Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A07280singletonON1711718921e-124
CAGL0D03608gsingletonON441751785e-15
Kpol_385.3singletonON359741671e-13
ZYRO0E01738gna 1ON454791628e-13
TDEL0G03430na 1ON433741573e-12
Smik_13.3352.395ON5651331531e-11
YMR136W (GAT2)2.395ON5601151486e-11
Suva_13.3162.395ON5631161478e-11
NDAI0H029002.395ON913701478e-11
SAKL0E04862g2.395ON5811341442e-10
Skud_13.2972.395ON5521231442e-10
TPHA0O01160singletonON203721376e-10
SAKL0A06842gna 1ON4741401362e-09
Skud_12.81na 2ON140691293e-09
KAFR0B05930singletonON573681344e-09
TBLA0B092402.395ON1278691345e-09
YLR013W (GAT3)na 2ON141691276e-09
TBLA0B087902.395ON451801327e-09
Suva_10.93na 2ON142691251e-08
CAGL0L06776g2.395ON828671301e-08
Kpol_1046.62.395ON407601292e-08
Smik_12.76na 2ON157601242e-08
TPHA0G021302.395ON678621292e-08
TDEL0G032702.395ON545701292e-08
TPHA0G026402.395ON350631256e-08
Suva_9.224na 3ON119601196e-08
KLTH0H06314gna 1ON422471249e-08
Kwal_14.1746na 1ON437711231e-07
KNAG0E021202.395ON347801221e-07
Kpol_1041.262.395ON467941221e-07
Skud_16.312na 4ON142601172e-07
KAFR0F026802.395ON352681212e-07
Smik_9.213na 3ON120601143e-07
Skud_9.191na 3ON128601144e-07
YIR013C (GAT4)na 3ON121601134e-07
ZYRO0A08536g2.395ON528621176e-07
KLLA0F09757gna 1ON2521131167e-07
Kwal_47.178492.395ON473371161e-06
Ecym_60602.395ON719571161e-06
Ecym_3059na 1ON466781151e-06
AAR174Wna 1ON460781151e-06
KAFR0B051302.395ON493841151e-06
KLTH0E09548g2.395ON503751151e-06
CAGL0I00902g2.395ON567431142e-06
ADR249W2.395ON625691133e-06
Suva_16.354na 4ON142621074e-06
NCAS0C04570singletonON1761491076e-06
Smik_16.268na 4ON138601058e-06
KNAG0A059402.395ON610651091e-05
KNAG0M01200singletonON291491061e-05
NCAS0D012602.395ON331391062e-05
NDAI0G032508.55ON497311062e-05
NCAS0G03520singletonON257471052e-05
KLLA0F25300g8.55ON692311053e-05
KLLA0F17116g2.395ON391721043e-05
Ecym_14568.55ON657311053e-05
ZYRO0F03520g8.55ON327311017e-05
YER040W (GLN3)3.539ON730921028e-05
KAFR0I01960singletonON6440931e-04
NDAI0H01910singletonON419721001e-04
AFR513C8.55ON468311001e-04
NDAI0H01740singletonON420721001e-04
Suva_5.1393.539ON728971001e-04
NCAS0C039208.55ON459311001e-04
KLTH0A03036g8.55ON72031982e-04
KNAG0M01120singletonON26268963e-04
Skud_6.508.55ON47031973e-04
TDEL0C008108.55ON34536964e-04
Kwal_47.179808.55ON72144964e-04
NDAI0B061103.539ON104028974e-04
YFL021W (GAT1)8.55ON51031964e-04
SAKL0B01826g8.55ON68331965e-04
Suva_6.378.55ON51531947e-04
KNAG0E033708.55ON49931947e-04
TBLA0E004003.539ON96928930.001
Kpol_483.223.539ON77728930.001
NCAS0F038403.539ON83128920.001
Suva_6.1851.250ON551145910.002
Skud_5.1493.539ON73197900.002
SAKL0F01496g3.539ON80533900.002
NDAI0B051601.250ON35932900.002
CAGL0G04389g1.250ON46241900.003
Smik_6.578.55ON52331900.003
KNAG0F03415singletonON25367890.003
CAGL0C02277g3.539ON82334880.005
KAFR0C033808.55ON30231870.005
KNAG0C014401.250ON46031870.006
Smik_5.1643.539ON73333870.006
Kpol_1011.148.55ON42828870.006
KNAG0B016201.250ON48662860.008
KAFR0A034101.250ON33632860.008
CAGL0K07634g8.55ON45931860.008
Smik_10.1281.250ON55231860.009
KLLA0B02651g4.283ON46056850.009
ZYRO0E08910g3.539ON85392860.010
Kpol_1058.278.55ON48428840.013
Ecym_63651.250ON57331850.013
Ecym_25693.539ON84728850.013
KLTH0E15488g1.250ON54147840.014
KAFR0J003203.539ON65728840.014
NCAS0B078101.250ON20031830.014
SAKL0G16192g4.283ON52364840.015
Kwal_27.126551.250ON56031840.016
SAKL0D04928g1.250ON39231830.017
Kpol_1055.574.283ON57754830.019
KLLA0F21296g1.250ON50431830.020
Suva_11.2661.250ON27331820.020
NCAS0A096001.250ON41534830.021
Smik_11.2961.250ON26931820.021
Skud_11.2691.250ON26831820.023
AFR069C1.250ON30831820.023
YKR034W (DAL80)1.250ON26931810.027
Kpol_1016.121.250ON50948820.027
YPL021W (ECM23)na 5ON18752800.030
Skud_10.1041.250ON54931820.031
TDEL0E008704.283ON50965810.033
Skud_16.261na 5ON18732800.033
TDEL0D060703.539ON81128820.034
TBLA0I033603.539ON106182810.039
Suva_16.297na 5ON17932790.040
YJL110C (GZF3)1.250ON55131810.040
KAFR0A013101.250ON46032810.040
TPHA0A059303.539ON81228810.043
Smik_16.214na 5ON17232790.044
TBLA0D055301.250ON47531800.051
KAFR0G033804.283ON53834800.052
SAKL0E12276gsingletonON16531780.056
TPHA0B012501.250ON39444790.059
KLLA0A01342g3.539ON78183800.060
ZYRO0D03894g1.250ON44442780.076
ZYRO0B13134g4.283ON56646780.085
NDAI0G053501.250ON43731780.089
YKL185W (ASH1)4.283ON58834780.10
Skud_11.414.283ON59334770.11
Smik_11.454.283ON59034770.12
TDEL0D012801.250ON35831770.13
KNAG0D028303.539ON75533760.15
AFR237W3.539ON80728760.16
CAGL0D00462g4.283ON71252760.19
KLTH0G01320g3.539ON74428750.25
CAGL0L03157g1.250ON18628720.37
Kwal_47.191603.539ON67828730.40
TBLA0H030101.250ON20433691.0
NDAI0D045804.283ON80958701.0
TPHA0B020104.283ON59748691.4
Suva_11.394.283ON59834681.7
Smik_3.106na 6ON22151671.7
Ecym_45535.481ON80258681.9
AER088C4.283ON39559672.0
Ecym_32364.283ON51034672.5
NDAI0A071403.87ON39379653.4
KNAG0D045204.283ON56834653.8
YCR018C (SRD1)na 6ON22139643.8
NCAS0A026504.283ON59334654.1
KNAG0M018202.201ON143279654.4
TBLA0F012504.283ON45234654.6
Kpol_1002.1132.201ON140479646.0
Kwal_23.40694.283ON58034638.7
Suva_3.45na 6ON22235629.1
NCAS0G027402.201ON141260639.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07280
         (171 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07280 Chr1 (1813951..1814466) [516 bp, 171 aa] {ON}             348   e-124
CAGL0D03608g Chr4 complement(363465..364790) [1326 bp, 441 aa] {...    73   5e-15
Kpol_385.3 s385 (7522..8601) [1080 bp, 359 aa] {ON} (7522..8601)...    69   1e-13
ZYRO0E01738g Chr5 complement(125883..127247) [1365 bp, 454 aa] {...    67   8e-13
TDEL0G03430 Chr7 complement(633324..634625) [1302 bp, 433 aa] {O...    65   3e-12
Smik_13.335 Chr13 (523587..524124,524203..525362) [1698 bp, 565 ...    64   1e-11
YMR136W Chr13 (541199..542881) [1683 bp, 560 aa] {ON}  GAT2Prote...    62   6e-11
Suva_13.316 Chr13 (519713..520254,520783..521103,521223..522051)...    61   8e-11
NDAI0H02900 Chr8 (707849..710590) [2742 bp, 913 aa] {ON} Anc_2.395     61   8e-11
SAKL0E04862g Chr5 (394898..396643) [1746 bp, 581 aa] {ON} weakly...    60   2e-10
Skud_13.297 Chr13 (514594..516252) [1659 bp, 552 aa] {ON} YMR136...    60   2e-10
TPHA0O01160 Chr15 complement(225978..226589) [612 bp, 203 aa] {O...    57   6e-10
SAKL0A06842g Chr1 complement(605900..607324) [1425 bp, 474 aa] {...    57   2e-09
Skud_12.81 Chr12 (163225..163647) [423 bp, 140 aa] {ON} YLR013W ...    54   3e-09
KAFR0B05930 Chr2 complement(1222301..1224022) [1722 bp, 573 aa] ...    56   4e-09
TBLA0B09240 Chr2 complement(2185248..2189084) [3837 bp, 1278 aa]...    56   5e-09
YLR013W Chr12 (171339..171764) [426 bp, 141 aa] {ON}  GAT3Protei...    54   6e-09
TBLA0B08790 Chr2 (2089746..2091101) [1356 bp, 451 aa] {ON} Anc_2...    55   7e-09
Suva_10.93 Chr10 (177471..177899) [429 bp, 142 aa] {ON} YLR013W ...    53   1e-08
CAGL0L06776g Chr12 (763580..766066) [2487 bp, 828 aa] {ON} some ...    55   1e-08
Kpol_1046.6 s1046 (13998..15221) [1224 bp, 407 aa] {ON} (13998.....    54   2e-08
Smik_12.76 Chr12 (158187..158660) [474 bp, 157 aa] {ON} YLR013W ...    52   2e-08
TPHA0G02130 Chr7 complement(435945..437981) [2037 bp, 678 aa] {O...    54   2e-08
TDEL0G03270 Chr7 complement(607444..609081) [1638 bp, 545 aa] {O...    54   2e-08
TPHA0G02640 Chr7 complement(552162..553214) [1053 bp, 350 aa] {O...    53   6e-08
Suva_9.224 Chr9 complement(367588..367947) [360 bp, 119 aa] {ON}...    50   6e-08
KLTH0H06314g Chr8 complement(553271..554539) [1269 bp, 422 aa] {...    52   9e-08
Kwal_14.1746 s14 complement(450643..451956) [1314 bp, 437 aa] {O...    52   1e-07
KNAG0E02120 Chr5 complement(432952..433995) [1044 bp, 347 aa] {O...    52   1e-07
Kpol_1041.26 s1041 (68074..69477) [1404 bp, 467 aa] {ON} (68074....    52   1e-07
Skud_16.312 Chr16 complement(583881..584309) [429 bp, 142 aa] {O...    50   2e-07
KAFR0F02680 Chr6 (524312..525370) [1059 bp, 352 aa] {ON} Anc_2.3...    51   2e-07
Smik_9.213 Chr9 complement(355801..356163) [363 bp, 120 aa] {ON}...    49   3e-07
Skud_9.191 Chr9 complement(350693..351079) [387 bp, 128 aa] {ON}...    49   4e-07
YIR013C Chr9 complement(380019..380384) [366 bp, 121 aa] {ON}  G...    48   4e-07
ZYRO0A08536g Chr1 complement(682125..683711) [1587 bp, 528 aa] {...    50   6e-07
KLLA0F09757g Chr6 (898398..899156) [759 bp, 252 aa] {ON} some si...    49   7e-07
Kwal_47.17849 s47 (579209..580630) [1422 bp, 473 aa] {ON} YMR136...    49   1e-06
Ecym_6060 Chr6 complement(114016..116175) [2160 bp, 719 aa] {ON}...    49   1e-06
Ecym_3059 Chr3 complement(110013..111413) [1401 bp, 466 aa] {ON}...    49   1e-06
AAR174W Chr1 (657598..658980) [1383 bp, 460 aa] {ON} NOHBY117; N...    49   1e-06
KAFR0B05130 Chr2 complement(1053911..1055392) [1482 bp, 493 aa] ...    49   1e-06
KLTH0E09548g Chr5 (862710..864221) [1512 bp, 503 aa] {ON} weakly...    49   1e-06
CAGL0I00902g Chr9 complement(67387..69090) [1704 bp, 567 aa] {ON...    49   2e-06
ADR249W Chr4 (1135915..1137792) [1878 bp, 625 aa] {ON} Syntenic ...    48   3e-06
Suva_16.354 Chr16 complement(625042..625470) [429 bp, 142 aa] {O...    46   4e-06
NCAS0C04570 Chr3 complement(935042..935572) [531 bp, 176 aa] {ON}      46   6e-06
Smik_16.268 Chr16 complement(495302..495718) [417 bp, 138 aa] {O...    45   8e-06
KNAG0A05940 Chr1 complement(887824..889656) [1833 bp, 610 aa] {O...    47   1e-05
KNAG0M01200 Chr13 complement(218147..219022) [876 bp, 291 aa] {O...    45   1e-05
NCAS0D01260 Chr4 complement(229646..230641) [996 bp, 331 aa] {ON...    45   2e-05
NDAI0G03250 Chr7 (766494..767987) [1494 bp, 497 aa] {ON} Anc_8.55      45   2e-05
NCAS0G03520 Chr7 (657612..658385) [774 bp, 257 aa] {ON}                45   2e-05
KLLA0F25300g Chr6 (2354118..2356196) [2079 bp, 692 aa] {ON} some...    45   3e-05
KLLA0F17116g Chr6 complement(1569192..1570367) [1176 bp, 391 aa]...    45   3e-05
Ecym_1456 Chr1 complement(938648..940621) [1974 bp, 657 aa] {ON}...    45   3e-05
ZYRO0F03520g Chr6 (300351..301334) [984 bp, 327 aa] {ON} uniprot...    44   7e-05
YER040W Chr5 (229795..231987) [2193 bp, 730 aa] {ON}  GLN3Transc...    44   8e-05
KAFR0I01960 Chr9 (401053..401247) [195 bp, 64 aa] {ON}                 40   1e-04
NDAI0H01910 Chr8 (467628..468887) [1260 bp, 419 aa] {ON}               43   1e-04
AFR513C Chr6 complement(1355811..1357217) [1407 bp, 468 aa] {ON}...    43   1e-04
NDAI0H01740 Chr8 complement(415810..417072) [1263 bp, 420 aa] {O...    43   1e-04
Suva_5.139 Chr5 (206012..208198) [2187 bp, 728 aa] {ON} YER040W ...    43   1e-04
NCAS0C03920 Chr3 (795871..797250) [1380 bp, 459 aa] {ON} Anc_8.55      43   1e-04
KLTH0A03036g Chr1 complement(258170..260332) [2163 bp, 720 aa] {...    42   2e-04
KNAG0M01120 Chr13 (200158..200946) [789 bp, 262 aa] {ON}               42   3e-04
Skud_6.50 Chr6 (99142..100554) [1413 bp, 470 aa] {ON} YFL021W (R...    42   3e-04
TDEL0C00810 Chr3 (134908..135945) [1038 bp, 345 aa] {ON} Anc_8.5...    42   4e-04
Kwal_47.17980 s47 complement(634203..636368) [2166 bp, 721 aa] {...    42   4e-04
NDAI0B06110 Chr2 (1482402..1485524) [3123 bp, 1040 aa] {ON} Anc_...    42   4e-04
YFL021W Chr6 (95966..97498) [1533 bp, 510 aa] {ON}  GAT1Transcri...    42   4e-04
SAKL0B01826g Chr2 (179191..181242) [2052 bp, 683 aa] {ON} some s...    42   5e-04
Suva_6.37 Chr6 (69498..71045) [1548 bp, 515 aa] {ON} YFL021W (REAL)    41   7e-04
KNAG0E03370 Chr5 (674614..676113) [1500 bp, 499 aa] {ON} Anc_8.5...    41   7e-04
TBLA0E00400 Chr5 complement(73944..76853) [2910 bp, 969 aa] {ON}...    40   0.001
Kpol_483.22 s483 (58125..60458) [2334 bp, 777 aa] {ON} (58125..6...    40   0.001
NCAS0F03840 Chr6 (769692..772187) [2496 bp, 831 aa] {ON} Anc_3.5...    40   0.001
Suva_6.185 Chr6 (340566..342221) [1656 bp, 551 aa] {ON} YJL110C ...    40   0.002
Skud_5.149 Chr5 (227606..229801) [2196 bp, 731 aa] {ON} YER040W ...    39   0.002
SAKL0F01496g Chr6 complement(124251..126668) [2418 bp, 805 aa] {...    39   0.002
NDAI0B05160 Chr2 (1264852..1265931) [1080 bp, 359 aa] {ON} Anc_1...    39   0.002
CAGL0G04389g Chr7 complement(413376..414764) [1389 bp, 462 aa] {...    39   0.003
Smik_6.57 Chr6 (111118..112689) [1572 bp, 523 aa] {ON} YFL021W (...    39   0.003
KNAG0F03415 Chr6 (646275..647036) [762 bp, 253 aa] {ON}                39   0.003
CAGL0C02277g Chr3 complement(230496..232967) [2472 bp, 823 aa] {...    39   0.005
KAFR0C03380 Chr3 complement(688344..689252) [909 bp, 302 aa] {ON...    38   0.005
KNAG0C01440 Chr3 complement(282044..283426) [1383 bp, 460 aa] {O...    38   0.006
Smik_5.164 Chr5 (234546..236747) [2202 bp, 733 aa] {ON} YER040W ...    38   0.006
Kpol_1011.14 s1011 complement(30640..30891,30894..31928) [1287 b...    38   0.006
KNAG0B01620 Chr2 complement(296633..298093) [1461 bp, 486 aa] {O...    38   0.008
KAFR0A03410 Chr1 complement(695254..696264) [1011 bp, 336 aa] {O...    38   0.008
CAGL0K07634g Chr11 complement(754675..756054) [1380 bp, 459 aa] ...    38   0.008
Smik_10.128 Chr10 complement(201424..203082) [1659 bp, 552 aa] {...    38   0.009
KLLA0B02651g Chr2 (233553..234935) [1383 bp, 460 aa] {ON} weakly...    37   0.009
ZYRO0E08910g Chr5 (711088..713649) [2562 bp, 853 aa] {ON} some s...    38   0.010
Kpol_1058.27 s1058 (80407..81861) [1455 bp, 484 aa] {ON} (80407....    37   0.013
Ecym_6365 Chr6 (722796..724517) [1722 bp, 573 aa] {ON} similar t...    37   0.013
Ecym_2569 Chr2 (1112550..1115093) [2544 bp, 847 aa] {ON} similar...    37   0.013
KLTH0E15488g Chr5 (1377607..1379232) [1626 bp, 541 aa] {ON} some...    37   0.014
KAFR0J00320 Chr10 complement(52668..54641) [1974 bp, 657 aa] {ON...    37   0.014
NCAS0B07810 Chr2 (1483287..1483889) [603 bp, 200 aa] {ON} Anc_1....    37   0.014
SAKL0G16192g Chr7 complement(1399297..1400868) [1572 bp, 523 aa]...    37   0.015
Kwal_27.12655 s27 (1320535..1322217) [1683 bp, 560 aa] {ON} YJL1...    37   0.016
SAKL0D04928g Chr4 complement(379886..381064) [1179 bp, 392 aa] {...    37   0.017
Kpol_1055.57 s1055 (146707..148440) [1734 bp, 577 aa] {ON} (1467...    37   0.019
KLLA0F21296g Chr6 (1990998..1992512) [1515 bp, 504 aa] {ON} some...    37   0.020
Suva_11.266 Chr11 (490833..491654) [822 bp, 273 aa] {ON} YKR034W...    36   0.020
NCAS0A09600 Chr1 (1918722..1919969) [1248 bp, 415 aa] {ON} Anc_1...    37   0.021
Smik_11.296 Chr11 (496172..496981) [810 bp, 269 aa] {ON} YKR034W...    36   0.021
Skud_11.269 Chr11 (489067..489873) [807 bp, 268 aa] {ON} YKR034W...    36   0.023
AFR069C Chr6 complement(546145..547071) [927 bp, 308 aa] {ON} Sy...    36   0.023
YKR034W Chr11 (506898..507707) [810 bp, 269 aa] {ON}  DAL80Negat...    36   0.027
Kpol_1016.12 s1016 complement(29363..30892) [1530 bp, 509 aa] {O...    36   0.027
YPL021W Chr16 (511101..511664) [564 bp, 187 aa] {ON}  ECM23Non-e...    35   0.030
Skud_10.104 Chr10 complement(177748..179397) [1650 bp, 549 aa] {...    36   0.031
TDEL0E00870 Chr5 (179193..180722) [1530 bp, 509 aa] {ON} Anc_4.2...    36   0.033
Skud_16.261 Chr16 (475931..476494) [564 bp, 187 aa] {ON} YPL021W...    35   0.033
TDEL0D06070 Chr4 (1095543..1097978) [2436 bp, 811 aa] {ON} Anc_3...    36   0.034
TBLA0I03360 Chr9 (812803..815988) [3186 bp, 1061 aa] {ON} Anc_3....    36   0.039
Suva_16.297 Chr16 (514206..514745) [540 bp, 179 aa] {ON} YPL021W...    35   0.040
YJL110C Chr10 complement(209922..211577) [1656 bp, 551 aa] {ON} ...    36   0.040
KAFR0A01310 Chr1 complement(250863..252245) [1383 bp, 460 aa] {O...    36   0.040
TPHA0A05930 Chr1 (1340674..1343112) [2439 bp, 812 aa] {ON} Anc_3...    36   0.043
Smik_16.214 Chr16 (388331..388849) [519 bp, 172 aa] {ON} YPL021W...    35   0.044
TBLA0D05530 Chr4 (1360138..1361565) [1428 bp, 475 aa] {ON} Anc_1...    35   0.051
KAFR0G03380 Chr7 complement(696148..697764) [1617 bp, 538 aa] {O...    35   0.052
SAKL0E12276g Chr5 complement(1016243..1016740) [498 bp, 165 aa] ...    35   0.056
TPHA0B01250 Chr2 complement(278851..280035) [1185 bp, 394 aa] {O...    35   0.059
KLLA0A01342g Chr1 complement(120385..122730) [2346 bp, 781 aa] {...    35   0.060
ZYRO0D03894g Chr4 complement(315134..316468) [1335 bp, 444 aa] {...    35   0.076
ZYRO0B13134g Chr2 complement(1065215..1066915) [1701 bp, 566 aa]...    35   0.085
NDAI0G05350 Chr7 complement(1304235..1305548) [1314 bp, 437 aa] ...    35   0.089
YKL185W Chr11 (94499..96265) [1767 bp, 588 aa] {ON}  ASH1Zinc-fi...    35   0.10 
Skud_11.41 Chr11 (80890..82671) [1782 bp, 593 aa] {ON} YKL185W (...    34   0.11 
Smik_11.45 Chr11 (80029..81801) [1773 bp, 590 aa] {ON} YKL185W (...    34   0.12 
TDEL0D01280 Chr4 (247241..248317) [1077 bp, 358 aa] {ON} Anc_1.2...    34   0.13 
KNAG0D02830 Chr4 (512472..514739) [2268 bp, 755 aa] {ON} Anc_3.5...    34   0.15 
AFR237W Chr6 (866798..869221) [2424 bp, 807 aa] {ON} Syntenic ho...    34   0.16 
CAGL0D00462g Chr4 (55305..57443) [2139 bp, 712 aa] {ON} weakly s...    34   0.19 
KLTH0G01320g Chr7 complement(95197..97431) [2235 bp, 744 aa] {ON...    33   0.25 
CAGL0L03157g Chr12 (367003..367563) [561 bp, 186 aa] {ON} some s...    32   0.37 
Kwal_47.19160 s47 (1115610..1117646) [2037 bp, 678 aa] {ON} YER0...    33   0.40 
TBLA0H03010 Chr8 (739587..740201) [615 bp, 204 aa] {ON} Anc_1.25...    31   1.0  
NDAI0D04580 Chr4 complement(1075178..1077607) [2430 bp, 809 aa] ...    32   1.0  
TPHA0B02010 Chr2 (456137..457930) [1794 bp, 597 aa] {ON} Anc_4.2...    31   1.4  
Suva_11.39 Chr11 (79211..81007) [1797 bp, 598 aa] {ON} YKL185W (...    31   1.7  
Smik_3.106 Chr3 complement(148337..149002) [666 bp, 221 aa] {ON}...    30   1.7  
Ecym_4553 Chr4 (1088872..1091280) [2409 bp, 802 aa] {ON} similar...    31   1.9  
AER088C Chr5 complement(804332..805519) [1188 bp, 395 aa] {ON} S...    30   2.0  
Ecym_3236 Chr3 (440796..442328) [1533 bp, 510 aa] {ON} similar t...    30   2.5  
NDAI0A07140 Chr1 complement(1628146..1629327) [1182 bp, 393 aa] ...    30   3.4  
KNAG0D04520 Chr4 complement(818647..820353) [1707 bp, 568 aa] {O...    30   3.8  
YCR018C Chr3 complement(148238..148903) [666 bp, 221 aa] {ON}  S...    29   3.8  
NCAS0A02650 Chr1 complement(505025..506806) [1782 bp, 593 aa] {O...    30   4.1  
KNAG0M01820 Chr13 complement(334935..339233) [4299 bp, 1432 aa] ...    30   4.4  
TBLA0F01250 Chr6 complement(311865..313223) [1359 bp, 452 aa] {O...    30   4.6  
Kpol_1002.113 s1002 (283671..287885) [4215 bp, 1404 aa] {ON} (28...    29   6.0  
Kwal_23.4069 s23 (557325..559067) [1743 bp, 580 aa] {ON} YKL185W...    29   8.7  
Suva_3.45 Chr3 complement(62203..62871) [669 bp, 222 aa] {ON} YC...    28   9.1  
NCAS0G02740 Chr7 (492545..496783) [4239 bp, 1412 aa] {ON} Anc_2....    29   9.3  

