECLTSVVDVNGKNKHRYV 118

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKASV 180
           VATQD+E+RR+LRKIPGVPL++  RSVMVMEPLS+AS + + EVE +KL  GLN  K + 
Sbjct: 119 VATQDVEIRRRLRKIPGVPLVYMNRSVMVMEPLSNASEKVSREVEEQKLYKGLNDPKFAG 178

Query: 181 EGGQEN 186
               EN
Sbjct: 179 IARDEN 184

>Kpol_1045.74 s1045 complement(173724..174497) [774 bp, 257 aa] {ON}
           complement(173726..174499) [774 nt, 258 aa]
          Length = 257

 Score =  244 bits (624), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 144/177 (81%), Gaps = 2/177 (1%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQ+RAKSY+KQ++VYNHTFKFREPYQ I+DD LV +  ++K++++KGL   L +   +K
Sbjct: 1   MRQRRAKSYRKQMLVYNHTFKFREPYQAIVDDQLVLDCCQSKFDILKGLKRTLQAE--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
            MITQCC+ ALYK+++QE+ISI K FERRRCNH  K+P SP EC+ SIVD+ G NKHRY+
Sbjct: 59  VMITQCCMQALYKTDNQEAISIAKEFERRRCNHPPKDPKSPLECIESIVDIKGSNKHRYV 118

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK 177
           VA+QD+++RRKLRKIPGVP++H  R+VM++EPLSDAS + +E +E  KL  GLN +K
Sbjct: 119 VASQDMDIRRKLRKIPGVPIVHVSRAVMILEPLSDASLKISERLEKDKLYKGLNDSK 175

>CAGL0E02673g Chr5 (253705..254496) [792 bp, 263 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004w
          Length = 263

 Score =  242 bits (618), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 132/280 (47%), Positives = 172/280 (61%), Gaps = 40/280 (14%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAKSY+KQL+VYNHTFKFREPYQV++DD +V ++  +KY+L+K L   L +   +K
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFREPYQVLLDDQIVMDSTTSKYDLVKALKRTLQAE--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
           PMITQCC+ ALY+++++ +I +GK FERRRC H   E +SP EC+L++VDV GKNKHRY+
Sbjct: 59  PMITQCCMQALYETKNEHAIDLGKEFERRRCGHMPGEAVSPKECILNVVDVKGKNKHRYV 118

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK-AS 179
           VA QD+E+RR LRK+PGVPL+H  RSVM+MEPLSDAS + +   E  KL  GLN  K A 
Sbjct: 119 VACQDVEIRRLLRKVPGVPLLHISRSVMIMEPLSDASAKVSRMEEESKLFRGLNDPKYAG 178

Query: 180 VEG-------GQENGIXXXXXXGV---NPLSMXXXXXXXXXXXXXXXXXXXXXXXXIKHE 229
           ++G        +E  +      G    NPLSM                           E
Sbjct: 179 LKGEHEEEEQSKEQTVAKKRKIGPKQPNPLSMKKKKKENTKK-----------------E 221

Query: 230 RDNENATDQ--PAKKRRKRKH--------TSNANAKKSEE 259
           +  E + DQ  P K+RR RKH         +N N   SEE
Sbjct: 222 QQTETSADQSQPTKRRRSRKHKHGSKNSTDTNENGNLSEE 261

>KAFR0A05060 Chr1 complement(1006556..1007365) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  241 bits (615), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 112/213 (52%), Positives = 153/213 (71%), Gaps = 14/213 (6%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAKSY+KQL+VY+HTFKFREPYQV++D+ +V  +  + ++L+KGL   L +   +K
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNEIVTVSSNSNFDLVKGLKRTLQAE--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
           PMITQCC+ ALY++ DQ +I + K FERRRCNH  KEP +P EC+LS+V+VNGKNKHRY+
Sbjct: 59  PMITQCCMQALYETRDQNAIDMAKGFERRRCNHPPKEPKTPIECVLSVVNVNGKNKHRYV 118

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK--- 177
           VA+QD+++RR+LR++PGVPL+H  RSVM+MEPLSD S + +  +E +KL  GLN  K   
Sbjct: 119 VASQDIDIRRQLRRVPGVPLVHISRSVMIMEPLSDTSAKISSRMEQEKLYKGLNDPKYAG 178

Query: 178 --------ASVEG-GQENGIXXXXXXGVNPLSM 201
                      +G G++         G NPLS+
Sbjct: 179 LKLDEEEATETQGSGEKTAKKKRGPKGPNPLSV 211

