Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A072706.21ON37335616370.0
TBLA0G010506.21ON3503463974e-44
KNAG0M011706.21ON3393383931e-43
TPHA0J003406.21ON3383443712e-40
Kpol_1037.266.21ON3423413615e-39
Kpol_1032.86.21ON3433393616e-39
NCAS0H008306.21ON3383463606e-39
ZYRO0C07788g6.21ON3343353537e-38
YOR007C (SGT2)6.21ON3463363493e-37
Smik_15.1766.21ON3453353476e-37
Skud_15.1686.21ON3483403423e-36
CAGL0E02739g6.21ON3433333344e-35
Kwal_56.224336.21ON3223363325e-35
TDEL0G044806.21ON3433383302e-34
KAFR0L004106.21ON3313413273e-34
NDAI0D008106.21ON3493513283e-34
TPHA0M002706.21ON3773783286e-34
ACR005W6.21ON3273473256e-34
SAKL0E01210g6.21ON3233373248e-34
Suva_15.1826.21ON3463353223e-33
Ecym_30256.21ON3183362983e-30
NCAS0D026706.21ON3513992986e-30
NDAI0I022406.21ON3503702978e-30
KLTH0C11220g6.21ON3273382591e-24
KLLA0D01155g6.21ON3352562502e-23
KNAG0A079003.481ON512841782e-13
KAFR0C058905.617ON5751031721e-12
Ecym_55825.617ON5841011712e-12
KLLA0A07062g5.617ON5811011693e-12
Smik_15.2055.617ON5891011693e-12
YOR027W (STI1)5.617ON5891021684e-12
NDAI0F009105.617ON5831001684e-12
CAGL0H08195g5.617ON5831011667e-12
KAFR0B066103.481ON511861659e-12
KLLA0F24046g2.152ON604871651e-11
Suva_8.805.617ON5861021632e-11
Kpol_505.413.481ON513821622e-11
ZYRO0A05676g5.617ON5721011622e-11
Ecym_44133.481ON510851595e-11
NCAS0G008105.617ON5841011595e-11
Skud_15.1925.617ON5891011552e-10
TPHA0D028805.617ON5851321532e-10
KLTH0E02178g5.617ON5931011524e-10
NCAS0F034903.481ON512821515e-10
SAKL0G07084g5.617ON5851011498e-10
Kwal_55.199355.617ON5931661499e-10
TDEL0A048405.617ON5761011472e-09
AAR083C3.481ON538821462e-09
AEL224W5.617ON5801011462e-09
Kpol_1018.695.617ON5901011462e-09
SAKL0F03102g3.481ON513811452e-09
Skud_7.4323.481ON513861434e-09
TBLA0E033005.617ON5821011435e-09
TBLA0C039503.481ON512811417e-09
TDEL0D055003.481ON512901417e-09
Suva_7.4083.481ON513861363e-08
YGR123C (PPT1)3.481ON513801363e-08
KNAG0B032005.617ON5791851363e-08
Smik_6.2153.481ON513721354e-08
KLLA0B10912g3.481ON512901355e-08
NDAI0B057903.481ON523761311e-07
NCAS0A00490singletonON620871302e-07
TPHA0D032203.481ON5131061293e-07
NCAS0G024802.152ON5961051283e-07
CAGL0L12936g2.152ON600951275e-07
KLTH0B05170g2.152ON5931121265e-07
ABR131W2.152ON594991266e-07
CAGL0D05060g3.481ON510811241e-06
ZYRO0B04224g3.481ON513811241e-06
Skud_8.1782.152ON638921241e-06
NCAS0B070102.152ON625951222e-06
TBLA0C055302.152ON6101011222e-06
TPHA0I015102.152ON6031031222e-06
KNAG0H035302.152ON614871213e-06
Kwal_33.147672.152ON5941121203e-06
YCR060W (TAH1)6.328ON111511104e-06
Ecym_82042.152ON5971001194e-06
KAFR0F007202.152ON608961186e-06
Suva_15.3142.152ON644901178e-06
NDAI0F028102.152ON6091271161e-05
YHR117W (TOM71)2.152ON639861142e-05
YNL121C (TOM70)2.152ON6171031133e-05
KLTH0F14542g3.481ON5131511123e-05
SAKL0E10956g2.152ON600951123e-05
Suva_3.956.328ON111701034e-05
Skud_14.2112.152ON6171031115e-05
Smik_14.2072.152ON6171031105e-05
Smik_8.1952.152ON635861098e-05
ZYRO0G06512g2.152ON604871081e-04
NDAI0B043402.152ON664791081e-04
Kwal_55.211753.481ON511951071e-04
NDAI0A051003.367ON10071191072e-04
KAFR0J025706.328ON12154982e-04
Suva_14.2192.152ON6171031043e-04
TPHA0M016303.367ON10431241043e-04
TDEL0B051402.152ON599891043e-04
Kpol_1048.212.152ON597871034e-04
Kpol_1006.43.367ON7321061034e-04
Kpol_513.28.506ON374891015e-04
KAFR0H008703.367ON8871191017e-04
TPHA0D038606.328ON12054947e-04
TDEL0C050903.367ON7591041008e-04
SAKL0A01672g6.328ON12858940.001
KNAG0H006103.367ON9731081000.001
Smik_2.2543.367ON1020125990.001
Smik_3.1596.328ON11551920.001
NCAS0A112003.367ON907113990.001
AAR054C6.328ON13364920.002
Skud_2.2403.367ON984125980.002
ZYRO0C16522g3.367ON974106980.002
NCAS0D045006.328ON12155910.002
TBLA0F012303.367ON1189108970.002
YBR112C (CYC8)3.367ON966125970.002
Suva_4.3613.367ON963125960.003
KAFR0E029808.506ON380145930.005
CAGL0D01364g3.367ON1148124940.005
KLTH0E11748g8.506ON37889930.005
NCAS0B024008.506ON38088930.006
Kwal_23.36703.367ON802104930.007
ADL344W3.367ON910125930.007
Skud_3.1356.328ON11861870.007
Smik_2.2958.506ON38587920.007
SAKL0B07986g3.367ON880104920.008
KLTH0F10428g3.367ON795104920.008
TBLA0I023106.328ON11654860.009
KNAG0I025206.328ON11755860.009
Suva_4.4058.506ON38589910.009
YBR155W (CNS1)8.506ON38587910.009
TDEL0B013108.506ON38089900.012
Kpol_172.23.367ON418103900.012
CAGL0H07425g8.506ON38088900.013
TBLA0H033808.506ON375131900.013
Kwal_27.118908.506ON33484890.014
KLLA0B09966g8.506ON370103890.016
Ecym_20906.328ON17258860.018
CAGL0L04048g2.152ON587107890.020
CAGL0K09240g6.328ON14257840.021
KNAG0A039508.506ON386119870.029
Ecym_25598.506ON37088860.036
Skud_2.2828.506ON38587860.042
KLLA0C08910g6.328ON11553800.051
ADR230W5.689ON68554850.066
NCAS0B025608.470ON578190840.067
Kpol_1028.516.328ON11754780.099
SAKL0H10934g8.506ON38090820.12
KAFR0E028208.470ON56290820.14
NDAI0C043205.352ON706121810.20
SAKL0H11946g8.470ON573132790.29
NCAS0E024907.412ON809117790.30
TDEL0A074306.328ON12453740.32
TPHA0L014208.506ON374107780.34
KLTH0H14872g5.352ON62385790.35
NDAI0I004406.328ON12852740.39
Kpol_1043.605.689ON70697780.48
AGL268C8.506ON37994760.56
Suva_12.1141.456ON370125760.57
NDAI0C051308.470ON59062760.75
AEL062C1.456ON38390750.76
Ecym_40315.689ON68872750.86
ZYRO0F00374g6.4ON61835731.5
TBLA0A016908.470ON66268722.2
TBLA0H019705.352ON84065722.3
KNAG0C055005.352ON585118722.3
NDAI0C052908.506ON379118712.8
NCAS0C005307.493ON29293703.0
AFR453W8.470ON56962703.7
Kpol_534.152.333ON39229693.9
TPHA0B039701.456ON39691694.1
TPHA0E011105.352ON69356704.3
Suva_2.687.493ON27195694.4
ZYRO0F16544g1.88ON102878704.4
ZYRO0G18106g7.493ON29281684.6
YNL313C (EMW1)3.32ON90488694.6
Kwal_27.117378.470ON57577694.8
Kpol_463.111.267ON784104695.3
TDEL0A005103.32ON90384695.3
NDAI0F004005.689ON76478695.9
NDAI0E040407.412ON783132695.9
YDR244W (PEX5)8.470ON61262686.0
TBLA0D004607.412ON835139686.1
CAGL0F04653g7.493ON29240676.2
TDEL0E027505.352ON564121686.2
Skud_4.5068.470ON61162686.5
Suva_2.4108.470ON61162687.1
Smik_4.4918.470ON61262687.2
TDEL0C035607.493ON29294668.1
ZYRO0D10186g5.352ON63565679.2
KNAG0A041208.470ON60262679.3
NCAS0C027708.415ON76769679.3
NDAI0G015003.19ON100761679.7
TPHA0E007407.412ON74662679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07270
         (373 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   635   0.0  
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   157   4e-44
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   155   1e-43
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   147   2e-40
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   143   5e-39
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   143   6e-39
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   143   6e-39
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   140   7e-38
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   139   3e-37
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   138   6e-37
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   136   3e-36
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   133   4e-35
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   132   5e-35
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   131   2e-34
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   130   3e-34
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   130   3e-34
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   130   6e-34
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   129   6e-34
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   129   8e-34
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   128   3e-33
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   119   3e-30
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   119   6e-30
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   119   8e-30
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   104   1e-24
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   100   2e-23
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    73   2e-13
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    71   1e-12
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    70   2e-12
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    70   3e-12
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    70   3e-12
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    69   4e-12
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     69   4e-12
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    69   7e-12
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    68   9e-12
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    68   1e-11
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    67   2e-11
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    67   2e-11
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    67   2e-11
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    66   5e-11
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    66   5e-11
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    64   2e-10
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    64   2e-10
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    63   4e-10
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    63   5e-10
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    62   8e-10
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    62   9e-10
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    61   2e-09
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    61   2e-09
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    61   2e-09
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    61   2e-09
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    60   2e-09
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    60   4e-09