>TBLA0A07280 Chr1 (1813951..1814466) [516 bp, 171 aa] {ON} 
          Length = 171

 Score =  348 bits (892), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 171/171 (100%), Positives = 171/171 (100%)

Query: 1   MTSQIKSRLDILINVMMADPVFNPPSQEETETKIGNGKKVEVITAATKNSINKVKKPNCI 60
           MTSQIKSRLDILINVMMADPVFNPPSQEETETKIGNGKKVEVITAATKNSINKVKKPNCI
Sbjct: 1   MTSQIKSRLDILINVMMADPVFNPPSQEETETKIGNGKKVEVITAATKNSINKVKKPNCI 60

Query: 61  RKKRTLNKSAEYVNFTIGQESFVSLGPKRSTSGKNLNKFGYCTRCGIKSSPEWRKNPQGE 120
           RKKRTLNKSAEYVNFTIGQESFVSLGPKRSTSGKNLNKFGYCTRCGIKSSPEWRKNPQGE
Sbjct: 61  RKKRTLNKSAEYVNFTIGQESFVSLGPKRSTSGKNLNKFGYCTRCGIKSSPEWRKNPQGE 120

Query: 121 TSLCNACGLNLKKLTKAYSENGVRYFLKTYDKPFKRSIPSIEELERTLNEE 171
           TSLCNACGLNLKKLTKAYSENGVRYFLKTYDKPFKRSIPSIEELERTLNEE
Sbjct: 121 TSLCNACGLNLKKLTKAYSENGVRYFLKTYDKPFKRSIPSIEELERTLNEE 171

>CAGL0D03608g Chr4 complement(363465..364790) [1326 bp, 441 aa] {ON}
           no similarity
          Length = 441

 Score = 73.2 bits (178), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 48/75 (64%), Gaps = 3/75 (4%)

Query: 88  KRSTSGKNLNKFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYS-ENGVRYF 146
           K S SGKN N FGYC +CG   +PEWR  PQG+ +LCNACGL  KKL K ++ EN    F
Sbjct: 365 KVSKSGKNRNVFGYCLQCGKVDTPEWRNGPQGKATLCNACGLFYKKLKKYFADENMAIQF 424

Query: 147 L--KTYDKPFKRSIP 159
           +  ++   P  R++P
Sbjct: 425 MQHRSIVDPEDRTMP 439

>Kpol_385.3 s385 (7522..8601) [1080 bp, 359 aa] {ON} (7522..8601)
           [1080 nt, 360 aa]
          Length = 359

 Score = 68.9 bits (167), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 41/74 (55%), Gaps = 2/74 (2%)

Query: 88  KRSTSGKNLNKFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFL 147
           K S+S KN N FG C  CG   +PEWRK P G TSLCNACGL  KKL +  +       +
Sbjct: 281 KLSSSNKNRNPFGQCLHCGDTETPEWRKGPSGPTSLCNACGLFYKKLLEKSTLEDANLLM 340

Query: 148 KTY--DKPFKRSIP 159
           K      P+ R IP
Sbjct: 341 KERFNSNPYNRRIP 354

>ZYRO0E01738g Chr5 complement(125883..127247) [1365 bp, 454 aa] {ON}
           some similarities with uniprot|P40209 Saccharomyces
           cerevisiae YMR136W
          Length = 454

 Score = 67.0 bits (162), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 41/79 (51%), Gaps = 2/79 (2%)