>TPHA0J00280 Chr10 (63865..64680) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  241 bits (615), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 121/259 (46%), Positives = 164/259 (63%), Gaps = 9/259 (3%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAKSYKKQ++VYNHTFKFREPYQ+++D+ +VQ++  + YNL + L   L + N IK
Sbjct: 1   MRQKRAKSYKKQMVVYNHTFKFREPYQILVDEQIVQDSFESNYNLYRNLRKTLQAEN-IK 59

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
            MITQCC+  LY + +QE I   K FERRRCNHS+K+P  P EC+ SIV+++G+NKHRY+
Sbjct: 60  VMITQCCMQKLYTTSNQELIDEAKRFERRRCNHSIKDPKEPLECIESIVNIDGQNKHRYV 119

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKASV 180
           VATQ++ELRRKLR++PGVP++H  RSVM+MEP+SD+S   N + E  KL  GLN  K S+
Sbjct: 120 VATQNMELRRKLRRVPGVPILHLSRSVMIMEPISDSSVRLNRKFEQSKLYKGLNDPKYSM 179

Query: 181 EGGQENGIXXXXXXGVNPLSMXXXXXXXXXXXXXXXXXXXXXXXXIKHERDNENATDQPA 240
               + G       G  P +                         ++  +     TD  A
Sbjct: 180 APTPKEGT--PDTEGTQPAAT-----KKRKGVKEPNPLSKKKKVKVEIPKPAATTTDA-A 231

Query: 241 KKRRKRKHTSNANAKKSEE 259
            K+R+RKH SN N++   E
Sbjct: 232 NKKRRRKHRSNKNSENGNE 250

>ZYRO0C07920g Chr3 complement(603790..604671) [882 bp, 293 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 293

 Score =  241 bits (614), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 139/177 (78%), Gaps = 2/177 (1%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAKSYKKQ++VYN+ F+FREPYQV+IDD LV +  ++ Y+L+ GL   L +   +K
Sbjct: 1   MRQKRAKSYKKQMLVYNYAFRFREPYQVLIDDQLVSDCQKSHYDLVGGLKRTLQAE--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
           PMITQCC+ ALY +++Q++I +GK+FERRRCNH  KE   P EC+ S+V+VNG NKHRY+
Sbjct: 59  PMITQCCMQALYFTKNQDAIELGKSFERRRCNHPPKEAKPPHECIQSVVNVNGSNKHRYV 118

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK 177
           VA+QD+ LRRKLRK+PGVPLIH  RSVMVMEPLS+AS   NE  E +KL  GLN  K
Sbjct: 119 VASQDVTLRRKLRKVPGVPLIHMSRSVMVMEPLSEASSRVNEMSEREKLLKGLNDPK 175

>KLTH0C11352g Chr3 complement(934886..935692) [807 bp, 268 aa] {ON}
           similar to uniprot|Q12339 Saccharomyces cerevisiae
           YOR004W Protein required for cell viability
          Length = 268

 Score =  239 bits (610), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 116/212 (54%), Positives = 153/212 (72%), Gaps = 13/212 (6%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAKSY+KQ++VYNH FKFREPYQV++DD +V +T RA ++L+KGL   L +   +K
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHRASFDLVKGLQRTLQAE--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
           PMITQCCI A+Y++++Q++I + K+FERRRCNH  KE   P EC+ S+V VNG NKHRY+
Sbjct: 59  PMITQCCIQAIYETKNQDAIELAKSFERRRCNHPPKEAKPPIECLQSVVSVNGNNKHRYV 118

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK--- 177
           VA+QD  +R+KLR++PGVPLI+  RSVMVMEPLS AS +++   E +KL  GLN  K   
Sbjct: 119 VASQDPSIRKKLRQVPGVPLIYMNRSVMVMEPLSKASGDFSRAQEKEKLFKGLNDPKYAG 178

Query: 178 --ASVEGGQ-ENGIXXXX-----XXGVNPLSM 201
             A  EGG+ +NG            G NPLS+
Sbjct: 179 LPAEEEGGKTDNGTEVSKNKRKGPKGPNPLSI 210

>Skud_15.165 Chr15 (293629..294402) [774 bp, 257 aa] {ON} YOR004W
           (REAL)
          Length = 257