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    60   5e-09
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    59   7e-09
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    59   7e-09
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    57   3e-08
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    57   3e-08
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    57   3e-08
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    57   4e-08
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    57   5e-08
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    55   1e-07
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       55   2e-07
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    54   3e-07
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    54   3e-07
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    54   5e-07
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    53   5e-07
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    53   6e-07
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    52   1e-06
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    52   1e-06
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    52   1e-06
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    52   2e-06
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    52   2e-06
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    52   2e-06
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    51   3e-06
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    51   3e-06
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    47   4e-06
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    50   4e-06
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    50   6e-06
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    50   8e-06
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    49   1e-05
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    49   2e-05
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    48   3e-05
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    48   3e-05
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    48   3e-05
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    44   4e-05
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    47   5e-05
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    47   5e-05
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    47   8e-05
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    46   1e-04
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    46   1e-04
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    46   1e-04
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    46   2e-04
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    42   2e-04
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    45   3e-04
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    45   3e-04
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    45   3e-04
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    44   4e-04
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    44   4e-04
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    44   5e-04
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    44   7e-04
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    41   7e-04
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    43   8e-04
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    41   0.001
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    43   0.001
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    43   0.001
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    40   0.001
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    43   0.001
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    40   0.002
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    42   0.002
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    42   0.002
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    40   0.002
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    42   0.002
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    42   0.002
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    42   0.003
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    40   0.005
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    41   0.005
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    40   0.005
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    40   0.006
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    40   0.007
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    40   0.007
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    38   0.007
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    40   0.007
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    40   0.008
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    40   0.008
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    38   0.009
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    38   0.009
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    40   0.009
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    40   0.009
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    39   0.012
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    39   0.012
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    39   0.013
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    39   0.013
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    39   0.014
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    39   0.016
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    38   0.018
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    39   0.020
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    37   0.021
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    38   0.029
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    38   0.036
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    38   0.042
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    35   0.051
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    37   0.066
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    37   0.067
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    35   0.099
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    36   0.12 
KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.4...    36   0.14 
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    36   0.20 
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    35   0.29 
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    35   0.30 
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    33   0.32 
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    35   0.34 
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    35   0.35 
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    33   0.39 
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    35   0.48 
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    34   0.56 
Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032...    34   0.57 
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    34   0.75 
AEL062C Chr5 complement(519416..520567) [1152 bp, 383 aa] {ON} S...    33   0.76 
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    33   0.86 
ZYRO0F00374g Chr6 complement(37241..39097) [1857 bp, 618 aa] {ON...    33   1.5  
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    32   2.2  
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    32   2.3  
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...    32   2.3  
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    32   2.8  
NCAS0C00530 Chr3 (85814..85843,85918..86766) [879 bp, 292 aa] {O...    32   3.0  
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    32   3.7  
Kpol_534.15 s534 (35957..37135) [1179 bp, 392 aa] {ON} (35957..3...    31   3.9  
TPHA0B03970 Chr2 (938053..939243) [1191 bp, 396 aa] {ON} Anc_1.4...    31   4.1  
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    32   4.3  
Suva_2.68 Chr2 (123103..123918) [816 bp, 271 aa] {ON} YBL050W (R...    31   4.4  
ZYRO0F16544g Chr6 (1360946..1364032) [3087 bp, 1028 aa] {ON} sim...    32   4.4  
ZYRO0G18106g Chr7 complement(1487959..1488807,1488878..1488907) ...    31   4.6  
YNL313C Chr14 complement(45308..48022) [2715 bp, 904 aa] {ON}  E...    31   4.6  
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    31   4.8  
Kpol_463.11 s463 complement(29915..32269) [2355 bp, 784 aa] {ON}...    31   5.3  
TDEL0A00510 Chr1 complement(86493..89204) [2712 bp, 903 aa] {ON}...    31   5.3  
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    31   5.9  
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    31   5.9  
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    31   6.0  
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    31   6.1  
CAGL0F04653g Chr6 complement(470517..471395) [879 bp, 292 aa] {O...    30   6.2  
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    31   6.2  
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    31   6.5  
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    31   7.1  
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    31   7.2  
TDEL0C03560 Chr3 complement(622010..622858,622921..622950) [879 ...    30   8.1  
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...    30   9.2  
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    30   9.3  
NCAS0C02770 Chr3 complement(522391..524694) [2304 bp, 767 aa] {O...    30   9.3  
NDAI0G01500 Chr7 (331856..334879) [3024 bp, 1007 aa] {ON} Anc_3....    30   9.7  
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    30   9.8  