Query: 88  KRSTSGKNLNKFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFL 147
           K S SGKN N    C  C    +PEWRK P G T+LCNACGL  KKL K + E      +
Sbjct: 376 KTSKSGKNRNAHMRCLHCSSTETPEWRKGPSGPTTLCNACGLFYKKLIKKFGEEVATSIM 435

Query: 148 KT--YDKPFKRSIPSIEEL 164
           K+   + P  R IP    L
Sbjct: 436 KSRQTEDPQNRKIPRFARL 454

>TDEL0G03430 Chr7 complement(633324..634625) [1302 bp, 433 aa] {ON} 
          Length = 433

 Score = 65.1 bits (157), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 39/74 (52%), Gaps = 2/74 (2%)

Query: 88  KRSTSGKNLNKFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFL 147
           K S SGKN N    C  C    +PEWRK P G T+LCNACGL  KKL K +        +
Sbjct: 355 KTSKSGKNRNTHMKCLHCAATDTPEWRKGPVGPTTLCNACGLFFKKLVKKFGPETASVIM 414

Query: 148 KTY--DKPFKRSIP 159
           K+   + P  R +P
Sbjct: 415 KSRQDENPQDRKVP 428

>Smik_13.335 Chr13 (523587..524124,524203..525362) [1698 bp, 565 aa]
           {ON} YMR136W (REAL)
          Length = 565

 Score = 63.5 bits (153), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 66/133 (49%), Gaps = 17/133 (12%)

Query: 56  KPNCIRKKRTLNKSAEYVNFTIGQESFVS-LGPKRSTSGKNLNK---FGYCTRCGIKSSP 111
           +P  I+++ TL  S+ ++N      + VS + P  +   KN N      +C  CG   +P
Sbjct: 427 RPRAIQRQPTLTTSSHFINNPNPSVATVSTITPATNNDEKNPNAKKIIEFCFHCGETETP 486

Query: 112 EWRKNPQGETSLCNACGLNLKKLTKAY---SENGVRYFLKTYDKPFKRSIPS-------- 160
           EWRK P G  +LCNACGL  +K+TK +   S N +  + +  D    R IP         
Sbjct: 487 EWRKGPYGTRTLCNACGLFYRKVTKKFGSKSSNLLLRYRRAIDLANDRRIPDFITIPNRF 546

Query: 161 IEEL--ERTLNEE 171
           I ++  +RTL+ E
Sbjct: 547 IHDMDNDRTLDSE 559

>YMR136W Chr13 (541199..542881) [1683 bp, 560 aa] {ON}  GAT2Protein
           containing GATA family zinc finger motifs; similar to
           Gln3p and Dal80p; expression repressed by leucine
          Length = 560

 Score = 61.6 bits (148), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 60/115 (52%), Gaps = 7/115 (6%)

Query: 52  NKVKKPNCIRKKRTLNKSAEYVNFT-IGQESFVSLGPKRSTSGKNLNK---FGYCTRCGI 107
           N   +P  I+++ TL  S+ ++N +  G  +  +  P  ++  KN N      +C  CG 
Sbjct: 418 NNRGRPRAIQRQPTLTTSSHFINNSNPGAAAVSTTTPAANSDEKNPNAKKIIEFCFHCGE 477

Query: 108 KSSPEWRKNPQGETSLCNACGLNLKKLTKAY---SENGVRYFLKTYDKPFKRSIP 159
             +PEWRK P G  +LCNACGL  +K+TK +   S N +  + ++ D    R IP
Sbjct: 478 TETPEWRKGPYGTRTLCNACGLFYRKVTKKFGSKSSNLLLRYRRSIDLANDRRIP 532

>Suva_13.316 Chr13 (519713..520254,520783..521103,521223..522051)
           [1692 bp, 563 aa] {ON} YMR136W (REAL)
          Length = 563

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 56/116 (48%), Gaps = 13/116 (11%)

Query: 56  KPNCIRKKRTLNKSAEYVNFTIGQESFVSLGPKRSTSGKNLNK-------FGYCTRCGIK 108
           +P  I+++ TL  S  ++N      + V++ P  + +  N  K         +C  CG  
Sbjct: 425 RPRAIQRQPTLTTSTHFIN---NSGTSVAVAPNTAPTTNNNEKETNPKKIIEFCFHCGET 481

Query: 109 SSPEWRKNPQGETSLCNACGLNLKKLTKAY---SENGVRYFLKTYDKPFKRSIPSI 161
            +PEWRK P G  +LCNACGL  +K+TK +   S N +  + +  D    R IP  
Sbjct: 482 ETPEWRKGPYGTRTLCNACGLFYRKVTKKFGSKSSNLLLRYRRAIDLANDRRIPDF 537

>NDAI0H02900 Chr8 (707849..710590) [2742 bp, 913 aa] {ON} Anc_2.395
          Length = 913

 Score = 61.2 bits (147), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 4/70 (5%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFLKTYDK---PFKRSI 158
           C  CG K +PEWR+ P G  +LCNACGL  +KL K ++      F++ Y +   P  R I
Sbjct: 828 CKHCGDKDTPEWRRGPYGNRTLCNACGLFYRKLVKKFTIKDANLFMR-YQRTINPSDRRI 886

Query: 159 PSIEELERTL 168
           PSI ++  T 
Sbjct: 887 PSIIKIPETF 896

>SAKL0E04862g Chr5 (394898..396643) [1746 bp, 581 aa] {ON} weakly
           similar to uniprot|P40209 Saccharomyces cerevisiae
           YMR136W GAT2
          Length = 581

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 62/134 (46%), Gaps = 14/134 (10%)

Query: 42  VITAATKNSINKVKKPNCIRKKRTLNKSAEYVNFTIGQESFVSLGPKRSTSGKNLNKFGY 101
           +IT A+   INK+ KP  + KK   N S          +    L  KR     N N F  
Sbjct: 435 IITRASVPLINKINKPKKLSKK---NSSTHIKKRNFSNDDIPVLLQKR-----NSNPFME 486

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYS---ENGVRYFLK-TYDKPFKRS 157
           C  C  K +PEWR+ P G  +LCNACGL   KL K +     N + ++ + T+  P  R 
Sbjct: 487 CLHCAQKDTPEWRRGPYGNRTLCNACGLFYGKLMKKFGLKEANTLMHYRRCTF--PEDRR 544

Query: 158 IPSIEELERTLNEE 171
           +P   E+  +  +E
Sbjct: 545 VPQTAEVPESFIKE 558

>Skud_13.297 Chr13 (514594..516252) [1659 bp, 552 aa] {ON} YMR136W
           (REAL)
          Length = 552

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 39/123 (31%), Positives = 61/123 (49%), Gaps = 7/123 (5%)

Query: 44  TAATKNSINKVKKPNCIRKKRTLNKSAEYVNFTIGQESFVSLG-PKRSTSGKNLNK---F 99
           ++A     N   +P  I+++ TL  S+ ++N +    + VS   P  S   K+ +     
Sbjct: 402 SSANSKKKNNRGRPRAIQRQPTLTTSSHFINNSNSSVATVSTSLPSASNREKDPDAKKII 461

Query: 100 GYCTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAY---SENGVRYFLKTYDKPFKR 156
            +C  CG   +PEWRK P G  +LCNACGL  +K+TK +   S N +  + +  D    R
Sbjct: 462 EFCFHCGETETPEWRKGPYGTRTLCNACGLFYRKVTKKFGSKSSNLLLRYRRAVDLANDR 521

Query: 157 SIP 159
            IP
Sbjct: 522 RIP 524

>TPHA0O01160 Chr15 complement(225978..226589) [612 bp, 203 aa] {ON} 
          Length = 203

 Score = 57.4 bits (137), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 40/72 (55%), Gaps = 2/72 (2%)

Query: 90  STSGKNLNKFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLT--KAYSENGVRYFL 147
           S S KN N  G C  CG+  + EWRK PQG  +LCN+CGL  ++L    +Y E  + +  
Sbjct: 118 SKSNKNRNYNGGCVHCGVTETVEWRKGPQGNHTLCNSCGLFYRRLLGFTSYDETIMIFKE 177

Query: 148 KTYDKPFKRSIP 159
           +  + P  R IP
Sbjct: 178 RYKNNPTDRRIP 189

>SAKL0A06842g Chr1 complement(605900..607324) [1425 bp, 474 aa] {ON}
           weakly similar to uniprot|P40209 Saccharomyces
           cerevisiae YMR136W GAT2
          Length = 474

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 63/140 (45%), Gaps = 19/140 (13%)

Query: 35  GNGKKVEVITAA---TKN----SINKVKKPNCIRKKRTLNKSAEYVNFTIGQESFVSLGP 87
           GN  +   ++A+   T+N    S NKV KP  +  K     S+ Y        S V+   
Sbjct: 317 GNSSRASTLSASLVTTRNDFTSSSNKVTKPKKVAGKTKNVVSSSY--------SKVAAYG 368

Query: 88  KRSTSGKNLNKFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFL 147
             S S KN N +  C  C    +PEWR+ P G+ SLCNACGL  KKL   +        L
Sbjct: 369 TPSRSRKNSNPYMKCLHCASMETPEWRRGPYGKRSLCNACGLFYKKLINQFGNKDAN-IL 427

Query: 148 KTYDK---PFKRSIPSIEEL 164
             Y +   P  R +P + E+
Sbjct: 428 MHYRRSILPTDRRVPKVFEV 447

>Skud_12.81 Chr12 (163225..163647) [423 bp, 140 aa] {ON} YLR013W
           (REAL)
          Length = 140

 Score = 54.3 bits (129), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 102 CTRCGI-KSSPEWRKNPQGETSLCNACGLNLKKLTKAYSEN-GVRYFLKTYDKPFKRSIP 159
           C +C + K+SP+WR+ P GE +LCNACGL  +K+   + +N   RYF +      KR +P
Sbjct: 71  CPQCAVVKTSPQWREGPDGEVTLCNACGLFYRKIFLVFGKNLAKRYFDEIKGVGVKRKVP 130

Query: 160 -SIEELERT 167
            S+  + RT
Sbjct: 131 KSLYGVTRT 139

>KAFR0B05930 Chr2 complement(1222301..1224022) [1722 bp, 573 aa]
           {ON} 
          Length = 573

 Score = 56.2 bits (134), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 37/68 (54%), Gaps = 8/68 (11%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRY--FLKTYDK---PFKR 156
           C  C    + EWR  P GE +LCNACGL  +KLT  +   GV+Y   L  Y K   PF R
Sbjct: 487 CVHCSDADTAEWRVGPYGERTLCNACGLFHRKLTDKF---GVKYSNILMRYRKRINPFNR 543

Query: 157 SIPSIEEL 164
            +P+  E+
Sbjct: 544 RVPAFIEV 551

>TBLA0B09240 Chr2 complement(2185248..2189084) [3837 bp, 1278 aa] {ON}
            
          Length = 1278

 Score = 56.2 bits (134), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 38/69 (55%), Gaps = 2/69 (2%)

Query: 102  CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVR--YFLKTYDKPFKRSIP 159
            C  CG  S+PEWR+ P G+ +LCNACGL  +K+ + +S  G     +L+    P  R +P
Sbjct: 1189 CLHCGDTSTPEWRRGPYGDGTLCNACGLFYRKIVRRFSAIGANLLMWLRKDRVPSDRRVP 1248

Query: 160  SIEELERTL 168
               E+   L
Sbjct: 1249 LFIEIPGHL 1257

>YLR013W Chr12 (171339..171764) [426 bp, 141 aa] {ON}  GAT3Protein
           containing GATA family zinc finger motifs
          Length = 141

 Score = 53.5 bits (127), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 102 CTRCG-IKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSEN-GVRYFLKTYDKPFKRSIP 159
           C +C  IK+SP+WR+ P GE +LCNACGL  +K+   + ++   RYF +      KR +P
Sbjct: 72  CPQCAVIKTSPQWREGPDGEVTLCNACGLFYRKIFLVFGKDLAKRYFNEIKGVSVKRKVP 131

Query: 160 -SIEELERT 167
            S+  + RT
Sbjct: 132 KSLYGVTRT 140

>TBLA0B08790 Chr2 (2089746..2091101) [1356 bp, 451 aa] {ON}
           Anc_2.395 YMR136W
          Length = 451

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (57%), Gaps = 14/80 (17%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYS-ENG---VRY--FLKTYDKPFK 155
           C  C   S+PEWR+ PQG  +LCNACGL  +KL K +  EN    +RY  F+ + D    
Sbjct: 366 CFYCSKTSTPEWRRGPQGNRTLCNACGLYYRKLIKKFGYENANLLLRYRNFISSTD---- 421

Query: 156 RSIPSIEELE----RTLNEE 171
           R +P+I ++     + LNE+
Sbjct: 422 RRVPTIVDVPNSFVKMLNED 441

>Suva_10.93 Chr10 (177471..177899) [429 bp, 142 aa] {ON} YLR013W
           (REAL)
          Length = 142

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 102 CTRCG-IKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSEN-GVRYFLKTYDKPFKRSIP 159
           C +C  IK+SP+WR+ P GE +LCNACGL  +K+   + ++   RYF +      KR +P
Sbjct: 73  CPQCDVIKTSPQWREGPNGEVTLCNACGLFYRKVFLVFGKSLAKRYFDEIKGASVKRKVP 132

Query: 160 -SIEELERT 167
            S+  + RT
Sbjct: 133 RSLYGVMRT 141

>CAGL0L06776g Chr12 (763580..766066) [2487 bp, 828 aa] {ON} some
           similarities with uniprot|P40209 Saccharomyces
           cerevisiae YMR136w GAT2
          Length = 828

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 36/67 (53%), Gaps = 6/67 (8%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTK----AYSENGVRYFLKTYDKPFKRS 157
           C  CG   +PEWR+ P G  +LCNACGL  +KLTK     Y    +RY  +    P  R 
Sbjct: 739 CHHCGESDTPEWRRGPYGSRTLCNACGLFYRKLTKKFTVPYGNLYMRY--RRIQAPLDRR 796

Query: 158 IPSIEEL 164
           +P + ++
Sbjct: 797 VPLVLDV 803

>Kpol_1046.6 s1046 (13998..15221) [1224 bp, 407 aa] {ON}
           (13998..15221) [1224 nt, 408 aa]
          Length = 407

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFLKTYDK--PFKRSIP 159
           C +CG   +PEWR+ P G  +LCNACGL   KLTK +        ++   K  P  R +P
Sbjct: 320 CLQCGETQTPEWRRGPYGNKTLCNACGLFYSKLTKKFGNKNANLLMRYRQKTSPSDRKVP 379

>Smik_12.76 Chr12 (158187..158660) [474 bp, 157 aa] {ON} YLR013W
           (REAL)
          Length = 157

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (61%), Gaps = 2/60 (3%)