 Score =  238 bits (607), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 116/209 (55%), Positives = 150/209 (71%), Gaps = 10/209 (4%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAKSY+KQL+VY+HTFKFREPYQV++D+ LV E   + +NL  GL   L +   +K
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFNLPSGLKRTLQAD--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
            MITQCCI ALY++ ++ +I + K FERRRCNHS K+P SP+EC+ S+VDVNG NKHRY+
Sbjct: 59  VMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVDVNGANKHRYV 118

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLN------ 174
           VA+QD+ LRRKLR +PGVPLIH  RSVM+MEPLS AS + +++ E +KL  GLN      
Sbjct: 119 VASQDIHLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKESKKTEEQKLFKGLNDPNVEK 178

Query: 175 STKASVEGGQENGIXXXX--XXGVNPLSM 201
           + K S E G+E+            NPLS+
Sbjct: 179 TEKVSSESGKESAPKKRKIGPKAPNPLSV 207

>KNAG0F02880 Chr6 complement(546147..546956) [810 bp, 269 aa] {ON}
           Anc_6.15 YOR004W
          Length = 269

 Score =  234 bits (598), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 141/179 (78%), Gaps = 2/179 (1%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAKSY+KQL+VYNHTF+FREPYQVI+DD +V +   +K++L K L   + +   +K
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQVILDDEIVLQATESKFDLYKALQRTVQAE--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
            MITQCC+ ALY + ++++I + K +ERRRCNH  K+P SP EC+ S+VD+ G+NKHRYI
Sbjct: 59  LMITQCCMQALYATNNRQAIDMAKRYERRRCNHPPKDPKSPFECIESVVDIKGENKHRYI 118

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKAS 179
           VA Q+++LRRKLR++PGVPLIH  R+VM+MEPLSDAS   ++ +E +KL SGLN  KA+
Sbjct: 119 VACQNIDLRRKLRRVPGVPLIHVSRAVMIMEPLSDASARISKRMEQQKLFSGLNDAKAA 177

>ACR011C Chr3 complement(377334..378095) [762 bp, 253 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR004W
          Length = 253

 Score =  234 bits (596), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 114/212 (53%), Positives = 151/212 (71%), Gaps = 14/212 (6%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAK+YKKQ++VYNHTFKFREPYQV++DD +V ET ++ ++L+KGL   L +   +K
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFREPYQVLVDDQIVLETNKSSFDLLKGLKRTLQAE--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
           PMITQCC+  LY +++Q++I+ GK +ERRRCNH VKEP  P EC+ S+V VNG+N+HRYI
Sbjct: 59  PMITQCCMQKLYDTKNQDAIAQGKLYERRRCNH-VKEPKEPIECLQSVVAVNGQNRHRYI 117

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK--- 177
           VA+QD+ +RR LRK+PGVPL++  R+VMVMEPLS  S + + E E +KL  GLN  K   
Sbjct: 118 VASQDIAIRRALRKVPGVPLVYINRAVMVMEPLSSTSEQVSREAEKQKLFKGLNDPKYTG 177

Query: 178 ----ASVEGGQ-ENGIXXXXXXG---VNPLSM 201
               ++  G Q   G       G    NPLSM
Sbjct: 178 IAENSAPAGAQPAEGAPTLKRKGPKAPNPLSM 209

>Suva_15.179 Chr15 (308047..308826) [780 bp, 259 aa] {ON} YOR004W
           (REAL)
          Length = 259

 Score =  233 bits (594), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 148/209 (70%), Gaps = 10/209 (4%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAKSY+KQL+VY+HTFKFREPYQV++D+ LV E   + ++L  GL   L +   +K
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVSECSGSNFDLPSGLKRTLQAD--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
            MITQCCI ALY++ ++ +I + K FERRRCNHS K+P SP+EC+ S+V+VNG NKHRY+
Sbjct: 59  VMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPAECIESVVNVNGANKHRYV 118

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNS----- 175
           VA+QD++LRRKLR +PGVPLIH  RSVM+MEPLS AS + +   E +KL  GLN      
Sbjct: 119 VASQDIDLRRKLRTVPGVPLIHLTRSVMIMEPLSTASAKASRMTEEQKLYKGLNDPNIEK 178

Query: 176 TKASVEGGQENGIXXXXXXG---VNPLSM 201
            +A  +G ++         G    NPLSM
Sbjct: 179 AEAISKGSEKESTPKKRKAGPKAPNPLSM 207

>SAKL0E01056g Chr5 (79518..80327) [810 bp, 269 aa] {ON} similar to
           uniprot|Q12339 Saccharomyces cerevisiae YOR004W Protein
           required for cell viability
          Length = 269