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/356 (91%), Positives = 324/356 (91%)

Query: 1   MSTTQINDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXX 60
           MSTTQINDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAY       
Sbjct: 1   MSTTQINDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLIL 60

Query: 61  XXXXXDLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISIN 120
                DLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISIN
Sbjct: 61  KFSKSDLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISIN 120

Query: 121 LNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVA 180
           LNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVA
Sbjct: 121 LNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVA 180

Query: 181 YLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVP 240
           YLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVP
Sbjct: 181 YLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVP 240

Query: 241 EKITREFEDLKLKVQTDISLREIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAALLSN 300
           EKITREFEDLKLKVQTDISLREI                    PDIGSILGDGFAALLSN
Sbjct: 241 EKITREFEDLKLKVQTDISLREISNDHSNNNYNENSYNSTKNSPDIGSILGDGFAALLSN 300

Query: 301 PMLQQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSAFDKKLFMDLLDSLL 356
           PMLQQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSAFDKKLFMDLLDSLL
Sbjct: 301 PMLQQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSAFDKKLFMDLLDSLL 356

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  157 bits (397), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 103/346 (29%), Positives = 169/346 (48%), Gaps = 42/346 (12%)

Query: 7   NDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXXD 66
           ++KD+A L+V+FL   I KK +S DN DSLNVAIDCI + +   +               
Sbjct: 4   SNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFGGKS 63

Query: 67  LTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSK 126
           LT +L+  A  N K  +S+ E                            K+SI+  D   
Sbjct: 64  LTELLD--AATNAKGRSSSPEDI--------------------------KVSISDKDE-- 93

Query: 127 NNFSDKDKQIA---DTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLK 183
               ++DK++A   +  K EGN+ M ++DY  A+E Y  AI   P   +YY+NR+ AY  
Sbjct: 94  ----EEDKELAAKAEALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSS 149

Query: 184 VNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKI 243
              Y+ AI DA   I ++ N+SK Y RL   K  Q +  +AL+ YKK +E++ D   + +
Sbjct: 150 QEKYDEAIKDAESAIKVEPNWSKGYSRLGFAKFAQGKSQEALEAYKKALEVDGDKATDIM 209

Query: 244 TREFEDLKLKVQTDISLREIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAALLSNPML 303
            R++E  K KV+  +++ +                     PD+ S+LG G  + L+NP +
Sbjct: 210 KRDYETAKKKVEQSLNVEKS----ATPSASASASASAGGMPDMASMLGGGLGSFLNNPQI 265

Query: 304 QQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSAFDKKLFM 349
            Q   +++ +NP A + +  ++ NP+++ + +N  +GS+     FM
Sbjct: 266 MQAAQQMM-SNPRAMEQMESMMQNPSIRQMAENLSSGSSEGMGDFM 310

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  155 bits (393), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 99/338 (29%), Positives = 168/338 (49%), Gaps = 36/338 (10%)

Query: 7   NDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXXD 66
           ++K+V+ LI+++L  V+SK E+S D+IDSLNVAIDC+ + + + +               
Sbjct: 4   SNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEK-------------DT 50

Query: 67  LTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSK 126
           L++ + +  K N K++T              L ++  +N  N      E + IN+     
Sbjct: 51  LSATIES--KFNGKSLTE-------------LLDAASQNAGNTDECKTETVKINIPQEDA 95

Query: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186
                  K  A+  K EGN+ + S+DY  A+E YT AI   P + +Y++NR+ AY    +
Sbjct: 96  ET-----KAKAEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQN 150

Query: 187 YESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITRE 246
           Y+ A+ DA   I +D  +SK Y RLA  K  Q  + ++L+ YKK +E+  DS  E   R 
Sbjct: 151 YDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRG 210

Query: 247 FEDLKLKVQTDISLREIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAALLSNPMLQQM 306
           +E  K +V+  ++L +                     PD  S++  G   L++NP + Q 
Sbjct: 211 YETAKKRVEESLNLEK--SVPTESAGGQTNPAAGGGFPDFSSLMSGGLEGLMNNPQMMQA 268

Query: 307 IFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSAFD 344
              ++ +NP A + I  ++ NPA++ + + FK G+  D
Sbjct: 269 AQSMM-SNPGAMEKIQSMMQNPAIQQMAEQFKGGNTPD 305

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  147 bits (371), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 100/344 (29%), Positives = 163/344 (47%), Gaps = 52/344 (15%)

Query: 9   KDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXXDLT 68
           K++A LIV++L NV+ KKE+S DN DSLNVA+DCI + +                   LT
Sbjct: 6   KEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFNGNGLT 65

Query: 69  SILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKNN 128
           S L+  A N+                                      I +N+ D + + 
Sbjct: 66  SFLSGSATND--------------------------------------IQVNIADDAAD- 86

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYE 188
             ++ K  A+  K EGN+ M ++DY+ AI+ Y+ AI   P + +YY+NR+ AY  +  Y+
Sbjct: 87  --EEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYD 144

Query: 189 SAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITREFE 248
            A+NDA   I ++  +SK Y RL   K  Q +  DALD YKK +++  D   + + R++E
Sbjct: 145 DAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYE 204