Query: 102 CTRCGI-KSSPEWRKNPQGETSLCNACGLNLKKLTKAYSEN-GVRYFLKTYDKPFKRSIP 159
           C +C + K+SP+WR+ P GE +LCNACGL  +K+   + ++   RYF +      KR +P
Sbjct: 88  CPQCAVVKTSPQWREGPDGEVTLCNACGLFYRKIFLVFGKSLAKRYFNEIKGASVKRKVP 147

>TPHA0G02130 Chr7 complement(435945..437981) [2037 bp, 678 aa] {ON}
           Anc_2.395 YMR136W
          Length = 678

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAY---SENGVRYFLKTYDKPFKRSI 158
           C  C    +PEWRK P G  +LCNACGL  +KL K +   S N V  + K    P  R +
Sbjct: 591 CVHCNDHDTPEWRKGPYGNRTLCNACGLFYRKLIKKFGLKSANLVMRYRKNI-SPHDRRV 649

Query: 159 PS 160
           PS
Sbjct: 650 PS 651

>TDEL0G03270 Chr7 complement(607444..609081) [1638 bp, 545 aa] {ON}
           Anc_2.395 YMR136W
          Length = 545

 Score = 54.3 bits (129), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 35/70 (50%), Gaps = 2/70 (2%)

Query: 94  KNLNKFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFL--KTYD 151
           KN      C  CG  S+PEWR+ P G  +LCNACGL  +KL K +        +  K   
Sbjct: 443 KNDQATTSCVHCGEGSTPEWRRGPYGNRTLCNACGLFYRKLIKKFGVKDANLLMRFKKQI 502

Query: 152 KPFKRSIPSI 161
            P  R +PS+
Sbjct: 503 NPEDRRVPSL 512

>TPHA0G02640 Chr7 complement(552162..553214) [1053 bp, 350 aa] {ON}
           Anc_2.395 YMR136W
          Length = 350

 Score = 52.8 bits (125), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 35/63 (55%), Gaps = 6/63 (9%)

Query: 101 YCTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAY-SENG---VRYFLKTYDKPFKR 156
           +C +C    +PEWR+ P G  +LCNACGL   KL K + SE     +RY   TY  P  R
Sbjct: 264 FCKQCNENETPEWRRGPYGNKTLCNACGLYYSKLIKKFNSEQANIIMRYKKTTY--PSDR 321

Query: 157 SIP 159
            IP
Sbjct: 322 KIP 324

>Suva_9.224 Chr9 complement(367588..367947) [360 bp, 119 aa] {ON}
           YIR013C (REAL)
          Length = 119

 Score = 50.4 bits (119), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 33/60 (55%), Gaps = 2/60 (3%)

Query: 102 CTRCG-IKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGV-RYFLKTYDKPFKRSIP 159
           C +CG IK+S +WR+ P G   LCNACGL  +KLT  +      RY  +      KR IP
Sbjct: 51  CGQCGEIKTSLQWREGPNGAACLCNACGLFFRKLTLRFGRAAAKRYMEQIKGTAAKRRIP 110

>KLTH0H06314g Chr8 complement(553271..554539) [1269 bp, 422 aa] {ON}
           some similarities with uniprot|P40209 Saccharomyces
           cerevisiae YMR136W GAT2 Protein containing GATA family
           zinc finger motifs; similar to Gln3p and Dal80p;
           expression repressed by leucine
          Length = 422

 Score = 52.4 bits (124), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 26/47 (55%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFLK 148
           C  C    +PEWRK P G  SLCNACGL  KKL + + +      +K
Sbjct: 351 CAHCSSTKTPEWRKGPCGRRSLCNACGLFYKKLVRKFGDGQASMIMK 397

>Kwal_14.1746 s14 complement(450643..451956) [1314 bp, 437 aa] {ON}
           YIR013C (GAT4) - very short and so far mRNA can't be
           detected [contig 237] FULL
          Length = 437

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 35/71 (49%), Gaps = 2/71 (2%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFLKTYDKPF--KRSIP 159
           C  C    +PEWRK P G+ SLCNACGL  KKL   +  +     +K     F   R +P
Sbjct: 364 CAHCASTKTPEWRKGPYGKRSLCNACGLFYKKLLHKFGFDQAAMIMKYRKSIFSKDRKVP 423

Query: 160 SIEELERTLNE 170
              ++  T N+
Sbjct: 424 RSFDVPSTHNQ 434

>KNAG0E02120 Chr5 complement(432952..433995) [1044 bp, 347 aa] {ON}
           Anc_2.395 YMR136W
          Length = 347

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 42/80 (52%), Gaps = 6/80 (7%)

Query: 67  NKSAEYVNFTIGQESF---VSLGPKRSTSGKNLNKFGYCTRCGIKSSPEWRKNPQGETSL 123
           N ++E  +   G E      + GP+R  S      F  C  C    +PEWR+ P G  SL
Sbjct: 225 NINSELTDLVAGSERIQQPPTTGPQRYRS--QAVPFIKCKHCQETETPEWRRGPYGNRSL 282

Query: 124 CNACGLNLKKLTKAY-SENG 142
           CNACGL  +KL K++ ++NG
Sbjct: 283 CNACGLYYRKLIKSFDTKNG 302

>Kpol_1041.26 s1041 (68074..69477) [1404 bp, 467 aa] {ON}
           (68074..69477) [1404 nt, 468 aa]
          Length = 467

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 7/94 (7%)

Query: 69  SAEYVNFTIGQESFVSLGPKRSTSGKNLNKFGYCTRCGIKSSPEWRKNPQGETSLCNACG 128
           +AE V+  + QE  ++   +++ S +       C  C  + +PEWR+ P G  +LCNACG
Sbjct: 352 AAETVDNRVSQELLLAESIRKTESYQ-----MSCVHCKEQDTPEWRRGPYGNRTLCNACG 406

Query: 129 LNLKKLTKAYSENGVRYFLKTYDK--PFKRSIPS 160
           L  +KL K +        ++   +  P  R +PS
Sbjct: 407 LFYRKLIKKFGNKQANLLMRYRREICPQDRRVPS 440

>Skud_16.312 Chr16 complement(583881..584309) [429 bp, 142 aa] {ON}
           YIR013C (REAL)
          Length = 142

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (61%), Gaps = 2/60 (3%)

Query: 102 CTRCG-IKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFL-KTYDKPFKRSIP 159
           C++C   KSS +WR+ P G + LCNACGL  +KL  A+ +   R +L +T +   KR IP
Sbjct: 73  CSQCNEKKSSSQWREGPTGRSCLCNACGLFYRKLFLAFGKQSARRYLEETRNTGAKRRIP 132

>KAFR0F02680 Chr6 (524312..525370) [1059 bp, 352 aa] {ON} Anc_2.395
           YMR136W
          Length = 352

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRY--FLKTYDK---PFKR 156
           C  C    +PEWR  P GE S+CNACGL  +KL   +   G +Y   L  Y +   P  R
Sbjct: 267 CKHCLDDDTPEWRHGPYGERSVCNACGLFHRKLVHKF---GYKYSNLLMRYRRRLNPLNR 323

Query: 157 SIPSIEEL 164
            +P+  E+
Sbjct: 324 KVPNFIEI 331

>Smik_9.213 Chr9 complement(355801..356163) [363 bp, 120 aa] {ON}
           YIR013C (REAL)
          Length = 120

 Score = 48.5 bits (114), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 102 CTRCG-IKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGV-RYFLKTYDKPFKRSIP 159
           C +CG IK+S +WR+ P G   LCNACGL  +KL   +      RY  +      KR IP
Sbjct: 52  CGQCGEIKTSLQWREGPNGAACLCNACGLFFRKLILRFGRAAAKRYMEQIKGTGTKRRIP 111

>Skud_9.191 Chr9 complement(350693..351079) [387 bp, 128 aa] {ON}
           YIR013C (REAL)
          Length = 128

 Score = 48.5 bits (114), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 102 CTRCG-IKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGV-RYFLKTYDKPFKRSIP 159
           C +CG IK+S +WR+ P G   LCNACGL  +KL   +      RY  +      KR IP
Sbjct: 60  CGQCGEIKTSLQWREGPNGAACLCNACGLFFRKLVLRFGRAAAKRYMEQIKGTGTKRRIP 119

>YIR013C Chr9 complement(380019..380384) [366 bp, 121 aa] {ON}
           GAT4Protein containing GATA family zinc finger motifs
          Length = 121

 Score = 48.1 bits (113), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 102 CTRCG-IKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGV-RYFLKTYDKPFKRSIP 159
           C +CG IK+S +WR+ P G   LCNACGL  +KL   +      RY  +      KR IP
Sbjct: 53  CGQCGEIKTSLQWREGPNGAACLCNACGLFFRKLILRFGRAAAKRYMEQIKGTGTKRRIP 112

>ZYRO0A08536g Chr1 complement(682125..683711) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P40209 Saccharomyces
           cerevisiae YMR136W GAT2
          Length = 528

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFLKTYDK---PFKRSI 158
           C  C    +PEWR+ P G  +LCNACGL  +KL K +S       ++ Y +   P  R +
Sbjct: 433 CVHCKEGITPEWRRGPYGNRTLCNACGLFYRKLIKKFSTRDANILMR-YKRQVNPEDRRV 491

Query: 159 PS 160
           PS
Sbjct: 492 PS 493

>KLLA0F09757g Chr6 (898398..899156) [759 bp, 252 aa] {ON} some
           similarities with uniprot|P40209 Saccharomyces
           cerevisiae YMR136W GAT2 Protein containing GATA family
           zinc finger motifs; similar to Gln3p and Dal80p
          Length = 252

 Score = 49.3 bits (116), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 51/113 (45%), Gaps = 17/113 (15%)

Query: 29  ETETKIGNGKKVEVITAATKNSINKVKKPNCIRKKRTLNKSAEYVNFTI--GQESFVSLG 86
           + E+ +   K+ +VI   T     ++ K +CI  +   N S  Y+N  I      F   G
Sbjct: 66  DYESIVAIQKECQVIREFTNKIRMRMIKHDCIDIQ---NNSDIYINEIIPPTWFEFKREG 122

Query: 87  PKRSTSGKNLNKFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYS 139
           PK            YC  C    + EWR  P G+ +LCNACGL  +KL K ++
Sbjct: 123 PK------------YCVHCECVETIEWRNGPWGKATLCNACGLWYRKLKKKFT 163

>Kwal_47.17849 s47 (579209..580630) [1422 bp, 473 aa] {ON} YMR136W
           (GAT2) - Similar to GATA-family of DNA binding proteins
           [contig 204] FULL
          Length = 473

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 23/37 (62%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAY 138
           C  C  K +PEWR+ P G  ++CNACGL   KL K +
Sbjct: 388 CVHCASKDTPEWRRGPYGSRTVCNACGLFYGKLVKRF 424

>Ecym_6060 Chr6 complement(114016..116175) [2160 bp, 719 aa] {ON}
           similar to Ashbya gossypii ADR249W
          Length = 719

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/57 (45%), Positives = 34/57 (59%), Gaps = 5/57 (8%)

Query: 90  STSGKNLN--KFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVR 144
           STSG +++    G C  C  + +PEWR+ P G  +LCNACGL   KL K +   GVR
Sbjct: 616 STSGTSISGANTGVCLHCHERDTPEWRRGPYGNRTLCNACGLFYNKLIKKF---GVR 669

>Ecym_3059 Chr3 complement(110013..111413) [1401 bp, 466 aa] {ON}
           similar to Ashbya gossypii AAR174W
          Length = 466

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 11/78 (14%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGV-----------RYFLKTY 150
           C +CG + + EWR  P G  S+CNACG+   KL + + E              R+  +  
Sbjct: 354 CLQCGSRDTSEWRSGPLGRKSMCNACGIWYMKLKQRFGEEDAAVIMEYRRLTNRHDDRRV 413

Query: 151 DKPFKRSIPSIEELERTL 168
            K F+  +P +E+++R +
Sbjct: 414 PKKFEVPLPEVEKVKRAI 431

>AAR174W Chr1 (657598..658980) [1383 bp, 460 aa] {ON} NOHBY117; No
           homolog in Saccharomyces cerevisiae
          Length = 460

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 11/78 (14%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGV-----------RYFLKTY 150
           C +CG + + EWR  P G  S+CNACG+   KL + + E              R+  +  
Sbjct: 342 CLQCGSRDTSEWRSGPLGRKSMCNACGIWYMKLKQRFGEEDAAVIMEYRRLTNRHDDRRV 401

Query: 151 DKPFKRSIPSIEELERTL 168
            K F+  +P +E+++R +
Sbjct: 402 PKKFEVPLPEVEKVKRAI 419

>KAFR0B05130 Chr2 complement(1053911..1055392) [1482 bp, 493 aa]
           {ON} Anc_2.395 YMR136W
          Length = 493

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 42/84 (50%), Gaps = 9/84 (10%)

Query: 84  SLGPKRSTSGKNLN-KFGY----CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAY 138
           SL  K S+   NLN ++      C  C    +PEWR+ P G  +LCNACGL  +KL K +
Sbjct: 381 SLAEKLSSQQSNLNTRYNNDKTKCLHCDEIDTPEWRRGPYGNRTLCNACGLFYRKLVKKF 440

Query: 139 SENGVRYFLKTYDK---PFKRSIP 159
                   ++ ++K   P  R IP
Sbjct: 441 GNKNANLLMR-FNKLINPEDRRIP 463

>KLTH0E09548g Chr5 (862710..864221) [1512 bp, 503 aa] {ON} weakly
           similar to uniprot|P40209 Saccharomyces cerevisiae
           YMR136W GAT2
          Length = 503

 Score = 48.9 bits (115), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 2/75 (2%)

Query: 87  PKRSTSGKNLNKFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSEN--GVR 144
           P  S   ++L +   C  C  K +PEWR+ P G  ++CNACGL   KL + +  +   + 
Sbjct: 398 PLESCMPRDLPETMECVHCSRKDTPEWRRGPYGNRTVCNACGLFYGKLVRRFGAHRANIM 457

Query: 145 YFLKTYDKPFKRSIP 159
              +    P  R +P
Sbjct: 458 MHYRRRTAPEDRRVP 472

>CAGL0I00902g Chr9 complement(67387..69090) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P40209 Saccharomyces
           cerevisiae YMR136w GAT2
          Length = 567

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVR 144
           C  CG   +PEWR+ P G  +LCNACGL  +   KA S+ GV+
Sbjct: 477 CLHCGENHTPEWRRGPYGNRTLCNACGLFYR---KAISKFGVK 516

>ADR249W Chr4 (1135915..1137792) [1878 bp, 625 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR136W (GAT2)
          Length = 625

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 2/69 (2%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFLKTYDK--PFKRSIP 159
           C  C  + +PEWR+ P G  +LCNACGL   KL K +        +    +  P  R +P
Sbjct: 536 CLHCQERDTPEWRRGPYGNRTLCNACGLFYNKLIKKFGTKEANMVMHYRRRVFPDDRRVP 595