 Score =  233 bits (594), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 106/177 (59%), Positives = 139/177 (78%), Gaps = 2/177 (1%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAKSY+KQ++VYNHTFKFREPYQV++DD +V  T ++ ++L KGL   L +   +K
Sbjct: 1   MRQKRAKSYRKQMLVYNHTFKFREPYQVLVDDQIVMGTYKSSFDLAKGLKRTLQAE--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
           PMITQCC+ ALY ++DQ +I + KT+ERRRCNH  KE  +  EC+ S+V+ NGKNKHRY+
Sbjct: 59  PMITQCCMQALYATKDQGAIEMAKTYERRRCNHPPKESKTSLECIESVVNFNGKNKHRYV 118

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK 177
           VATQD+++RRKLR++PGVPLI+  RSVMVMEPLS+AS   ++  E +KL  GLN  K
Sbjct: 119 VATQDIDIRRKLRRVPGVPLIYMNRSVMVMEPLSEASERLSKVREEEKLFKGLNDPK 175

>Smik_15.173 Chr15 (300941..301696) [756 bp, 251 aa] {ON} YOR004W
           (REAL)
          Length = 251

 Score =  231 bits (590), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 106/174 (60%), Positives = 136/174 (78%), Gaps = 2/174 (1%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAKSY+KQL+VY+HTFKFREPYQV++D+ LV E   + +NL  GL   L +   +K
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNGSNFNLPSGLKRTLQAD--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
            MITQCCI ALY++ ++ +I + K FERRRCNHS K+P SP++C+ S+VD+NG NKHRY+
Sbjct: 59  VMITQCCIQALYETRNEGAIDLAKQFERRRCNHSFKDPKSPADCIESVVDINGANKHRYV 118

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLN 174
           VA+QD+ LRRKLR +PGVPLIH  RSVMVMEPLS AS + ++  E +KL  GLN
Sbjct: 119 VASQDIGLRRKLRNVPGVPLIHLTRSVMVMEPLSTASAKASKMTEERKLYKGLN 172

>NCAS0D02660 Chr4 complement(511544..512329) [786 bp, 261 aa] {ON}
           Anc_6.15
          Length = 261

 Score =  230 bits (586), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 141/177 (79%), Gaps = 2/177 (1%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAKSY+KQL+VYNHTF+FREPYQ+++D+ +V +   + Y+L KGL+  L +   +K
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFRFREPYQILVDNQIVTDCSTSNYDLEKGLHRTLQAE--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
            MITQCC+ ALY++ DQ +I + + FERRRCNH+ K+P +P EC+ S+V++NG+NKHRY+
Sbjct: 59  VMITQCCMQALYEANDQNAIELARRFERRRCNHNPKDPKTPIECIESVVNINGQNKHRYV 118

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK 177
           VA QD+ +RRKLR++PGVPL+H  R+VM+MEPLSDAS + ++  E++KL  GLN  K
Sbjct: 119 VAAQDVAIRRKLRQVPGVPLVHISRAVMIMEPLSDASAKVSKRKENEKLYKGLNDPK 175

>Kwal_56.22399 s56 (111021..111845) [825 bp, 274 aa] {ON} YOR004W -
           Protein required for cell viability [contig 185] FULL
          Length = 274

 Score =  230 bits (586), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 115/218 (52%), Positives = 147/218 (67%), Gaps = 19/218 (8%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAKSY+KQ++VYNH FKFREPYQV++DD +V +T +A ++L+KGL   L +   +K
Sbjct: 1   MRQKRAKSYRKQMLVYNHNFKFREPYQVLVDDQIVCDTHKAAFDLVKGLKRTLQAE--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
           PMITQCCI A+Y++ DQE+I + K+FERRRCNH  KE   P EC+ S+V+VNG NKHRY+
Sbjct: 59  PMITQCCIQAIYETNDQEAIELAKSFERRRCNHPPKEAKPPLECLQSVVNVNGVNKHRYV 118

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLN------ 174
           VATQ+ E+R  LRK+PGVPL+   RSVMVMEPLS AS   +   E +KL  GLN      
Sbjct: 119 VATQNQEIRGCLRKVPGVPLVFMNRSVMVMEPLSKASQNVSRVQEREKLFKGLNDPKFAG 178

Query: 175 ---------STKASV--EGGQENGIXXXXXXGVNPLSM 201
                    +T A+V  EG            G NPLS+
Sbjct: 179 LPLTEQPATATAATVDKEGAGAPAKKRKGPKGPNPLSI 216