Query: 249 DLKLKVQTDISLREIXXXXXXXXXXXXXXXXXXXX------PDIGSILGDGFAALLS--- 299
             K KV+  ++L ++                          PD+ S+LG G    L    
Sbjct: 205 TAKKKVEQSLNLEKVTPKEAETESNADAGTGAAGMGGMGGFPDLSSMLGGGLGGGLGDLL 264

Query: 300 -NPMLQQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342
            NP + Q   +++Q NP+A + +  ++ NPA++ + +NF +G  
Sbjct: 265 KNPQIMQAAQQMMQ-NPNAMQQMESMMQNPAVRQMAENFASGEG 307

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  143 bits (361), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 101/341 (29%), Positives = 164/341 (48%), Gaps = 41/341 (12%)

Query: 6   INDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXX 65
           +++KD+A LI++FL  V+ K E+S+DN DSLNVA+DCI + +                  
Sbjct: 3   VSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQGN 62

Query: 66  DLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTS 125
            L+S LN     +    T+              +E+VK    N++ D+ E          
Sbjct: 63  SLSSYLNGSTSASAATTTA--------------DETVK---VNVTEDDTEA--------- 96

Query: 126 KNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVN 185
                    + A+  K EGN+ M  +DY+ AI+ YT AI+  P + +Y++NR+ AY  + 
Sbjct: 97  --------SEAAEALKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLK 148

Query: 186 DYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245
            Y+ A+ DAN  I I+  +SK Y RL   K  Q +  DAL+ YKK +++  D   E + R
Sbjct: 149 KYDEAVEDANSAIKINPTYSKGYSRLGFAKFAQGKAEDALEAYKKVLDIEGDKATEMMKR 208

Query: 246 EFEDLKLKVQTDISLREIXXXXXXXXXXXXXXXX-----XXXXPDIGSI-LGDGFAALLS 299
           ++E  K KV+  ++L +                          PD  S+  G G   LL+
Sbjct: 209 DYETAKKKVEQSLNLEKSTVSGNATAESDSASAADPFAGMGGMPDFSSMLGGGGLGNLLN 268

Query: 300 NPMLQQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNG 340
           NP L Q   +++Q +P+A K +  ++ NP++K +   F +G
Sbjct: 269 NPQLMQAAQQMMQ-DPEAMKQVESMMQNPSVKQMADQFSSG 308

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  143 bits (361), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 107/339 (31%), Positives = 165/339 (48%), Gaps = 43/339 (12%)

Query: 6   INDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXX 65
           +N+KD   LIVN+L  +I  KE+S+DN +SLNVAIDCI   + L+               
Sbjct: 3   LNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFNKS 62

Query: 66  DLTSI-LNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDT 124
           DL +I L      N  ++        + LE       VK          NE+IS      
Sbjct: 63  DLKTITLKGLGLQNVSDV--------VELE-------VK----------NEEIS------ 91

Query: 125 SKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKV 184
                 DK K+ A+  K EGN+ M  ++YK AI+ Y+ AI  YP +P YYSNR+ AY  +
Sbjct: 92  -----EDKKKE-AEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMI 145

Query: 185 NDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKIT 244
            D+ +A+ DAN  I +D  +SKAY RL   K+ +    DA+  +KK +EL  D   E + 
Sbjct: 146 EDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMK 205

Query: 245 REFEDLKLKVQTDISLREIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAALLSNP-ML 303
            ++E+ K  VQT ++L +                      DI ++LG  F +L++N  M+
Sbjct: 206 NDYENAKKLVQTFVTLNK----NVPDPSGPPPLNTTDVLTDIATVLGSSFGSLMNNTQMM 261

Query: 304 QQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342
           Q+    +   NP+  + +  ++ NP ++   +N  NG+ 
Sbjct: 262 QRAQQMMQTQNPEMMQQVEGLMQNPVVRQFAENVANGNG 300

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  143 bits (360), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 104/346 (30%), Positives = 172/346 (49%), Gaps = 45/346 (13%)

Query: 6   INDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXX 65
           +++K+V  LIV+FL  VI  KEIS+D+ DSLNVAIDCI + +                  
Sbjct: 3   LSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQ--------- 53

Query: 66  DLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTS 125
              ++ + F+    K I S+   T    E     ESV             K++I + D  
Sbjct: 54  ---TLQDKFSGKTLKEILSSASATSTGSEK---EESV-------------KVNIPVEDA- 93

Query: 126 KNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVN 185
                 + K  A++FK EGN+ M ++DY+ AIE Y+ AI   P + IYY+NR+ AY  V 
Sbjct: 94  ------EIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVK 147

Query: 186 DYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245
           +Y++AI DA   I ID  +SK Y RLA  K   ++  +AL+YYKK +++  D     + R
Sbjct: 148 EYDNAIKDAEKAIEIDPAYSKGYSRLAFAKYALNKPEEALEYYKKVLDMEGDKATPAMKR 207

Query: 246 EFEDLKLKVQTDISLREIXXXXXXXXXXXXXXX----XXXXXPDIGSIL-----GDGFAA 296
           +FE  K +V++ ++L +                         PD+ S+        G ++
Sbjct: 208 DFEMAKNRVESSMNLEKSSTTTPEPSRSAGQQPANPFAGSGMPDMSSLFGNGGGMGGLSS 267

Query: 297 LLSNPMLQQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342
            L+NP + Q   +++ ++P++ + +  ++ NP ++ + QN  +G A
Sbjct: 268 FLNNPQVMQAAQQMM-SDPNSMQKMQEMMQNPNLREMAQNLASGDA 312

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  140 bits (353), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 98/335 (29%), Positives = 165/335 (49%), Gaps = 43/335 (12%)

Query: 7   NDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXXD 66
           ++KD++ LIV++L +V+ KK +S+D+IDSLNVAI+CI + + + +               
Sbjct: 4   SNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAA--------- 54

Query: 67  LTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSK 126
                  F   N   + S          PSS  E+VK    NI  ++ E           
Sbjct: 55  -------FGGKNLAELLSAGAGA-----PSSQGENVK---VNIPAEDAEL---------- 89

Query: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186
                  K  A++ K EGN+ M  +DY+ AI+ Y+ AIS  P + +YY+NR+ A+  + +
Sbjct: 90  -------KSKAESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKN 142

Query: 187 YESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITRE 246
           Y+ AI DA   + +D+++SK Y RL   K  Q +  +AL+ YKK +++  DS  + + R+
Sbjct: 143 YDEAIKDAESAVKVDSSYSKGYSRLGYAKFAQGKSEEALEAYKKVLDIEGDSATDVMKRD 202