Query: 160 SIEELERTL 168
            + E+  T 
Sbjct: 596 DVVEVPETF 604

>Suva_16.354 Chr16 complement(625042..625470) [429 bp, 142 aa] {ON}
           YIR013C (REAL)
          Length = 142

 Score = 45.8 bits (107), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 2/62 (3%)

Query: 102 CTRCG-IKSSPEWRKNPQGETSLCNACGLNLKKLTKAYS-ENGVRYFLKTYDKPFKRSIP 159
           C +C   KSS +WR+ P G + LCNACGL  +KL  A+  ++  RY  +      +R IP
Sbjct: 73  CDQCKETKSSSQWREGPTGGSCLCNACGLFYRKLFLAFGKQSAKRYLEEIKTTGARRRIP 132

Query: 160 SI 161
            I
Sbjct: 133 RI 134

>NCAS0C04570 Chr3 complement(935042..935572) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 45.8 bits (107), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 66/149 (44%), Gaps = 18/149 (12%)

Query: 40  VEVITAATKNSINKVK--KP-NCIRKKRTLNKSAEYVNFTI--GQE----SFVSLGPKRS 90
           +E +     NS + VK  KP   IRKKRT       +   +  G+E    S  S+  K +
Sbjct: 14  IEAVAREGANSGDDVKVLKPVGQIRKKRTTRFVVNIIRHHLPCGKEVESGSLTSIETKLA 73

Query: 91  TSGKNLNKFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFLKTY 150
           +    +     C +C      +WR+ P G  +LCN CGL   K+TK +        ++ +
Sbjct: 74  SKKVVVENEERCRQCSSSEIGQWRRGPYGPHTLCNKCGLFYSKVTKRFGSRSANMLMRYH 133

Query: 151 DK--------PFKRSIPSIEELERTLNEE 171
            +        P K SIP ++ +ER L +E
Sbjct: 134 REMSIEDRHVPQKCSIP-MDFVERLLADE 161

>Smik_16.268 Chr16 complement(495302..495718) [417 bp, 138 aa] {ON}
           YLR013W (REAL)
          Length = 138

 Score = 45.1 bits (105), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 102 CTRCG-IKSSPEWRKNPQGETSLCNACGLNLKKLTKAYS-ENGVRYFLKTYDKPFKRSIP 159
           C +C   K+S +WR+ P G + LCNACGL  +KL  A+  ++  RY  +  +   KR IP
Sbjct: 69  CNQCKETKTSSQWREGPTGGSCLCNACGLFYRKLFLAFGKQSAKRYLEEIKNTGAKRRIP 128

>KNAG0A05940 Chr1 complement(887824..889656) [1833 bp, 610 aa] {ON}
           Anc_2.395 YMR136W
          Length = 610

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 31/65 (47%), Gaps = 2/65 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFLK--TYDKPFKRSIP 159
           C  C    +PEWR  P G  ++CNACGL  +K+   +   G    +K   +  P  R +P
Sbjct: 520 CFHCNSSKTPEWRAGPYGNENICNACGLFYRKVITKFGVRGGNLLMKYRQHTAPTNRRVP 579

Query: 160 SIEEL 164
              E+
Sbjct: 580 PYIEI 584

>KNAG0M01200 Chr13 complement(218147..219022) [876 bp, 291 aa] {ON} 
          Length = 291

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 102 CTRCG-IKSSPEWRKNPQGET-SLCNACGLNLKKLTKAYSENGVRYFLK 148
           C+ CG ++ +PEWR  P G T  +CNACGL  +KL K +S      F++
Sbjct: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQ 249

>NCAS0D01260 Chr4 complement(229646..230641) [996 bp, 331 aa] {ON}
           Anc_2.395
          Length = 331

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSE 140
           CT C    +PEWR+ P G  +LCNACG+  +KL   +S+
Sbjct: 271 CTHCKEIDTPEWRRGPDGCRTLCNACGIFYRKLLGRFSK 309

>NDAI0G03250 Chr7 (766494..767987) [1494 bp, 497 aa] {ON} Anc_8.55
          Length = 497

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  CG  ++P WRK+P G  SLCNACGL LK
Sbjct: 367 CNNCGTGTTPLWRKDPNGN-SLCNACGLFLK 396

>NCAS0G03520 Chr7 (657612..658385) [774 bp, 257 aa] {ON} 
          Length = 257

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFLK 148
           C +CG K + +WRK P G+ +LCN CGL  +KL   +        L+
Sbjct: 169 CRQCGDKETGQWRKGPYGKRTLCNKCGLYYRKLVNDFKPKKANALLR 215

>KLLA0F25300g Chr6 (2354118..2356196) [2079 bp, 692 aa] {ON} some
           similarities with uniprot|P43574 Saccharomyces
           cerevisiae YFL021W GAT1 Transcriptional activator of
           genes involved in nitrogen catabolite repression member
           of the GATA family of DNA binding proteins activity and
           localization regulated by nitrogen limitation and Ure2p
          Length = 692

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C+ C  K++P WR++PQG   LCNACGL LK
Sbjct: 471 CSNCHTKTTPLWRRDPQGNP-LCNACGLFLK 500

>KLLA0F17116g Chr6 complement(1569192..1570367) [1176 bp, 391 aa]
           {ON} weakly similar to uniprot|P40209 Saccharomyces
           cerevisiae YMR136W GAT2
          Length = 391

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 4/72 (5%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFLKTYDK---PFKRSI 158
           C  C    +PEWR+ P G  +LCNACGL   KL + ++       +  Y K   P  R +
Sbjct: 300 CKHCHETVTPEWRRGPYGNRTLCNACGLFYCKLIRKFNTKDANILMH-YRKMKGPEDRRV 358

Query: 159 PSIEELERTLNE 170
           P    + R+  E
Sbjct: 359 PESLNVPRSFIE 370

>Ecym_1456 Chr1 complement(938648..940621) [1974 bp, 657 aa] {ON}
           similar to Ashbya gossypii AFR513C
          Length = 657

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           CT C  K++P WR++PQG   LCNACGL LK
Sbjct: 445 CTNCHTKTTPLWRRDPQG-NPLCNACGLFLK 474

>ZYRO0F03520g Chr6 (300351..301334) [984 bp, 327 aa] {ON}
           uniprot|P87016 Zygosaccharomyces rouxii SAT1 DNA-
           binding protein
          Length = 327

 Score = 43.5 bits (101), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           CT C  +++P WR++P G   LCNACGL LK
Sbjct: 246 CTHCHTRTTPLWRRDPMG-NPLCNACGLFLK 275

>YER040W Chr5 (229795..231987) [2193 bp, 730 aa] {ON}
           GLN3Transcriptional activator of genes regulated by
           nitrogen catabolite repression (NCR), localization and
           activity regulated by quality of nitrogen source
          Length = 730

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 45/92 (48%), Gaps = 6/92 (6%)

Query: 38  KKVEVITAATKNSINKVKKPNCIRKKRTLNKSAEYVNFTIGQESFVSLGPKRSTSGKNLN 97
           KK + I  ++ N+ N V+K N + K  +    A +        S  ++ P    SG+N  
Sbjct: 247 KKSDSIGLSSSNTTNSVRK-NSLIKPMSSTSLANFKRAASVSSSISNMEP----SGQNKK 301

Query: 98  KFGYCTRCGIKSSPEWRKNPQGETSLCNACGL 129
               C  C    +P WR++P+G T LCNACGL
Sbjct: 302 PLIQCFNCKTFKTPLWRRSPEGNT-LCNACGL 332

>KAFR0I01960 Chr9 (401053..401247) [195 bp, 64 aa] {ON} 
          Length = 64

 Score = 40.4 bits (93), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 23/40 (57%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSEN 141
           C  C    +P+WR  P G ++LCN CGL  K+ T+   +N
Sbjct: 25  CKMCFTLETPQWRSGPDGPSTLCNKCGLYYKRQTRKKIQN 64

>NDAI0H01910 Chr8 (467628..468887) [1260 bp, 419 aa] {ON} 
          Length = 419

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 97  NKFGYCTRCGIKSSPEWRKNPQGETS-LCNACGLNLKKLTKAYSENG----VRYFLKTYD 151
           N    C +C  + +PEWR+ P G+ + LCN CGL  +KL K + +      +R+  +  D
Sbjct: 305 NPSAKCGQCRDEETPEWRRGPYGKNNKLCNKCGLFYRKLCKRFGDYRGTAILRFRFRGRD 364

Query: 152 KPFKRSIPSIEE 163
               R +P+  E
Sbjct: 365 YKGMRDMPTTSE 376

>AFR513C Chr6 complement(1355811..1357217) [1407 bp, 468 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL021W
           (GAT1)
          Length = 468

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 23/31 (74%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C+ C  K++P WR+ PQG+  LCNACGL LK
Sbjct: 289 CSNCMTKTTPLWRRGPQGD-PLCNACGLFLK 318

>NDAI0H01740 Chr8 complement(415810..417072) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 97  NKFGYCTRCGIKSSPEWRKNPQGETS-LCNACGLNLKKLTKAYSENG----VRYFLKTYD 151
           N    C +C  + +PEWR+ P G+ + LCN CGL  +KL K + +      +R+  +  D
Sbjct: 306 NPSAKCGQCRDEETPEWRRGPYGKNNKLCNKCGLFYRKLCKRFGDYRGTAILRFRFRGRD 365

Query: 152 KPFKRSIPSIEE 163
               R +P+  E
Sbjct: 366 YKGMRDMPTTSE 377

>Suva_5.139 Chr5 (206012..208198) [2187 bp, 728 aa] {ON} YER040W
           (REAL)
          Length = 728

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 7/97 (7%)

Query: 38  KKVEVITAATKNSINKVKKPNCIRKKRTLNKSAEYVNFTIGQESFVSLGPKRSTSGKNLN 97
           KK + +  ++ N+ N V+K N + K  +    A +        +  S+ P    SG+N  
Sbjct: 246 KKSDSMGLSSSNTTNSVRK-NSLIKPMSSTSLANFKRAASVSSTMSSMEP----SGQNKK 300

Query: 98  KFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLKKL 134
               C  C    +P WR++P+G T LCNACGL  +KL
Sbjct: 301 PLIQCFNCKTFKTPLWRRSPEGNT-LCNACGL-FQKL 335

>NCAS0C03920 Chr3 (795871..797250) [1380 bp, 459 aa] {ON} Anc_8.55
          Length = 459

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C+ CG  ++P WRK+  G  SLCNACGL LK
Sbjct: 346 CSNCGTGTTPLWRKDANG-NSLCNACGLFLK 375

>KLTH0A03036g Chr1 complement(258170..260332) [2163 bp, 720 aa] {ON}
           conserved hypothetical protein
          Length = 720

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           CT C  K++P WR++PQG   LCNACGL LK
Sbjct: 461 CTNCHTKTTPLWRRDPQG-NPLCNACGLFLK 490

>KNAG0M01120 Chr13 (200158..200946) [789 bp, 262 aa] {ON} 
          Length = 262

 Score = 41.6 bits (96), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 6/68 (8%)

Query: 102 CTRC-GIKSSPEWRKNPQG-ETSLCNACGLNLKKLTKAYSE---NGVRYFLKTYDKPFKR 156
           CT C  ++ +PEWR  P G +  +CNACGL   KL   + E   N + ++ KT++    R
Sbjct: 165 CTHCNSLEKTPEWRSGPYGRKHKICNACGLFYLKLKAKFGERAANLLMHYRKTHEV-KNR 223

Query: 157 SIPSIEEL 164
            +PS+ ++
Sbjct: 224 KVPSVIDI 231

>Skud_6.50 Chr6 (99142..100554) [1413 bp, 470 aa] {ON} YFL021W
           (REAL)
          Length = 470

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C+ C   ++P WRK+P+G   LCNACGL LK
Sbjct: 269 CSNCTTSTTPLWRKDPKG-LPLCNACGLFLK 298

>TDEL0C00810 Chr3 (134908..135945) [1038 bp, 345 aa] {ON} Anc_8.55
           YFL021W
          Length = 345

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 97  NKFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           N+   C+ C  +++P WR++P G   LCNACGL LK
Sbjct: 183 NRDTRCSNCNTRTTPLWRRDPAG-NPLCNACGLFLK 217

>Kwal_47.17980 s47 complement(634203..636368) [2166 bp, 721 aa] {ON}
           YFL021W (GAT1) - transcriptional activator with
           GATA-1-type Zn finger DNA-binding motif [contig 202]
           FULL
          Length = 721

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 22/44 (50%), Positives = 28/44 (63%), Gaps = 2/44 (4%)

Query: 90  STSGKNLNKFGY-CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           S+ G  +NK    CT C  K++P WR++P G   LCNACGL LK
Sbjct: 445 SSIGSTVNKTDTKCTNCHTKTTPLWRRDPHG-NPLCNACGLFLK 487

>NDAI0B06110 Chr2 (1482402..1485524) [3123 bp, 1040 aa] {ON}
           Anc_3.539
          Length = 1040

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGL 129
           C  C    +P WR++PQG T LCNACGL
Sbjct: 377 CFNCKTTKTPLWRRDPQGNT-LCNACGL 403

>YFL021W Chr6 (95966..97498) [1533 bp, 510 aa] {ON}
           GAT1Transcriptional activator of genes involved in
           nitrogen catabolite repression; contains a GATA-1-type
           zinc finger DNA-binding motif; activity and localization
           regulated by nitrogen limitation and Ure2p
          Length = 510

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C+ C   ++P WRK+P+G   LCNACGL LK
Sbjct: 310 CSNCTTSTTPLWRKDPKG-LPLCNACGLFLK 339

>SAKL0B01826g Chr2 (179191..181242) [2052 bp, 683 aa] {ON} some
           similarities with uniprot|P43574 Saccharomyces
           cerevisiae YFL021W GAT1 Transcriptional activator of
           genes involved in nitrogen catabolite repression member
           of the GATA family of DNA binding proteins activity and
           localization regulated by nitrogen limitation and Ure2p
          Length = 683

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/31 (58%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           CT C  K++P WR++P G   LCNACGL LK
Sbjct: 423 CTNCHTKTTPLWRRDPHG-NPLCNACGLFLK 452

>Suva_6.37 Chr6 (69498..71045) [1548 bp, 515 aa] {ON} YFL021W (REAL)
          Length = 515

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 17/31 (54%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C+ C   ++P WRK+P+G   LCNACGL LK
Sbjct: 279 CSNCTTSTTPLWRKDPKG-LPLCNACGLFLK 308

>KNAG0E03370 Chr5 (674614..676113) [1500 bp, 499 aa] {ON} Anc_8.55
           YFL021W
          Length = 499

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C+ C   ++P WRK+ +G  SLCNACGL LK
Sbjct: 408 CSNCQTHNTPLWRKDAEGN-SLCNACGLFLK 437

>TBLA0E00400 Chr5 complement(73944..76853) [2910 bp, 969 aa] {ON}
           Anc_3.539 YER040W
          Length = 969