>NDAI0I02250 Chr9 (513792..514607) [816 bp, 271 aa] {ON} Anc_6.15
           YOR004W
          Length = 271

 Score =  229 bits (584), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 137/177 (77%), Gaps = 2/177 (1%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAKSY+KQL+VYNHTFKFR PYQV++D+ +V +   + Y+L KGL N L S   +K
Sbjct: 1   MRQKRAKSYRKQLLVYNHTFKFRAPYQVLVDNQIVLDCSNSNYDLAKGLKNTLQSE--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
            MITQCC+ ALY+  +Q++I + + FERRRCNH+ KEP +  EC+ S+V++NG+NKHRY+
Sbjct: 59  VMITQCCMQALYEENNQDAIELARRFERRRCNHNPKEPKTAIECIESVVNINGQNKHRYV 118

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTK 177
           VA+QDL  RRKLR++PGVPLIH  R+VM+MEPLSD S + +   E++KL  GLN  K
Sbjct: 119 VASQDLATRRKLRQVPGVPLIHISRAVMIMEPLSDVSAQVSRRKENEKLYKGLNDPK 175

>Ecym_3019 Chr3 (36286..37086) [801 bp, 266 aa] {ON} similar to
           Ashbya gossypii ACR011C
          Length = 266

 Score =  226 bits (575), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 107/179 (59%), Positives = 144/179 (80%), Gaps = 3/179 (1%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAK+YKKQ++VYNHTFKFR+PYQV++DD LV ET ++ ++L+KGL   L +   +K
Sbjct: 1   MRQKRAKAYKKQMLVYNHTFKFRQPYQVLVDDQLVLETNKSSFDLLKGLKRTLQAE--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
           PMITQCC+  LY+S++Q +I+  K +ERRRCNH  KEP  PSEC+ S+VD+NG+N HRY+
Sbjct: 59  PMITQCCVQKLYESKNQGAIAQAKMYERRRCNH-YKEPKEPSECIRSVVDINGRNLHRYV 117

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKAS 179
           VATQD+E+RR LR++PGVPLI+  RSVMVMEPLS  S + +++VE++KL  GLN  K +
Sbjct: 118 VATQDIEIRRILRRVPGVPLIYMNRSVMVMEPLSSNSQQVSQQVENEKLVKGLNDPKYA 176

>YOR004W Chr15 (333592..334356) [765 bp, 254 aa] {ON}
           UTP23Component of the small subunit processome, involved
           in 40S ribosomal subunit biogenesis; interacts with
           snR30 and is required for dissociation of snR30 from
           large pre-ribosomal particles; has homology to PINc
           domain protein Fcf1p, although the PINc domain of Utp23p
           is not required for function; essential protein
          Length = 254

 Score =  217 bits (553), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 123/253 (48%), Positives = 163/253 (64%), Gaps = 10/253 (3%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAKSY+KQL+VY+HTFKFREPYQV++D+ LV E   + +NL  GL   L +   +K
Sbjct: 1   MRQKRAKSYRKQLLVYSHTFKFREPYQVLVDNQLVLECNNSNFNLPSGLKRTLQAD--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
            MITQCCI ALY++ +  +I++ K FERRRCNHS K+P SP+EC+ S+V+++G NKHRY+
Sbjct: 59  VMITQCCIQALYETRNDGAINLAKQFERRRCNHSFKDPKSPAECIESVVNISGANKHRYV 118

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKASV 180
           VA+QD++LRRKLR +PGVPLIH  RSVMVMEPLS AS + ++  E +KL  GLN    ++
Sbjct: 119 VASQDIDLRRKLRTVPGVPLIHLTRSVMVMEPLSTASAKASKITEEQKLYKGLND--PNI 176

Query: 181 EGGQENGIXXXXXXGVNPLSMXXXXXXXXXXXXXXXXXXXXXXXXIKHERDNENATDQPA 240
           E  QE+G       G    S+                           E  ++  T +  
Sbjct: 177 EKLQESG------DGSGKESITKKRKLGPKAPNPLSVKKKKKVNSPSDEVKDKEDTSKEK 230

Query: 241 KKRRKRKHTSNAN 253
           KKRR+RKH SN N
Sbjct: 231 KKRRRRKHKSNTN 243

>TDEL0G04540 Chr7 complement(828055..828792) [738 bp, 245 aa] {ON}
           Anc_6.15 YOR004W
          Length = 245

 Score =  214 bits (545), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 134/174 (77%), Gaps = 2/174 (1%)