Query: 247 FEDLKLKVQTDISLREIXXXXXXXXXXXXXXXXXXXXP-DIGSILGDGFAALLSNPMLQQ 305
           +E  K KV+  + L +                       D+ S+LG G   LL+NP + Q
Sbjct: 203 YETAKRKVEQALELNKTDETETSDRGTGEPAGANPGGGFDLSSMLGGGLGGLLNNPQVMQ 262

Query: 306 MIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNG 340
              +++Q NP A   +  ++ NP ++ + + F  G
Sbjct: 263 AAQQMMQ-NPQAMSQMETMMQNPNVRQMAEKFAGG 296

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  139 bits (349), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 103/336 (30%), Positives = 169/336 (50%), Gaps = 36/336 (10%)

Query: 9   KDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNL-NEAYXXXXXXXXXXXXDL 67
           +++A LIVN+  +++ KKEIS+D  DSLNVA+DCI + +    EA              L
Sbjct: 6   EEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEFKGQHL 65

Query: 68  TSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKN 127
             ILN+                      S + ES KK       D+ E + IN+ +    
Sbjct: 66  ADILNS---------------------ASRVPESNKK-------DDAENVEINIPEDDAE 97

Query: 128 NFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDY 187
                 K  A+  K +GN+ M ++DY+ AI  YT AI   P + IYY+NR+ A+  + +Y
Sbjct: 98  T-----KAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEY 152

Query: 188 ESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITREF 247
           + A+ DA   ISID ++ + Y RL   K  Q +  +AL+ YKK +++  D+  E + R++
Sbjct: 153 DQAVKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDY 212

Query: 248 EDLKLKVQTDISL-REIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAALLSNPMLQQM 306
           E  K KV+  ++L + +                    PD+GS+LG G   L++NP L Q 
Sbjct: 213 ESAKKKVEQSLNLEKTVPEQSRDADVDASQGASAGGLPDLGSLLGGGLGGLMNNPQLMQA 272

Query: 307 IFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342
             K++ +NP A +NI  ++ +P+++ + + F +G  
Sbjct: 273 AQKMM-SNPGAMQNIQKMMQDPSIRQMAEGFASGGG 307

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  138 bits (347), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 99/335 (29%), Positives = 171/335 (51%), Gaps = 34/335 (10%)

Query: 9   KDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXXDLT 68
           +++A LIVN+  +++ KKEIS+D  DSLNVA+DCI + +                     
Sbjct: 6   EEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFG-------------------- 45

Query: 69  SILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKNN 128
                F ++    I    E    +L    LN + K ++SN   D+ + + +N+ +     
Sbjct: 46  -----FERDAASGILGKSEFKGKSL-ADVLNSASKASESN-EKDDAQNVEVNIPEEDAET 98

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYE 188
                K  A+  K +GN+ M ++DY+ AI  YT AI   P + IYY+NR+ A+  + +Y+
Sbjct: 99  -----KAKAEDLKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYD 153

Query: 189 SAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITREFE 248
            A+ DA   ISID ++ + Y RL   K  Q +  +AL+ YKK +++  D+  E + R++E
Sbjct: 154 EAVKDAESSISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKRDYE 213

Query: 249 DLKLKVQTDISL-REIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAALLSNPMLQQMI 307
             K KV+  ++L + +                    PD+GS+LG G   L++NP L Q  
Sbjct: 214 SAKKKVEQSLNLEKAVPEQSRDADANASQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAA 273

Query: 308 FKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342
            K++ +NP A +NI  ++ +P+++ + + F +G  
Sbjct: 274 QKMM-SNPGAMQNIQKMMQDPSIRQMAEGFTSGGG 307

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  136 bits (342), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 102/340 (30%), Positives = 172/340 (50%), Gaps = 44/340 (12%)

Query: 10  DVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNL-NEAYXXXXXXXXXXXXDLT 68
           ++A LIVN+  +++ KKEIS+D+ DSLNVA+DCI + +    EA             +LT
Sbjct: 7   EIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEFKGQNLT 66

Query: 69  SILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKNN 128
            +LN+ ++                     ++ES KK       D+ + + +N+       
Sbjct: 67  DLLNSTSR---------------------VSESTKK-------DDAQNVEVNI------- 91

Query: 129 FSDKDKQI---ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVN 185
             ++D +I   A+  K +GN+ M ++DY+ AI  YT AI   P + IYY+NR+ A+  + 
Sbjct: 92  -PEEDAEIKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLK 150

Query: 186 DYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245
            Y+ A+ DA   ISID  + + Y RL   K  Q +  +AL+ YKK +++  D+  E + R
Sbjct: 151 GYDEAVEDAESAISIDPTYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATEAMKR 210

Query: 246 EFEDLKLKVQTDISLREIXXXXXXXX---XXXXXXXXXXXXPDIGSILGDGFAALLSNPM 302
           ++E  K KV+  ++L +                        PD+GS+LG G   L++NP 
Sbjct: 211 DYESAKKKVEQSLNLEKTVPEQSRDADANADASQGAGTSGLPDLGSLLGGGLGGLMNNPQ 270

Query: 303 LQQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342
           L Q   K++ +NP A +NI  ++ +P +K + + F +G  
Sbjct: 271 LMQAAQKMM-SNPGAMQNIQKMMQDPNIKQMAEGFTSGGG 309

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  133 bits (334), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 87/333 (26%), Positives = 159/333 (47%), Gaps = 40/333 (12%)

Query: 9   KDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXXDLT 68
           K+VA +I+ +LE V+++K + +D +DS+NVAIDCI + + +                D+ 
Sbjct: 3   KEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERG-------------DVD 49

Query: 69  SILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKNN 128
           S+L     +                    L E ++  +       + K++I   D     
Sbjct: 50  SVLKQSGISK------------------GLEECLECMKGGAVKSEDVKVNIPAEDA---- 87

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYE 188
              + K  A+  K EGN+ M  +D++ AI  Y+ AI   P + IYY+NR+ A+  +  Y+
Sbjct: 88  ---ETKAKAEALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYD 144

Query: 189 SAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITREFE 248
            A+ DA   I ID  +SK Y RL   K  Q++  +AL+ YKK ++L  D   + + R++E
Sbjct: 145 EAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYKKVMDLEGDKATDIMKRDYE 204

Query: 249 DLKLKVQTDISLREIXXXXXXXXXXXXXXXXXXXXP-DIGSILGDGFAALLSNPMLQQMI 307
             K KV+  ++L +                       D  S+L  G + L++NP + Q  
Sbjct: 205 TAKKKVEQSLNLEKTPDARGADSGAGAGAGAGGAGGFDFSSMLSGGLSGLMNNPQIMQAA 264