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 21/28 (75%), Gaps = 1/28 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGL 129
           C  C   ++P WR++P+G+T LCNACGL
Sbjct: 267 CENCKTVTTPLWRRDPRGKT-LCNACGL 293

>Kpol_483.22 s483 (58125..60458) [2334 bp, 777 aa] {ON}
           (58125..60458) [2334 nt, 778 aa]
          Length = 777

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGL 129
           C  C    +P WR++PQG   LCNACGL
Sbjct: 320 CANCKTSKTPLWRRDPQGNV-LCNACGL 346

>NCAS0F03840 Chr6 (769692..772187) [2496 bp, 831 aa] {ON} Anc_3.539
           YER040W
          Length = 831

 Score = 40.0 bits (92), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGL 129
           C  C    +P WR++PQG T LCNACGL
Sbjct: 307 CFNCKTFKTPLWRRDPQGNT-LCNACGL 333

>Suva_6.185 Chr6 (340566..342221) [1656 bp, 551 aa] {ON} YJL110C
           (REAL)
          Length = 551

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/145 (26%), Positives = 62/145 (42%), Gaps = 28/145 (19%)

Query: 14  NVMMADPVFNPPSQEETETKIGNGK----KVEVITAATKNSINKVKKPNC---------- 59
           NV  ++P  NP +  ++E +  NGK      E +++  K+S+ ++ KP            
Sbjct: 18  NVFESNPSENPSNPTQSEDEGHNGKWPPLGYETVSSEPKSSV-QLPKPQLNMPISNDMNF 76

Query: 60  -IRKKRTLNKSA-------EYVNFTIGQESFVSLGPKRSTSGK----NLNKFGYCTRCGI 107
            +  K   N ++         ++  + +  F S G    TSG     N      C  C  
Sbjct: 77  KVEHKALSNSTSTNTGQDVNTLHHLLPKNQFRSSGQMTDTSGDSSISNDANVPVCKNCLT 136

Query: 108 KSSPEWRKNPQGETSLCNACGLNLK 132
            ++P WR++  G   LCNACGL LK
Sbjct: 137 STTPLWRRDEHGAV-LCNACGLFLK 160

>Skud_5.149 Chr5 (227606..229801) [2196 bp, 731 aa] {ON} YER040W
           (REAL)
          Length = 731

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 7/97 (7%)

Query: 38  KKVEVITAATKNSINKVKKPNCIRKKRTLNKSAEYVNFTIGQESFVSLGPKRSTSGKNLN 97
           KK + +  ++ N+ N V+K N + K  +    A +        S  ++ P    SG++  
Sbjct: 247 KKNDSMGLSSSNTTNSVRK-NSLIKPMSSTSLANFKRAASVSSSMSNVEP----SGQSKK 301

Query: 98  KFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLKKL 134
               C  C    +P WR++P+G T LCNACGL  +KL
Sbjct: 302 PLIQCFNCKTFKTPLWRRSPEGNT-LCNACGL-FQKL 336

>SAKL0F01496g Chr6 complement(124251..126668) [2418 bp, 805 aa] {ON}
           some similarities with uniprot|P18494 Saccharomyces
           cerevisiae YER040W GLN3 Transcriptional activator of
           genes regulated by nitrogen catabolite repression (NCR)
           localization and activity regulated by quality of
           nitrogen source
          Length = 805

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 2/33 (6%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKL 134
           C  C    +P WR++PQG T LCNACGL  +KL
Sbjct: 294 CFNCKTFKTPLWRRDPQGNT-LCNACGL-FQKL 324

>NDAI0B05160 Chr2 (1264852..1265931) [1080 bp, 359 aa] {ON}
           Anc_1.250
          Length = 359

 Score = 39.3 bits (90), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 101 YCTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           +C  C  +++P WR++  G T LCNACGL LK
Sbjct: 116 HCRNCFTQNTPLWRRDDMG-TVLCNACGLFLK 146

>CAGL0G04389g Chr7 complement(413376..414764) [1389 bp, 462 aa] {ON}
           some similarities with uniprot|P42944 Saccharomyces
           cerevisiae YJL110c GZF3 transcriptional repressor
          Length = 462

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 5/41 (12%)

Query: 96  LNKFG----YCTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           +++FG     C  C   ++P WR++ QG   LCNACGL LK
Sbjct: 73  VSEFGNSAPVCKNCMTSTTPLWRRDEQGSV-LCNACGLFLK 112

>Smik_6.57 Chr6 (111118..112689) [1572 bp, 523 aa] {ON} YFL021W
           (REAL)
          Length = 523

 Score = 39.3 bits (90), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/31 (54%), Positives = 22/31 (70%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C+ C   ++P WRK+P+G   LCNACGL LK
Sbjct: 316 CSNCTTSTTPLWRKDPKG-LPLCNACGLFLK 345

>KNAG0F03415 Chr6 (646275..647036) [762 bp, 253 aa] {ON}
          Length = 253

 Score = 38.9 bits (89), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 4/67 (5%)

Query: 102 CTRCG-IKSSPEWRKNPQGE-TSLCNACGLNLKKLTKAYSENGVRYFLKTYDK--PFKRS 157
           C  C  + ++PEWR  P G    +CNACGL  +KL + +        ++   K  P  R+
Sbjct: 171 CPHCSTVSATPEWRSGPYGNNVRICNACGLFYRKLKQKFGLKKANLLMQYRRKNCPRDRN 230

Query: 158 IPSIEEL 164
           +P   E+
Sbjct: 231 MPHSVEV 237

>CAGL0C02277g Chr3 complement(230496..232967) [2472 bp, 823 aa] {ON}
           weakly similar to uniprot|P18494 Saccharomyces
           cerevisiae YER040w GLN3 transcription factor for
           positive nitrogen regulation
          Length = 823

 Score = 38.5 bits (88), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 2/34 (5%)

Query: 101 YCTRCGIKSSPEWRKNPQGETSLCNACGLNLKKL 134
           +C  C    +P WR++P+G+  LCNACGL  +KL
Sbjct: 337 HCDNCKTYKTPLWRRSPEGKV-LCNACGL-FQKL 368

>KAFR0C03380 Chr3 complement(688344..689252) [909 bp, 302 aa] {ON}
           Anc_8.55 YFL021W
          Length = 302

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C   ++P WRK+ +G   LCNACGL L+
Sbjct: 204 CHNCQTSTTPLWRKDSEGHP-LCNACGLFLR 233

>KNAG0C01440 Chr3 complement(282044..283426) [1383 bp, 460 aa] {ON}
           Anc_1.250 YJL110C
          Length = 460

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C   ++P WR++ +G T LCNACGL LK
Sbjct: 179 CKNCATVNTPLWRRDNEGNT-LCNACGLFLK 208

>Smik_5.164 Chr5 (234546..236747) [2202 bp, 733 aa] {ON} YER040W
           (REAL)
          Length = 733

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 2/33 (6%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKL 134
           C  C    +P WR++P+G T LCNACGL  +KL
Sbjct: 309 CFNCKTFKTPLWRRSPEGNT-LCNACGL-FQKL 339

>Kpol_1011.14 s1011 complement(30640..30891,30894..31928) [1287 bp,
           428 aa] {ON} complement(30640..30891,30894..31928) [1287
           nt, 429 aa]
          Length = 428

 Score = 38.1 bits (87), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGL 129
           CT C   ++P WR++P G   LCNACGL
Sbjct: 366 CTNCETTNTPLWRRDPIGR-PLCNACGL 392

>KNAG0B01620 Chr2 complement(296633..298093) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 71  EYVNFTIGQESFVSLGPKRSTSGKNLNKFGYCTRCGIKSSPEWRKNPQGETSLCNACGLN 130
           +  N   G+  F + GP +     N++    C  C   ++P WR++  G   LCNACGL 
Sbjct: 56  QSANSASGKLLFRNTGPNQVL---NMSNSSVCKNCLTSTTPLWRRDENGSV-LCNACGLF 111

Query: 131 LK 132
           LK
Sbjct: 112 LK 113

>KAFR0A03410 Chr1 complement(695254..696264) [1011 bp, 336 aa] {ON}
           Anc_1.250 YJL110C
          Length = 336

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 101 YCTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           +C+ C   ++P WR++  G   LCNACGL LK
Sbjct: 117 HCSNCLTTTTPLWRRDLDGNI-LCNACGLFLK 147

>CAGL0K07634g Chr11 complement(754675..756054) [1380 bp, 459 aa]
           {ON} weakly similar to uniprot|P43574 Saccharomyces
           cerevisiae YFL021w transcriptional regulatory protein
           GAT1
          Length = 459

 Score = 37.7 bits (86), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           CT CG  ++P WRK+      LCNACGL  K
Sbjct: 258 CTNCGTTNTPLWRKD-IDRKPLCNACGLFFK 287

>Smik_10.128 Chr10 complement(201424..203082) [1659 bp, 552 aa] {ON}
           YJL110C (REAL)
          Length = 552

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C   ++P WR++  G   LCNACGL LK
Sbjct: 131 CRNCSTSTTPLWRRDEHGAV-LCNACGLFLK 160

>KLLA0B02651g Chr2 (233553..234935) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P34233 Saccharomyces cerevisiae
           YKL185W ASH1 Zinc-finger inhibitor of HO transcription
           mRNA is localized and translated in the distal tip of
           anaphase cells resulting in accumulation of Ash1p in
           daughter cell nuclei and inhibition of HO expression
           potential Cdc28p substrate
          Length = 460

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 3/56 (5%)

Query: 80  ESFVSLGPKRSTSGKNLNKFGYCTRCGIKSSPEWRK--NPQGETSLCNACGLNLKK 133
           +  V   PK S + +  N   +C  C I  SP WR   +   +  LCN+CGL  KK
Sbjct: 352 QELVQTSPKSSPTQRR-NSHRFCVSCHITDSPCWRPSWSKSKQDQLCNSCGLRYKK 406

>ZYRO0E08910g Chr5 (711088..713649) [2562 bp, 853 aa] {ON} some
           similarities with uniprot|P18494 Saccharomyces
           cerevisiae YER040W GLN3 Transcriptional activator of
           genes regulated by nitrogen catabolite repression (NCR)
           localization and activity regulated by quality of
           nitrogen source
          Length = 853

 Score = 37.7 bits (86), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 14/92 (15%)

Query: 43  ITAATKNSINKVKKPNCIRKKRTLNKSAEYVNFTIGQESFVSLGPKRSTSGKNLNKFGYC 102
           I  ++  + N VKK + +R+      S    N+  G  S +   PK+            C
Sbjct: 278 IALSSSTTTNSVKKNSLVRQV----SSTSLSNYKRGSSSGIPDLPKKPPI--------QC 325

Query: 103 TRCGIKSSPEWRKNPQGETSLCNACGLNLKKL 134
             C    +P WR++ QG T +CNACGL  +KL
Sbjct: 326 YNCKTNKTPLWRRDAQGNT-MCNACGL-FQKL 355

>Kpol_1058.27 s1058 (80407..81861) [1455 bp, 484 aa] {ON}
           (80407..81861) [1455 nt, 485 aa]
          Length = 484

 Score = 37.0 bits (84), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGL 129
           C  C   ++P WR++P G   LCNACGL
Sbjct: 400 CDNCKTTNTPLWRRDPIGN-PLCNACGL 426

>Ecym_6365 Chr6 (722796..724517) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR069C
          Length = 573

 Score = 37.4 bits (85), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C   ++P WR++  G   LCNACGL LK
Sbjct: 126 CKNCHTSTTPLWRRDEHGAV-LCNACGLFLK 155

>Ecym_2569 Chr2 (1112550..1115093) [2544 bp, 847 aa] {ON} similar to
           Ashbya gossypii AFR237W
          Length = 847

 Score = 37.4 bits (85), Expect = 0.013,   Method: Composition-based stats.
 Identities = 16/28 (57%), Positives = 19/28 (67%), Gaps = 1/28 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGL 129
           C  C    +P WR++PQG T LCNACGL
Sbjct: 340 CFNCKTYKTPLWRRDPQGNT-LCNACGL 366

>KLTH0E15488g Chr5 (1377607..1379232) [1626 bp, 541 aa] {ON} some
           similarities with uniprot|P42944 Saccharomyces
           cerevisiae YJL110C GZF3 GATA zinc finger protein and
           Dal80p homolog that negatively regulates nitrogen
           catabolic gene expression by competing with Gat1p for
           GATA site binding function requires a repressive carbon
           source dimerizes with Dal80p and binds to Tor1p
          Length = 541

 Score = 37.0 bits (84), Expect = 0.014,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 24/47 (51%), Gaps = 1/47 (2%)

Query: 86  GPKRSTSGKNLNKFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           G K + S  N      C  C   ++P WR+N  G   LCNACGL LK
Sbjct: 13  GAKPAESNGNAAGSPMCKNCHTLTTPLWRRNEHGAV-LCNACGLFLK 58

>KAFR0J00320 Chr10 complement(52668..54641) [1974 bp, 657 aa] {ON}
           Anc_3.539 YER040W
          Length = 657

 Score = 37.0 bits (84), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGL 129
           C  C    +P WR++P G  +LCNACGL
Sbjct: 259 CFNCKTLKTPLWRRDPNGN-ALCNACGL 285

>NCAS0B07810 Chr2 (1483287..1483889) [603 bp, 200 aa] {ON} Anc_1.250
          Length = 200

 Score = 36.6 bits (83), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C    +P WR++  G T LCNACGL LK
Sbjct: 25  CQNCSATRTPLWRRDLNG-TVLCNACGLFLK 54

>SAKL0G16192g Chr7 complement(1399297..1400868) [1572 bp, 523 aa]
           {ON} similar to uniprot|P34233 Saccharomyces cerevisiae
           YKL185W ASH1 Zinc-finger inhibitor of HO transcription
           mRNA is localized and translated in the distal tip of
           anaphase cells resulting in accumulation of Ash1p in
           daughter cell nuclei and inhibition of HO expression
           potential Cdc28p substrate
          Length = 523

 Score = 37.0 bits (84), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 75  FTIGQESFVSLGP---KRSTSGKNLNKFGYCTRCGIKSSPEWRKNPQG--ETSLCNACGL 129
           +T  + S VS  P   K ++S +N N+   C  C    SP WR +  G  +  LCN+CGL
Sbjct: 408 YTHNEFSAVSSSPQQKKHTSSRRNSNR--SCVSCHSSDSPCWRPSWSGRKQDQLCNSCGL 465

Query: 130 NLKK 133
             KK
Sbjct: 466 RYKK 469

>Kwal_27.12655 s27 (1320535..1322217) [1683 bp, 560 aa] {ON} YJL110C
           (GZF3) - GATA zinc finger protein 3 homologous to Dal80
           in structure and function [contig 260] FULL
          Length = 560

 Score = 37.0 bits (84), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C   ++P WR+N  G   LCNACGL LK
Sbjct: 29  CKNCHTLTTPLWRRNEHGAV-LCNACGLFLK 58