Query: 1   MRQKRAKSYKKQLIVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIK 60
           MRQKRAK+Y+KQ++VYNHTFKFREPYQV++D+ +V +   + ++L+KGL   L +   +K
Sbjct: 1   MRQKRAKAYRKQMLVYNHTFKFREPYQVLVDNQIVLDCHGSNFDLVKGLQRTLQAE--VK 58

Query: 61  PMITQCCISALYKSEDQESISIGKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHRYI 120
            MITQCC+ ALY++  Q +I + KTFERRRCNH  KEP  P EC+ SIV VNG NKHRY+
Sbjct: 59  VMITQCCMQALYETNKQGAIELAKTFERRRCNHPPKEPKPPIECLESIVCVNGHNKHRYV 118

Query: 121 VATQDLELRRKLRKIPGVPLIHFKRSVMVMEPLSDASCEYNEEVESKKLTSGLN 174
           VA+QD++ RR LR+ PGVPL+H  RSVMVMEPLSDAS + +   E++KL  GLN
Sbjct: 119 VASQDIDTRRILRRTPGVPLVHTVRSVMVMEPLSDASAKVSSAAEAEKLHKGLN 172

>ZYRO0A06754g Chr1 (550964..551533) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 67.8 bits (164), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 77/148 (52%), Gaps = 15/148 (10%)

Query: 14  IVYNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYK 73
           + + +    R PYQV+ID   +  +++ K +++KG+ + L +     P+IT C ++ L K
Sbjct: 51  LFFQYNQAIRPPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAK--CNPLITDCVMAELEK 108

Query: 74  SEDQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLEL 128
              +  I++        +R  C H   +     +C+     VN   +H+ YIVAT D  L
Sbjct: 109 LGPKYRIALKLARDPRIKRLSCTH---KGTYADDCL-----VNRVMQHKCYIVATNDAPL 160

Query: 129 RRKLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++++RKIPG+PL+       V+E L DA
Sbjct: 161 KQRVRKIPGIPLMSVGGHSYVIEKLPDA 188

>CAGL0M01056g Chr13 (117010..117579) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339c
          Length = 189

 Score = 66.2 bits (160), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 75/146 (51%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K +++KG+ + L +     P+IT C I+ L K  
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAK--CNPLITDCVIAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C H   +     +C+     VN   +H+ YIVAT D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLTCTH---KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RKIPG+PL+       V+E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>Kwal_55.20089 s55 (245372..245941) [570 bp, 189 aa] {ON} YDR339C -
           Protein required for cell viability [contig 154] FULL
          Length = 189

 Score = 66.2 bits (160), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 76/146 (52%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K +L++G+ + L +     P+IT C ++ L K  
Sbjct: 55  YNQAIK--PPYQVLIDTNFINFSIQKKIDLVRGMMDTLLAKCI--PLITDCVMAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H   +     +C+     VN   +H+ YIVAT D  L++
Sbjct: 111 PKYRIALKLARDPRIQRLSCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RK+PG+PL+       V+E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPDV 188

>KLTH0E02860g Chr5 (258370..258939) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 76/146 (52%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K ++++G+ + L +     PMIT C ++ L K  
Sbjct: 55  YNQAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDTLLAKCI--PMITDCVMAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H   +     +C+     VN   +H+ YIVAT D  L++
Sbjct: 111 PKYRIALKLARDPRIQRLTCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RK+PG+PL+       V+E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHAYVIEKLPDV 188

>KNAG0C05270 Chr3 (1028377..1028946) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 65.5 bits (158), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 76/146 (52%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K ++++G+ + L +     P+IT C I+ L K  
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAK--CNPLITDCVIAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H   +     +C+     VN   +H+ YIVAT D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RKIPG+PL+       V+E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>TPHA0D02310 Chr4 complement(478545..479114) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 65.5 bits (158), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 77/146 (52%), Gaps = 19/146 (13%)

Query: 20  FKF----REPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           F+F    R PYQV+ID   +  +++ K ++IKG+ + L +     P+IT C ++ L K  
Sbjct: 53  FQFNEAIRPPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAK--CNPLITDCVMAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H   +     +C+     VN   +H+ YIVAT D  L++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCYIVATNDQGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RKIPG+PL+       V+E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHAYVIEKLPDV 188

>Kpol_1055.18 s1055 complement(40805..41374) [570 bp, 189 aa] {ON}
           complement(40805..41374) [570 nt, 190 aa]
          Length = 189