Query: 308 FKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNG 340
            +++ +NP A + +  ++ +P+++ + + F +G
Sbjct: 265 QQMM-SNPQALQQMQSMMQDPSIRQMAEQFTSG 296

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  132 bits (332), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 96/336 (28%), Positives = 169/336 (50%), Gaps = 43/336 (12%)

Query: 7   NDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXXD 66
           ++KD+A LIV+FL + +  KE+S+D +DSLNVAIDCI + +  +                
Sbjct: 4   SNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVA----------- 52

Query: 67  LTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSK 126
            T++   FA  + K +         ++  SS  ESV             K++I + D   
Sbjct: 53  -TTLEKTFAGRSLKQVVEA-----ASVGSSSPQESV-------------KVNIPVEDA-- 91

Query: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186
                + K  A++ K EGN+ M ++D+++A+  Y+ AI   P + +YY+NR+ A+  +  
Sbjct: 92  -----ETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKK 146

Query: 187 YESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITRE 246
           YE A+ DA   I ++ ++SK Y RL   +    +  +ALD YKK +++  ++  + + R+
Sbjct: 147 YEEAVKDAEDAIKVNPSYSKGYSRLGFAQYALGKPEEALDAYKKVLDIEGEAATDAMKRD 206

Query: 247 FEDLKLKVQTDISLREIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAALLSNPMLQQM 306
           ++    KV   +++ +                     PDI S+LG G   LL+NP L Q 
Sbjct: 207 YDTAMKKVGQSLNVEK--SAPAATRDGAGSATGSGGLPDISSMLGGGLGGLLNNPQLMQA 264

Query: 307 IFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342
             +++Q NP+A +    V+ NPA+K + + F++G  
Sbjct: 265 AQQMMQ-NPNAMQE---VMNNPAVKQMAEKFQSGGG 296

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  131 bits (330), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 99/338 (29%), Positives = 161/338 (47%), Gaps = 39/338 (11%)

Query: 7   NDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXXD 66
           ++K+VA LIV++L  ++ KK +S++ IDSLNVAIDCI + + +                 
Sbjct: 4   SNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQ---------------- 47

Query: 67  LTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSK 126
                    K + K +   K    L       NES   +++  +   + K++I   D   
Sbjct: 48  ---------KGDSKAVFGGKGLVELLQ-----NESGSSSETATTQAESIKVNIPAEDA-- 91

Query: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186
                + K  A+T K EGN+ M  +D+  AI+ Y++AI   P + +YY+NR+ A+  +  
Sbjct: 92  -----ETKAKAETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKA 146

Query: 187 YESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITRE 246
           YE AI DA   I  D  +SK Y RL   K    Q  DAL+ YKK +++  D   + + R+
Sbjct: 147 YEEAIKDAESAIKTDPTYSKGYSRLGYAKFALGQAEDALEAYKKVLDIEGDKASDVMKRD 206

Query: 247 FEDLKLKVQTDISL-REIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAALLSNPMLQQ 305
           +E  K KV+  + L ++                      D  S+LG G   LL+NP L Q
Sbjct: 207 YETAKKKVEQSLDLEKKPETQARGADAGAGGAGGSGGFGDFASMLGGGLGGLLNNPQLMQ 266

Query: 306 MIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSAF 343
              +++Q NP A   +  ++ NP ++ + +NF  G+  
Sbjct: 267 AAQQMMQ-NPQAMSQMESMMQNPGVRQMAENFAQGNGM 303

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  130 bits (327), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 105/341 (30%), Positives = 174/341 (51%), Gaps = 39/341 (11%)

Query: 6   INDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXX 65
           +++K+++ LIV++L  V  K ++S+D  DSLNVAIDCI   +                  
Sbjct: 3   LSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFER-------------- 48

Query: 66  DLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINL-NDT 124
           D TS L    K+ + N+     + P  LE +            + N   E +++N+  D 
Sbjct: 49  DSTSGL---IKSKFYNL-----SLPELLEVA------------MENSAKENVTVNVPKDE 88

Query: 125 SKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKV 184
            +N+   K K  A+  K EGN+ M  +D+  AI  Y+ AIS  P + IYY+NR+ AY  +
Sbjct: 89  LENDEETKVK--AEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSL 146

Query: 185 NDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKIT 244
            D+E A  DA   I +D N+SK Y RL   K   ++  +AL+ YKK ++L  D   E + 
Sbjct: 147 KDFEKATEDAESAIRVDPNYSKGYSRLGFAKYALNKPEEALEAYKKVLDLEGDKATEIMK 206

Query: 245 REFEDLKLKVQTDISL-REIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAALLSNPML 303
           R++E  K +V+  ++L ++                     PD+ S+LG G   LL+NP L
Sbjct: 207 RDYETAKKRVEQSLNLEKKESTPKEESVTESAANAAAGGFPDMSSMLGGGLNGLLNNPQL 266

Query: 304 QQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSAFD 344
            Q   +++ ++P+A   I  ++ NP+++ + +NF+NG+  D
Sbjct: 267 MQAAQQMM-SDPNAMSKIQSMMQNPSIRQMAENFQNGNTPD 306

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  130 bits (328), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 94/351 (26%), Positives = 159/351 (45%), Gaps = 53/351 (15%)

Query: 6   INDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXX 65
           +N+KD+  LIV+FL  +I K E+S+DN DSLNVA+DCI +    +               
Sbjct: 3   LNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFNGK 62

Query: 66  DLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTS 125
            L  ILN  +          +E+                           +++I + D  
Sbjct: 63  TLVDILNTTSTATANTTIEKEESV--------------------------EVNIPVEDA- 95

Query: 126 KNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVN 185
                 + K  A+ FK EGN+ M  +D+  A+E YT AI   P + IYY+NR+ A+  + 
Sbjct: 96  ------EIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLK 149

Query: 186 DYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245
           ++E AI DA   I ID ++SK Y RLA  K    ++ +AL+ YKK +++  D+    + R
Sbjct: 150 EFEEAIKDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEALESYKKVLDIEGDNATAGMKR 209

Query: 246 EFEDLKLKVQTDISLREIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAAL-------- 297
           ++E  K +V+  +++ +                     P+       G   +        
Sbjct: 210 DYETAKKRVEESMNVEKSKTPEQGQGQQQTNESAQGNAPN---PFAGGMPDMSSLFGGAG 266

Query: 298 --------LSNPMLQQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNG 340
                   LSNP       K++ ++P+A + +  ++++P+M++L  NFKNG
Sbjct: 267 MGGGLGSLLSNPDFMSTAQKLM-SDPNAMQQVQSMMSDPSMRDLANNFKNG 316