>SAKL0D04928g Chr4 complement(379886..381064) [1179 bp, 392 aa] {ON}
           weakly similar to uniprot|P42944 Saccharomyces
           cerevisiae YJL110C GZF3 GATA zinc finger protein and
           Dal80p homolog that negatively regulates nitrogen
           catabolic gene expression by competing with Gat1p for
           GATA site binding function requires a repressive carbon
           source dimerizes with Dal80p and binds to Tor1p
          Length = 392

 Score = 36.6 bits (83), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C   ++P WR++  G   LCNACGL LK
Sbjct: 33  CKNCHTSTTPLWRRDEHGAV-LCNACGLFLK 62

>Kpol_1055.57 s1055 (146707..148440) [1734 bp, 577 aa] {ON}
           (146707..148440) [1734 nt, 578 aa]
          Length = 577

 Score = 36.6 bits (83), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 4/54 (7%)

Query: 84  SLGPKRSTSGKNLNKFGY--CTRCGIKSSPEWRKNPQG--ETSLCNACGLNLKK 133
           S+ P+R ++G N        C  C    SP WR +  G     LCN+CGL  KK
Sbjct: 383 SITPRRKSNGSNPQTLNIRKCVSCQSSDSPCWRPSWSGKKHEQLCNSCGLRYKK 436

>KLLA0F21296g Chr6 (1990998..1992512) [1515 bp, 504 aa] {ON} some
           similarities with uniprot|P42944 Saccharomyces
           cerevisiae YJL110C GZF3 GATA zinc finger protein and
           Dal80p homolog that negatively regulates nitrogen
           catabolic gene expression by competing with Gat1p for
           GATA site binding function requires a repressive carbon
           source dimerizes with Dal80p and binds to Tor1p
          Length = 504

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C   ++P WR++  G   LCNACGL LK
Sbjct: 84  CKNCYTSTTPLWRRDEHGSV-LCNACGLFLK 113

>Suva_11.266 Chr11 (490833..491654) [822 bp, 273 aa] {ON} YKR034W
           (REAL)
          Length = 273

 Score = 36.2 bits (82), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C    +P WR++  G T LCNACGL LK
Sbjct: 32  CQNCFTVKTPLWRRDEHG-TVLCNACGLFLK 61

>NCAS0A09600 Chr1 (1918722..1919969) [1248 bp, 415 aa] {ON}
           Anc_1.250
          Length = 415

 Score = 36.6 bits (83), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 99  FGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
              C  C   ++P WR++  G   LCNACGL LK
Sbjct: 100 LSVCKNCLTSTTPLWRRDENGAV-LCNACGLFLK 132

>Smik_11.296 Chr11 (496172..496981) [810 bp, 269 aa] {ON} YKR034W
           (REAL)
          Length = 269

 Score = 36.2 bits (82), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C    +P WR++  G T LCNACGL LK
Sbjct: 31  CQNCFTVKTPLWRRDEHG-TVLCNACGLFLK 60

>Skud_11.269 Chr11 (489067..489873) [807 bp, 268 aa] {ON} YKR034W
           (REAL)
          Length = 268

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C    +P WR++  G T LCNACGL LK
Sbjct: 31  CQNCFTVKTPLWRRDEHG-TVLCNACGLFLK 60

>AFR069C Chr6 complement(546145..547071) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKR034W
           (DAL80) and YJL110C (GZF3)
          Length = 308

 Score = 36.2 bits (82), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C   ++P WR++  G   LCNACGL LK
Sbjct: 42  CQNCHTSTTPLWRRDEHGAV-LCNACGLFLK 71

>YKR034W Chr11 (506898..507707) [810 bp, 269 aa] {ON}  DAL80Negative
           regulator of genes in multiple nitrogen degradation
           pathways; expression is regulated by nitrogen levels and
           by Gln3p; member of the GATA-binding family, forms
           homodimers and heterodimers with Deh1p
          Length = 269

 Score = 35.8 bits (81), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C    +P WR++  G T LCNACGL LK
Sbjct: 31  CQNCFTVKTPLWRRDEHG-TVLCNACGLFLK 60

>Kpol_1016.12 s1016 complement(29363..30892) [1530 bp, 509 aa] {ON}
           complement(29363..30892) [1530 nt, 510 aa]
          Length = 509

 Score = 36.2 bits (82), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 4/48 (8%)

Query: 88  KRSTSGKNLNK---FGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           K ++  +N NK      C  C    +P WR++  G   LCNACGL LK
Sbjct: 95  KEASDSENDNKNQQLSVCKNCLTSKTPLWRRDENGAI-LCNACGLFLK 141

>YPL021W Chr16 (511101..511664) [564 bp, 187 aa] {ON}
           ECM23Non-essential protein of unconfirmed function;
           affects pre-rRNA processing, may act as a negative
           regulator of the transcription of genes involved in
           pseudohyphal growth; homologous to Srd1p
          Length = 187

 Score = 35.4 bits (80), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 6/52 (11%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKK------LTKAYSENGVRYFL 147
           C  CG   + +WR  P G   LC+ CG+  +K       ++  S++G + F+
Sbjct: 132 CATCGDTWTSQWRSGPNGNVELCSRCGIAYRKKMEKKIRSQQSSDDGTKNFI 183

>Skud_10.104 Chr10 complement(177748..179397) [1650 bp, 549 aa] {ON}
           YJL110C (REAL)
          Length = 549

 Score = 36.2 bits (82), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C   ++P WR++  G   LCNACGL LK
Sbjct: 131 CKNCLTSTTPLWRRDEHGAV-LCNACGLFLK 160

>TDEL0E00870 Chr5 (179193..180722) [1530 bp, 509 aa] {ON} Anc_4.283
           YKL185W
          Length = 509

 Score = 35.8 bits (81), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 29/65 (44%), Gaps = 7/65 (10%)

Query: 76  TIGQESFVS---LGPKR--STSGKNLNKFGYCTRCGIKSSPEWRKNPQG--ETSLCNACG 128
           TI Q S+ S     PKR  S+ G        C  C    SP WR +  G     LCN+CG
Sbjct: 384 TIKQSSYHSSTKTTPKRRRSSGGSTHGTVRKCVSCHSNDSPCWRPSWSGKKHDQLCNSCG 443

Query: 129 LNLKK 133
           L  KK
Sbjct: 444 LRYKK 448

>Skud_16.261 Chr16 (475931..476494) [564 bp, 187 aa] {ON} YPL021W
           (REAL)
          Length = 187

 Score = 35.4 bits (80), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKK 133
           C  CG   + +WR  P+G   LC+ CG+  +K
Sbjct: 132 CATCGDTWTSQWRSGPEGNVELCSRCGIAYRK 163

>TDEL0D06070 Chr4 (1095543..1097978) [2436 bp, 811 aa] {ON}
           Anc_3.539 YER040W
          Length = 811

 Score = 36.2 bits (82), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGL 129
           C  C  + +P WR++  G T LCNACGL
Sbjct: 327 CFNCKTQKTPLWRRDSHGNT-LCNACGL 353

>TBLA0I03360 Chr9 (812803..815988) [3186 bp, 1061 aa] {ON} Anc_3.539
           YER040W
          Length = 1061

 Score = 35.8 bits (81), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 39/82 (47%), Gaps = 18/82 (21%)

Query: 54  VKKPNCIRKKRTLNKSAEYVNFTIGQESFVSL--GPKRS--TSGKNLNKFG--YCTRCGI 107
           +  PN IRK           N  I Q S  SL  G K++  T+  +LN+     C  C  
Sbjct: 380 ISTPNSIRK-----------NTIIKQISSSSLSGGFKKASLTTSIDLNRKQQIVCGNCKT 428

Query: 108 KSSPEWRKNPQGETSLCNACGL 129
             +P WR++  G T LCNACGL
Sbjct: 429 TKTPLWRRDNDGNT-LCNACGL 449

>Suva_16.297 Chr16 (514206..514745) [540 bp, 179 aa] {ON} YPL021W
           (REAL)
          Length = 179

 Score = 35.0 bits (79), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 17/32 (53%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKK 133
           C  CG   + +WR  P G   LC+ CG+  +K
Sbjct: 124 CAACGDTWTSQWRSGPDGNVELCSRCGIAYRK 155

>YJL110C Chr10 complement(209922..211577) [1656 bp, 551 aa] {ON}
           GZF3GATA zinc finger protein and Dal80p homolog that
           negatively regulates nitrogen catabolic gene expression
           by competing with Gat1p for GATA site binding; function
           requires a repressive carbon source; dimerizes with
           Dal80p and binds to Tor1p
          Length = 551

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C   ++P WR++  G   LCNACGL LK
Sbjct: 131 CKNCLTSTTPLWRRDEHGAM-LCNACGLFLK 160

>KAFR0A01310 Chr1 complement(250863..252245) [1383 bp, 460 aa] {ON}
           Anc_1.250 YJL110C
          Length = 460

 Score = 35.8 bits (81), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 101 YCTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
            C  C   ++P WR++  G   LCNACGL LK
Sbjct: 84  VCKNCLTSTTPLWRRDENGAV-LCNACGLFLK 114

>TPHA0A05930 Chr1 (1340674..1343112) [2439 bp, 812 aa] {ON}
           Anc_3.539 YER040W
          Length = 812

 Score = 35.8 bits (81), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 1/28 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGL 129
           C  C    +P WR++ QG   LCNACGL
Sbjct: 331 CANCKTFKTPLWRRDAQGNI-LCNACGL 357

>Smik_16.214 Chr16 (388331..388849) [519 bp, 172 aa] {ON} YPL021W
           (REAL)
          Length = 172

 Score = 35.0 bits (79), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 17/32 (53%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKK 133
           C  CG   + +WR  P G   LC+ CG+  +K
Sbjct: 132 CATCGDTWTSQWRSGPNGNVELCSRCGIAYRK 163

>TBLA0D05530 Chr4 (1360138..1361565) [1428 bp, 475 aa] {ON}
           Anc_1.250 YJL110C
          Length = 475

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C   ++P WR++  G   LCNACGL LK
Sbjct: 60  CKNCFTTNTPLWRRDENGSI-LCNACGLFLK 89

>KAFR0G03380 Chr7 complement(696148..697764) [1617 bp, 538 aa] {ON}
           Anc_4.283 YKL185W
          Length = 538

 Score = 35.4 bits (80), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 2/34 (5%)

Query: 102 CTRCGIKSSPEWRKN--PQGETSLCNACGLNLKK 133
           C  C    SP WR +  P+ +  LCN+CGL  KK
Sbjct: 451 CVSCHTSDSPCWRPSWSPRKQDQLCNSCGLRYKK 484

>SAKL0E12276g Chr5 complement(1016243..1016740) [498 bp, 165 aa]
           {ON} no similarity
          Length = 165

 Score = 34.7 bits (78), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C  + +P WR++  G  S+CNACGL LK
Sbjct: 80  CFNCHTRQTPLWRRDAVGR-SICNACGLYLK 109

 Score = 33.1 bits (74), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 2/37 (5%)

Query: 102 CTRCGIKSSPEWRKNPQGET--SLCNACGLNLKKLTK 136
           C  CG  S+P WRK P   +   +CNACGL  K   K
Sbjct: 18  CGNCGTTSTPLWRKPPPDISFQRICNACGLYYKSRGK 54

>TPHA0B01250 Chr2 complement(278851..280035) [1185 bp, 394 aa] {ON}
           Anc_1.250 YJL110C
          Length = 394

 Score = 35.0 bits (79), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 89  RSTSGKNLNKFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
            S+S ++L+K   C  C    +P WR++  G   LCNACGL LK
Sbjct: 32  HSSSYEDLDK-PVCNNCLTSKTPLWRRDEFGSI-LCNACGLFLK 73

>KLLA0A01342g Chr1 complement(120385..122730) [2346 bp, 781 aa] {ON}
           some similarities with uniprot|P18494 Saccharomyces
           cerevisiae YER040W GLN3 Transcriptional activator of
           genes regulated by nitrogen catabolite repression (NCR)
           localization and activity regulated by quality of
           nitrogen source
          Length = 781

 Score = 35.4 bits (80), Expect = 0.060,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 36/83 (43%), Gaps = 2/83 (2%)

Query: 47  TKNSINKVKKPNCIRKKRTLNKSAEYVNFTIGQESFVSLGPKRSTSGKNLNKFGYCTRCG 106
           T  + N VKK + ++   T     +Y   +      V  GP  +   K       C  C 
Sbjct: 295 THTTTNLVKKNSSVKNLPT-TTLPQYRRCSSSTNMQVMNGPPVNNGAKANKPPTQCYNCK 353

Query: 107 IKSSPEWRKNPQGETSLCNACGL 129
              +P WR++P G T LCNACGL
Sbjct: 354 TLKTPLWRRDPDGNT-LCNACGL 375

>ZYRO0D03894g Chr4 complement(315134..316468) [1335 bp, 444 aa] {ON}
           some similarities with uniprot|P42944 Saccharomyces
           cerevisiae YJL110C GZF3 GATA zinc finger protein and
           Dal80p homolog that negatively regulates nitrogen
           catabolic gene expression by competing with Gat1p for
           GATA site binding function requires a repressive carbon
           source dimerizes with Dal80p and binds to Tor1p
          Length = 444

 Score = 34.7 bits (78), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 92  SGKNLNKFG-YCTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           S  N+N     C  C   ++P WR++  G   LCNACGL LK
Sbjct: 90  SNPNVNSHNTVCKNCFTVTTPLWRRDENGAV-LCNACGLFLK 130

>ZYRO0B13134g Chr2 complement(1065215..1066915) [1701 bp, 566 aa]
           {ON} weakly similar to uniprot|P34233 Saccharomyces
           cerevisiae YKL185W ASH1 Zinc-finger inhibitor of HO
           transcription mRNA is localized and translated in the
           distal tip of anaphase cells resulting in accumulation
           of Ash1p in daughter cell nuclei and inhibition of HO
           expression potential Cdc28p substrate
          Length = 566

 Score = 34.7 bits (78), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 5/46 (10%)

Query: 90  STSGKNLNKFGYCTRCGIKSSPEWRKNPQG--ETSLCNACGLNLKK 133
           STS   L K   C  C    SP WR +  G  +  LCN+CGL  KK
Sbjct: 460 STSSHGLRK---CVSCHSSDSPCWRPSWSGRKQDQLCNSCGLRYKK 502

>NDAI0G05350 Chr7 complement(1304235..1305548) [1314 bp, 437 aa]
           {ON} Anc_1.250
          Length = 437

 Score = 34.7 bits (78), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C   ++P WR++  G   LCNACGL LK
Sbjct: 117 CKNCLTSTTPLWRRDESGAM-LCNACGLFLK 146

>YKL185W Chr11 (94499..96265) [1767 bp, 588 aa] {ON}
           ASH1Zinc-finger inhibitor of HO transcription; mRNA is
           localized and translated in the distal tip of anaphase
           cells, resulting in accumulation of Ash1p in daughter
           cell nuclei and inhibition of HO expression; potential
           Cdc28p substrate
          Length = 588