 Score = 65.1 bits (157), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 77/146 (52%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K ++IKG+ + L +     P+IT C ++ L K  
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIIKGMMDCLLAK--CNPLITDCVMAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H   +     +C+     VN   +H+ YIVAT D+ L++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCYIVATNDVGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RK+PG+PL+       V+E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>AEL102W Chr5 (436582..437151) [570 bp, 189 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR339C
          Length = 189

 Score = 64.7 bits (156), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 76/146 (52%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K +L++G+ + L +     P+IT C ++ L K  
Sbjct: 55  YNQAIK--PPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAKCV--PLITDCVMAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H   +     +C+     VN   +H+ YIVAT D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLNCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RK+PG+PL+       V+E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>TDEL0E02330 Chr5 (455296..455865) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 64.3 bits (155), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 75/146 (51%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K +L++G+ + L +     P+IT C ++ L K  
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAK--CNPLITDCVMAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C H   +     +C+     VN   +H+ YIVAT D  L++
Sbjct: 111 PKFRIALKLARDPRIKRLSCTH---KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RKIPG+PL+        +E L DA
Sbjct: 163 RVRKIPGIPLMSVGGHAYAIEKLPDA 188

>KAFR0D04280 Chr4 (842029..842598) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 64.3 bits (155), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 76/146 (52%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K ++++G+ + L +     P+IT C I+ L K  
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAK--CNPLITDCVIAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H   +     +C+     VN   +H+ YIVAT D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RKIPG+PL+       V+E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>NDAI0C04550 Chr3 complement(1031852..1032421) [570 bp, 189 aa] {ON}
           Anc_5.392
          Length = 189

 Score = 63.9 bits (154), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 76/146 (52%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K +L++G+ + L +     P+IT C ++ L K  
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDLVRGMMDCLLAK--CNPLITDCVMAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H   +     +C+     VN   +H+ YIVAT D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RKIPG+PL+       V+E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>NCAS0F03090 Chr6 complement(616705..617274) [570 bp, 189 aa] {ON}
           Anc_5.392 YDR339C
          Length = 189

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 76/146 (52%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K +L+KG+ + L +     P+IT C ++ L K  
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDLVKGMMDCLLAK--CNPLITDCVMAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H   +     +C+     VN   +H+ +IVAT D  L++
Sbjct: 111 PKYRIALRLARDPRIKRLSCSH---KGTYADDCI-----VNRVLQHKCFIVATNDAGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RKIPG+PL+       V+E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVIEKLPDV 188

>SAKL0G07766g Chr7 (652944..653513) [570 bp, 189 aa] {ON} highly
           similar to uniprot|Q05498 Saccharomyces cerevisiae
           YDR339C Protein required for cell viability
          Length = 189

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 76/146 (52%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K ++++G+ + L +     P+IT C ++ L K  
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCV--PLITDCVMAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H   +     +C+     VN   +H+ YIVAT D  L++
Sbjct: 111 PKYRIALRLARDPRIKRLNCSH---KGTYADDCL-----VNRVLQHKCYIVATNDAALKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RK+PG+PL+       V+E L D 
Sbjct: 163 RIRKVPGIPLMSVGGHSYVIEKLPDV 188

>Ecym_7469 Chr7 complement(956526..957095) [570 bp, 189 aa] {ON}
           similar to Ashbya gossypii AEL102W
          Length = 189

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 75/146 (51%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K ++++G+ + L +     P+IT C ++ L K  
Sbjct: 55  YNQAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAKCV--PLITDCVMAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H         +C+     VN   +H+ YIVAT D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLTCSH---RGTYADDCL-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RK+PG+PL+       V+E L D 
Sbjct: 163 RIRKVPGIPLLSVGGHSYVIEKLPDV 188

>YDR339C Chr4 complement(1149951..1150520) [570 bp, 189 aa] {ON}
           FCF1Putative PINc domain nuclease required for early
           cleavages of 35S pre-rRNA and maturation of 18S rRNA;
           component of the SSU (small subunit) processome involved
           in 40S ribosomal subunit biogenesis; copurifies with
           Faf1p
          Length = 189

 Score = 63.2 bits (152), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 76/146 (52%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K ++++G+ + L +     P+IT C ++ L K  
Sbjct: 55  YNQAIK--PPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAK--CNPLITDCVMAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H   +     +C++  V      +H+ YIVAT D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCLVHRV-----LQHKCYIVATNDAGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RKIPG+PL+       V+E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>TBLA0H01750 Chr8 (408338..408907) [570 bp, 189 aa] {ON} Anc_5.392
           YDR339C
          Length = 189