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  130 bits (328), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 104/378 (27%), Positives = 193/378 (51%), Gaps = 36/378 (9%)

Query: 1   MSTTQINDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXX 60
           M+TT   D+++A +IV++    I+  +++QDN+DSLNVAIDCI   +++++         
Sbjct: 1   MNTT---DQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKT 57

Query: 61  XXXXXDLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVK-KNQSNISND---NNEK 116
                DL + L N            +    L  + +++N SV+ K++ N  ND   N + 
Sbjct: 58  AYRSNDLLTYLPN----------GKRSALNLDKKNTTINVSVQTKDKINAYNDLSRNKDD 107

Query: 117 ISI------NLNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCD 170
           I++      ++ +T +   S+ D + A+  K++GN  M ++ Y KAI  Y++AI  YP +
Sbjct: 108 INVPVKVIEDIEETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTN 167

Query: 171 PIYYSNRSVAYLKVNDYESAINDANFCISIDANFS----KAYIRLANIKVQQHQYIDALD 226
             YY+NR++AY+K N+++ AI DAN  I ID+       KAY RL   K +   Y  +L 
Sbjct: 168 FNYYNNRALAYIKANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLA 227

Query: 227 YYKKFIELNK-----DSVPEKITREFEDLKLKVQTDISLREIXXXXXXXXXXXXXXXXXX 281
            +K+ IE+ +     D + +++  ++E  K KVQ ++   +I                  
Sbjct: 228 AFKRMIEIAQENNKGDEITKQMDADYEKAKEKVQ-ELFFMQITKSTGKEGSGNSVNDGPK 286

Query: 282 XXPDIGSIL---GDGFAALLSNPMLQQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFK 338
               +  IL   G+    ++SNP+ ++++ +++ +NP A +    V+ +P ++ + +N  
Sbjct: 287 RKVTLNDILNMAGNNLNIIMSNPLFKEVVEQLLASNPQAKQQFDNVMNDPRVRQMKENVN 346

Query: 339 NGSAFDKKLFMDLLDSLL 356
           + S  +  +  DL  SLL
Sbjct: 347 SDSMSNIPILKDLFYSLL 364

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  129 bits (325), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 97/347 (27%), Positives = 152/347 (43%), Gaps = 62/347 (17%)

Query: 7   NDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXXD 66
           ++KD+A LIV+FL    S K + +D  DSL VAIDCI + + L                 
Sbjct: 4   SNKDIAALIVDFL--TTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTLVSEKCGGRS 61

Query: 67  LTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSK 126
           L+ +L           T+    T    EP    E +KK                      
Sbjct: 62  LSQLL-----------TTGMAHTSDAGEPKVAAEELKKE--------------------- 89

Query: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186
                     A+  K EGNR M ++DY+ AI+ YT AI   P D +YY+NR+ AY  +  
Sbjct: 90  ----------AEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQ 139

Query: 187 YESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITRE 246
           YE A+ DA     +D+++SK + RL   K    ++ +AL+ YK+ +++  D+  E + R+
Sbjct: 140 YEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVLDIEGDNATEAMRRD 199

Query: 247 FEDLKLKVQTDISLREIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAALLS------- 299
           +E  K KV+  I++ +                     PD+ S+ G G             
Sbjct: 200 YESAKRKVEESINM-DRNAEVTESGDSAAGSAGGSGLPDLASMFGGGGLGGGLGGGLGGG 258

Query: 300 ------NPMLQQMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNG 340
                 NP + Q   K++Q NP A   I  +++NPA+K + +NF +G
Sbjct: 259 LGGLLNNPQVMQAAQKMMQ-NPSA---IQEMMSNPAIKKMAENFASG 301

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  129 bits (324), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 93/337 (27%), Positives = 163/337 (48%), Gaps = 42/337 (12%)

Query: 7   NDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXXD 66
           ++K++A LIV+FL + + K  +S+D  DSLNVAIDCI + +                   
Sbjct: 4   SNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFER--------------- 48

Query: 67  LTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSK 126
               ++   KN++ N                L+E +K   + +    +E + +N+     
Sbjct: 49  --DAVSEIVKNSFDN--------------RKLDELLKSAATALPT-QSEPVKVNIPAEDA 91

Query: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186
           N      K  A+  K +GN+ M S+D++ AI+ YT AI   P + +YY+NR+ AY  +  
Sbjct: 92  NT-----KAKAEDLKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYSSLKK 146

Query: 187 YESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITRE 246
           YE ++ DA   I ++ ++SK Y RL   K    +  +AL+ YK  +++  D   + + R+
Sbjct: 147 YEESVQDAESAIKVNPSYSKGYSRLGFAKYALGKPEEALEAYKTVLDIEGDKATDVMKRD 206

Query: 247 FEDLKLKVQTDISL-REIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAALLSNPMLQQ 305
           +E  K KV+  ++L + +                    PD+ S+LG G   LL+NP +  
Sbjct: 207 YETAKRKVEQSLNLEKSVPTQTDEQESSTDAGAGASGFPDMASLLGGGLGGLLNNPQVMS 266

Query: 306 MIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342
              K++Q NP A   +  ++ NPA++ + +NF +G  
Sbjct: 267 AAQKLMQ-NPGA---MDEMMKNPAVRQMAENFSSGGG 299

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  128 bits (322), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 98/335 (29%), Positives = 175/335 (52%), Gaps = 34/335 (10%)

Query: 9   KDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXXDLT 68
           +++A LIVN+  +++ KKE+S+D+ DSLNVA+DCI + +                   ++
Sbjct: 6   EEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFER-------------DAVS 52

Query: 69  SILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKNN 128
           SIL+   K+ +K     +    L    S L ES KK       D+ + + +N+ +     
Sbjct: 53  SILD---KSTFKG----QSLNNLLSSSSKLPESGKK-------DDAQNVEVNIPEEDAET 98

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYE 188
                K  A+  K +GN+ M +++Y+ AI+ YT AI   P + IYY+NR+ A+  + +Y+
Sbjct: 99  -----KAKAEELKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYD 153

Query: 189 SAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITREFE 248
            AI DA   IS+D ++ + Y RL   K  Q +  +AL+ YKK +++  D+  + + R++E
Sbjct: 154 EAIKDAESAISVDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYE 213

Query: 249 DLKLKVQTDISLREIXXXXXX-XXXXXXXXXXXXXXPDIGSILGDGFAALLSNPMLQQMI 307
             K +V+  ++L +                      PD+GS+LG G   L++NP L Q  
Sbjct: 214 SAKKRVEQSLNLEKTAPEQPRDAGANAGQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAA 273