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 2/34 (5%)

Query: 102 CTRCGIKSSPEWRKN--PQGETSLCNACGLNLKK 133
           C  C    SP WR +  P+ +  LCN+CGL  KK
Sbjct: 499 CVSCHSSDSPCWRPSWSPRKQDQLCNSCGLRYKK 532

>Skud_11.41 Chr11 (80890..82671) [1782 bp, 593 aa] {ON} YKL185W
           (REAL)
          Length = 593

 Score = 34.3 bits (77), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 2/34 (5%)

Query: 102 CTRCGIKSSPEWRKN--PQGETSLCNACGLNLKK 133
           C  C    SP WR +  P+ +  LCN+CGL  KK
Sbjct: 504 CVSCHSSDSPCWRPSWSPRKQDQLCNSCGLRYKK 537

>Smik_11.45 Chr11 (80029..81801) [1773 bp, 590 aa] {ON} YKL185W
           (REAL)
          Length = 590

 Score = 34.3 bits (77), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 2/34 (5%)

Query: 102 CTRCGIKSSPEWRKN--PQGETSLCNACGLNLKK 133
           C  C    SP WR +  P+ +  LCN+CGL  KK
Sbjct: 501 CVSCNSSDSPCWRPSWSPRKQDQLCNSCGLRYKK 534

>TDEL0D01280 Chr4 (247241..248317) [1077 bp, 358 aa] {ON} Anc_1.250
           YJL110C
          Length = 358

 Score = 34.3 bits (77), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           C  C   ++P WR++  G   LCNACGL LK
Sbjct: 70  CKNCLTSTTPLWRRDENGAL-LCNACGLFLK 99

>KNAG0D02830 Chr4 (512472..514739) [2268 bp, 755 aa] {ON} Anc_3.539
           YER040W
          Length = 755

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 2/33 (6%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKL 134
           C  C    +P WR++  G T LCNACGL  +KL
Sbjct: 336 CFNCKTFKTPLWRRDTDGNT-LCNACGL-FQKL 366

>AFR237W Chr6 (866798..869221) [2424 bp, 807 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER040W (GLN3)
          Length = 807

 Score = 33.9 bits (76), Expect = 0.16,   Method: Composition-based stats.
 Identities = 15/28 (53%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGL 129
           C  C    +P WR++ QG T LCNACGL
Sbjct: 330 CFNCKTFKTPLWRRDLQGNT-LCNACGL 356

>CAGL0D00462g Chr4 (55305..57443) [2139 bp, 712 aa] {ON} weakly
           similar to uniprot|P34233 Saccharomyces cerevisiae
           YKL185w ASH1 negative regulator of HO transcription
          Length = 712

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 26/52 (50%), Gaps = 7/52 (13%)

Query: 89  RSTSGKNLNKFGY-----CTRCGIKSSPEWRKNPQGETS--LCNACGLNLKK 133
           +S SG N  K G      C  C    SP WR +  G+ +  LCN+CGL  KK
Sbjct: 607 KSKSGSNSPKNGAYHLRKCVSCNSSDSPCWRPSWSGKKTEQLCNSCGLRYKK 658

>KLTH0G01320g Chr7 complement(95197..97431) [2235 bp, 744 aa] {ON}
           weakly similar to uniprot|P18494 Saccharomyces
           cerevisiae YER040W GLN3 Transcriptional activator of
           genes regulated by nitrogen catabolite repression (NCR)
           localization and activity regulated by quality of
           nitrogen source
          Length = 744

 Score = 33.5 bits (75), Expect = 0.25,   Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGL 129
           C  C    +P WR++ QG T +CNACGL
Sbjct: 257 CFNCKTFKTPLWRRDAQGNT-MCNACGL 283

>CAGL0L03157g Chr12 (367003..367563) [561 bp, 186 aa] {ON} some
           similarities with uniprot|P42944 Saccharomyces
           cerevisiae YJL110c GZF3 transcriptional repressor
          Length = 186

 Score = 32.3 bits (72), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGL 129
           C  C    +P WR++  G + LCNACGL
Sbjct: 26  CKNCLTSHTPLWRRDKDG-SMLCNACGL 52

>Kwal_47.19160 s47 (1115610..1117646) [2037 bp, 678 aa] {ON} YER040W
           (GLN3) - Transcriptional activator of nitrogen-regulated
           genes [contig 344] FULL
          Length = 678

 Score = 32.7 bits (73), Expect = 0.40,   Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (3%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGL 129
           C  C    +P WR++ QG T +CNACGL
Sbjct: 240 CFNCKTFKTPLWRRDAQGNT-MCNACGL 266

>TBLA0H03010 Chr8 (739587..740201) [615 bp, 204 aa] {ON} Anc_1.250
           YJL110C
          Length = 204

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 2/33 (6%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKL 134
           C  C   ++P WR++ +    LCNACGL  KKL
Sbjct: 25  CANCKTTATPLWRRD-EDLNVLCNACGL-FKKL 55

>NDAI0D04580 Chr4 complement(1075178..1077607) [2430 bp, 809 aa]
           {ON} Anc_4.283
          Length = 809

 Score = 31.6 bits (70), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 5/58 (8%)

Query: 78  GQESFVSLGPKRSTSGKNLNKFGYCTRCGIKSSPEWRKN--PQGETSLCNACGLNLKK 133
           G  +     P++ T  ++L +   C  C    SP WR +        LCN+CGL  KK
Sbjct: 700 GTNNSAGTSPRQHTHQQHLRR---CVSCRSSDSPCWRPSWSKMKHDQLCNSCGLRYKK 754

>TPHA0B02010 Chr2 (456137..457930) [1794 bp, 597 aa] {ON} Anc_4.283
           YKL185W
          Length = 597

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 2/48 (4%)

Query: 88  KRSTSGKNLNKFGYCTRCGIKSSPEWRKN--PQGETSLCNACGLNLKK 133
           KRS           C  C    SP WR +   +    LCN+CGL L+K
Sbjct: 475 KRSNGSPQHMHIRKCLSCNSSDSPCWRPSWSSKKHDQLCNSCGLRLQK 522

>Suva_11.39 Chr11 (79211..81007) [1797 bp, 598 aa] {ON} YKL185W
           (REAL)
          Length = 598

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 2/34 (5%)

Query: 102 CTRCGIKSSPEWRKN--PQGETSLCNACGLNLKK 133
           C  C    SP WR +   + +  LCN+CGL  KK
Sbjct: 509 CVSCHSSDSPCWRPSWSSRKQDQLCNSCGLRYKK 542

>Smik_3.106 Chr3 complement(148337..149002) [666 bp, 221 aa] {ON}
           YCR018C (REAL)
          Length = 221

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSENGVRYFLKTYDK 152
           C++C    + +WR  P+    LC+ CGL   K  K  +E   R   +T ++
Sbjct: 168 CSKCKDTWTIQWRSGPEQNRELCSPCGLAYGKRLKKENEKKRRAVDETREQ 218

>Ecym_4553 Chr4 (1088872..1091280) [2409 bp, 802 aa] {ON} similar to
           Ashbya gossypii AFR389C
          Length = 802

 Score = 30.8 bits (68), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 72  YVNFTIGQESFVSLGPKRSTSGKNLNKFGYCTRCGIKSSP---EWRKNPQGETSLCNA 126
           Y NFT     FVS   KR ++  N+N     TR   KS+    ++++N  GE  + +A
Sbjct: 655 YSNFTFEAIRFVSSAFKRGSNSGNMNHSARLTRSARKSNQIINDFKENSNGEVDVEDA 712

>AER088C Chr5 complement(804332..805519) [1188 bp, 395 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL185W
           (ASH1)
          Length = 395

 Score = 30.4 bits (67), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 5/59 (8%)

Query: 77  IGQESFVSLGPKRSTSGKNLNKFGYCTRCGIKSSPEWRKN--PQGETSLCNACGLNLKK 133
           + Q     +GP+  +   ++ +   C  C    SP WR +   + +  LCN+CGL  KK
Sbjct: 286 LAQLVRTPMGPRTPSRRASMRR---CLSCHCTESPCWRPSWSDRRQDQLCNSCGLRYKK 341

>Ecym_3236 Chr3 (440796..442328) [1533 bp, 510 aa] {ON} similar to
           Ashbya gossypii AER088C
          Length = 510

 Score = 30.4 bits (67), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 2/34 (5%)

Query: 102 CTRCGIKSSPEWRKN--PQGETSLCNACGLNLKK 133
           C  C    SP WR +   + +  LCN+CGL  KK
Sbjct: 423 CLSCHCTDSPCWRPSWSDKKQDQLCNSCGLRYKK 456

>NDAI0A07140 Chr1 complement(1628146..1629327) [1182 bp, 393 aa]
           {ON} Anc_3.87 YDR494W
          Length = 393

 Score = 29.6 bits (65), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 10/79 (12%)

Query: 73  VNFTIGQESFVSLGPKRSTSGKNLNKFGYCTRCGIKSSPEWRKNPQGETSLCNACGLNLK 132
           +NF     + + LG   + S  NLN F   T    K + +  KN        N   LNL+
Sbjct: 297 INFDTNAFNEIVLGKYSNLSNHNLNDFNKLTNSNTKKNSDLLKN-------SNTVKLNLE 349

Query: 133 KLTKAYSENGVRYFLKTYD 151
           KL +  ++N V+  L  YD
Sbjct: 350 KL-QINNDNNVKTLL--YD 365

>KNAG0D04520 Chr4 complement(818647..820353) [1707 bp, 568 aa] {ON}
           Anc_4.283 YKL185W
          Length = 568

 Score = 29.6 bits (65), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 2/34 (5%)

Query: 102 CTRCGIKSSPEWRKN--PQGETSLCNACGLNLKK 133
           C  C    SP WR +        LCN+CGL  KK
Sbjct: 480 CVSCHSSDSPCWRPSWSIDKHDQLCNSCGLRFKK 513

>YCR018C Chr3 complement(148238..148903) [666 bp, 221 aa] {ON}
           SRD1Protein involved in the processing of pre-rRNA to
           mature rRNA; contains a C2/C2 zinc finger motif; srd1
           mutation suppresses defects caused by the rrp1-1
           mutation
          Length = 221

 Score = 29.3 bits (64), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 19/39 (48%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTKAYSE 140
           C++C    + +WR  P     LC+ CGL   K  K  +E
Sbjct: 168 CSKCKDTWTIQWRSGPDQNRELCSPCGLAYGKRLKKENE 206

>NCAS0A02650 Chr1 complement(505025..506806) [1782 bp, 593 aa] {ON}
           Anc_4.283 YKL185W
          Length = 593

 Score = 29.6 bits (65), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 2/34 (5%)

Query: 102 CTRCGIKSSPEWRKN--PQGETSLCNACGLNLKK 133
           C  C    SP WR +        LCN+CGL  KK
Sbjct: 505 CVSCHSSDSPCWRPSWSKMKYDQLCNSCGLRFKK 538

>KNAG0M01820 Chr13 complement(334935..339233) [4299 bp, 1432 aa]
           {ON} Anc_2.201 YNL088W
          Length = 1432

 Score = 29.6 bits (65), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 18/79 (22%)

Query: 4   QIKSRLDILINVMMADPVFNPPSQEETETKIGN-GKKVE-----------------VITA 45
           QIK+ + I IN ++ +P F   ++E+  T+I + G + E                 +   
Sbjct: 344 QIKNNMFIFINCLIENPAFTSQTKEQLTTRIKDFGSRCEIPGDFVNKIMKTDLATKIFEI 403

Query: 46  ATKNSINKVKKPNCIRKKR 64
           A +N+ N++KK +  RK R
Sbjct: 404 ADENAHNQLKKSDGTRKSR 422

>TBLA0F01250 Chr6 complement(311865..313223) [1359 bp, 452 aa] {ON}
           Anc_4.283 YKL185W
          Length = 452

 Score = 29.6 bits (65), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 2/34 (5%)

Query: 102 CTRCGIKSSPEWRKNPQG--ETSLCNACGLNLKK 133
           C  C    SP WR +  G     LCN+CGL  KK
Sbjct: 366 CLSCRSTDSPCWRPSWSGLKTQQLCNSCGLRYKK 399

>Kpol_1002.113 s1002 (283671..287885) [4215 bp, 1404 aa] {ON}
           (283671..287885) [4215 nt, 1405 aa]
          Length = 1404

 Score = 29.3 bits (64), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 18/79 (22%)

Query: 4   QIKSRLDILINVMMADPVFNPPSQEETETKIGN-GKKVE-----------------VITA 45
           QIK+ + I IN ++ +P F   ++E+  T++ + G K E                 ++  
Sbjct: 343 QIKNNMFIFINSLIENPAFTSQTKEQLTTRVRDFGSKCELSNVFINKIMKTDFFDKILDV 402

Query: 46  ATKNSINKVKKPNCIRKKR 64
           A +N  N +KK +  RK R
Sbjct: 403 ANQNDQNALKKSDGTRKIR 421

>Kwal_23.4069 s23 (557325..559067) [1743 bp, 580 aa] {ON} YKL185W
           (ASH1) - probable purine nucleotide-binding protein
           [contig 255] FULL
          Length = 580

 Score = 28.9 bits (63), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 2/34 (5%)

Query: 102 CTRCGIKSSPEWRKN--PQGETSLCNACGLNLKK 133
           C  C    SP WR +   + +  LCN+CGL  KK
Sbjct: 490 CISCLSSDSPCWRPSWTNRKQDQLCNSCGLRYKK 523

>Suva_3.45 Chr3 complement(62203..62871) [669 bp, 222 aa] {ON}
           YCR018C (REAL)
          Length = 222

 Score = 28.5 bits (62), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 16/35 (45%)

Query: 102 CTRCGIKSSPEWRKNPQGETSLCNACGLNLKKLTK 136
           C +C    + +WR  P     LC+ CGL   K  K
Sbjct: 168 CAKCRDTWTIQWRSGPAHNRELCSPCGLAYGKRMK 202

>NCAS0G02740 Chr7 (492545..496783) [4239 bp, 1412 aa] {ON} Anc_2.201
           YNL088W
          Length = 1412

 Score = 28.9 bits (63), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 5/60 (8%)

Query: 4   QIKSRLDILINVMMADPVFNPPSQEETETKIGN-GKKVEVITAATKNSINKVKKPNCIRK 62
           QIK+ + I IN ++ +P F   ++E+  T++ + G K EV    +   INK+ K +   K
Sbjct: 344 QIKNNMFIFINCLIENPAFTSQTKEQLTTRVKDFGSKCEV----SPEYINKIMKTDFATK 399

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,624,033
Number of extensions: 767948
Number of successful extensions: 2044
Number of sequences better than 10.0: 191
Number of HSP's gapped: 1991
Number of HSP's successfully gapped: 192
Length of query: 171
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 69
Effective length of database: 41,785,467
Effective search space: 2883197223
Effective search space used: 2883197223
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 61 (28.1 bits)