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 75/146 (51%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K ++++G+ + L +     P+IT C ++ L K  
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVRGMMDCLLAK--CNPLITDCVVAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H         +C+     VN   +H+ YIVAT D  L++
Sbjct: 111 PKFRIALKLARDPRIKRLSCSH---RGTYADDCI-----VNRVLQHKCYIVATNDAGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RKIPG+PL+       V+E L D 
Sbjct: 163 RVRKIPGIPLMSVGGHSYVVEKLPDV 188

>Skud_4.606 Chr4 complement(1085976..1086545) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 76/146 (52%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K ++++G+ + L +     P+IT C ++ L K  
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAK--CNPLITDCVMAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H   +     +C++  V      +H+ YIVAT D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCLVHRV-----LQHKCYIVATNDAGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RKIPG+PL+       V+E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Smik_4.599 Chr4 complement(1076379..1076948) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 62.8 bits (151), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 76/146 (52%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K ++++G+ + L +     P+IT C ++ L K  
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAK--CNPLITDCVMAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H   +     +C++  V      +H+ YIVAT D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCLVHRV-----LQHKCYIVATNDAGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RKIPG+PL+       V+E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>Suva_2.509 Chr2 complement(907366..907935) [570 bp, 189 aa] {ON}
           YDR339C (REAL)
          Length = 189

 Score = 62.8 bits (151), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 76/146 (52%), Gaps = 17/146 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K ++++G+ + L +     P+IT C ++ L K  
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKVDIVRGMMDCLLAK--CNPLITDCVMAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H   +     +C++  V      +H+ YIVAT D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCLVHRV-----LQHKCYIVATNDAGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPLSDA 156
           ++RKIPG+PL+       V+E L D 
Sbjct: 163 RIRKIPGIPLMSVGGHAYVIEKLPDV 188

>KLLA0A07018g Chr1 complement(632523..633092) [570 bp, 189 aa] {ON}
           highly similar to uniprot|Q05498 Saccharomyces
           cerevisiae YDR339C Protein required for cell viability
          Length = 189

 Score = 57.4 bits (137), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 75/143 (52%), Gaps = 17/143 (11%)

Query: 16  YNHTFKFREPYQVIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALYKSE 75
           YN   K   PYQV+ID   +  +++ K +++KG+ + L +   I  +IT C ++ L K  
Sbjct: 55  YNEAIK--PPYQVLIDTNFINFSIQKKIDIVKGMMDCLLAKCNI--LITDCVMAELEKLG 110

Query: 76  DQESISI----GKTFERRRCNHSVKEPLSPSECMLSIVDVNGKNKHR-YIVATQDLELRR 130
            +  I++        +R  C+H   +     +C++  V      +H+ YIVAT D  L++
Sbjct: 111 PKYRIALKLARDPRIKRLSCSH---KGTYADDCIVHRV-----LQHKCYIVATNDAGLKQ 162

Query: 131 KLRKIPGVPLIHFKRSVMVMEPL 153
           ++RK+PG+PL+       V+E L
Sbjct: 163 RVRKVPGIPLMSVGGHSYVIEKL 185

>Ecym_1365 Chr1 complement(748590..752792) [4203 bp, 1400 aa] {ON}
           similar to Ashbya gossypii AEL061W
          Length = 1400

 Score = 30.0 bits (66), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 2/41 (4%)

Query: 145 RSVMVMEPLSDASCEYNEEVESKKLTSGLNSTKASVEGGQE 185
           + V+ +EPL   S EY  E+   K T GL ST AS   G E
Sbjct: 928 QQVLSLEPLPKPSAEY--EINKSKYTKGLFSTFASYLKGDE 966

>ZYRO0D06622g Chr4 (574866..575483) [618 bp, 205 aa] {ON} no
          similarity
          Length = 205

 Score = 29.3 bits (64), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%)

Query: 28 VIIDDALVQETLRAKYNLIKGLNNVLSSSNAIKPMITQCCISALY 72
          V +D   +QETL   + +I GL   L++    K  I QCC S  Y
Sbjct: 46 VPVDLTTLQETLEHLHQVINGLAFYLNTVRLKKSEIRQCCESYWY 90

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,540,292
Number of extensions: 925721
Number of successful extensions: 2707
Number of sequences better than 10.0: 52
Number of HSP's gapped: 2715
Number of HSP's successfully gapped: 53
Length of query: 259
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 152
Effective length of database: 41,212,137
Effective search space: 6264244824
Effective search space used: 6264244824
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)