Query: 308 FKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342
            K++ +NP A +NI  ++ +P+++ + + F +G  
Sbjct: 274 QKMM-SNPGAMQNIQNMMQDPSIRQMAEGFTSGGG 307

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  119 bits (298), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 90/336 (26%), Positives = 156/336 (46%), Gaps = 45/336 (13%)

Query: 7   NDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXXD 66
           ++K++A LIV FL    S K++ ++ +DSLNVAIDCI + + +                 
Sbjct: 4   SNKEIAALIVQFLS--TSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYNGRG 61

Query: 67  LTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSK 126
           L  ++ + A           E T  + EP+  N                       D   
Sbjct: 62  LVDLVKSGAS----------EPTLSSSEPTGNN----------------------TDAHA 89

Query: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186
              +++    A+  K EGN+   ++D++ A++ YT AI   P + ++Y NR+ AY     
Sbjct: 90  PEVAER----AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAVFYGNRAAAYSSFKK 145

Query: 187 YESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITRE 246
           +E A+ DA   + I+ ++S+ Y RL   K    +  +A++ YKK +++  D+  E + R+
Sbjct: 146 FEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAMEAYKKVLDIEGDNATEAMKRD 205

Query: 247 FEDLKLKVQTDISLREIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAALLSNPMLQQM 306
           +E  K KV+  ++L  +                    PD+ S+LG G   LL+NP + Q 
Sbjct: 206 YESAKKKVEESLNLEAL---PKGEEQQTSEGSSAGGFPDLSSMLGGGLGGLLNNPQVMQA 262

Query: 307 IFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342
             K++Q NP A + +   + NPA+K + QNF +G  
Sbjct: 263 AQKMMQ-NPSAMQEM---MNNPAIKQMAQNFASGGG 294

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  119 bits (298), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 100/399 (25%), Positives = 169/399 (42%), Gaps = 102/399 (25%)

Query: 6   INDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXX 65
           +++K++A  IV++L ++I   ++++D  +S++VAI+CI+  ++L E              
Sbjct: 3   LSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQE--------EVSADS 54

Query: 66  DLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTS 125
           DL ++L                   L LEP                              
Sbjct: 55  DLATVL----------------LANLNLEPEP---------------------------- 70

Query: 126 KNNFSDKDKQI----ADTFKDEGNRLMFSEDYKKAIECYTNAI-----SKYPCDPIYYSN 176
               S+K++++    A   K EGN+ +  E+YK AI+ YT AI     +  P D  Y SN
Sbjct: 71  --KLSEKERELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGYLSN 128

Query: 177 RSVAYLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNK 236
           +S+A  K   YE A +DA  CI ID  FSK Y RLA  K+ Q++Y DA++ YK+ ++L  
Sbjct: 129 KSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAMNAYKQVLDLEG 188

Query: 237 DSVPEKITREFEDLKLK-------------------------------VQTDISLREIXX 265
           +   + + R+FE  K K                               ++T  SL ++  
Sbjct: 189 NKATDTMKRDFEITKQKFETLNFSTHIDSGSATPISEAANKYPPKDEEIRTRSSLVKVDV 248

Query: 266 XXXXXXXXXXXXXXXXXXP--DIGSILGDGFAALLSNPMLQQMIFKIIQNNPDAAKNIGY 323
                             P  +I  ++G+G   +L+NP +Q  +    Q NPDAA+ +  
Sbjct: 249 PAEQTNTNEEHSTPNTNTPRFNIAQLIGNGIGTILNNPQVQLALSHFAQRNPDAARKVQE 308

Query: 324 VLANPAMKNLLQNFKNGS------AFDKKLFMDLLDSLL 356
           +  NP  K  L    + +       F  + F +L++S +
Sbjct: 309 ISNNPMFKMALSQLMDAANQSPEEFFKSEKFKNLVNSFI 347

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  119 bits (297), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 99/370 (26%), Positives = 157/370 (42%), Gaps = 91/370 (24%)

Query: 6   INDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXX 65
           +  +  A LI+++L  + +   + +D  +SL VAI CI + ++L+               
Sbjct: 3   LTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLD--------------- 47

Query: 66  DLTSILNNFAKNNYKNITSTKETTPLTLEPSSLN--ESVKKNQSNISNDNNEKISINLND 123
               IL           TS KE T  T+   +LN  E+ +K    I N+           
Sbjct: 48  --GDIL----------PTSLKERTLKTILQENLNTLEATQK----IHNEE---------- 81

Query: 124 TSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLK 183
                        A+  K EGN  M    Y++AI+ YT AI ++  +  YYSNRS+AY K
Sbjct: 82  -------------AEALKKEGNEAMIEGQYEEAIKKYTEAI-QFSKNVAYYSNRSLAYSK 127

Query: 184 VNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKI 243
           +  YE A+NDA   I+ID +FSKAY RL   K  Q +  D +  YK+ I+L   +  + +
Sbjct: 128 LGRYEDAVNDATLAINIDPSFSKAYSRLGYAKCCQDKLEDGMTAYKRAIDLEGTNASKTL 187

Query: 244 TREFEDLKLKVQT---------DISLREIXXXX-------------------------XX 269
             ++ED + K +            S++E+                               
Sbjct: 188 YDDYEDARFKYEQLKKNDDSEERKSIKEVTSEECPEKNNNQDEGFTAVNHYAQNNDNKSK 247

Query: 270 XXXXXXXXXXXXXXPDIGSILGDGFAALLSNPMLQQMIFKIIQNNPDAAKNIGYVLANPA 329
                          +I  +LG G   L++NP L+QM+F+ I +NPDA++ +  VL NP 
Sbjct: 248 EETKEENRSQAADLSNIARLLGSGVGGLMNNPQLKQMVFQAINDNPDASRQVKDVLNNPL 307

Query: 330 MKNLLQNFKN 339
           ++  L    N
Sbjct: 308 LRTTLSELMN 317

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  104 bits (259), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 88/338 (26%), Positives = 153/338 (45%), Gaps = 46/338 (13%)

Query: 9   KDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXXDLT 68
           K++A LI+++L      KEI +D IDSLNVAIDC+ + + + +               L 
Sbjct: 6   KELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFGGQSLE 65

Query: 69  SILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKNN 128
            I+            S+K  T    EP                    K++I + D     
Sbjct: 66  QIVG----------ASSKGPTATQQEPV-------------------KVNIPVEDA---- 92

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYE 188
              + K  A+  K EGN+ M ++D++ AI  Y+ AI   P + +Y++NR+ AY  +  Y 
Sbjct: 93  ---EIKAKAEALKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYA 149

Query: 189 SAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITREFE 248
            A+ DA   I ++ ++SK Y RL   +    +  +ALD YKK +++   +  + + R+++
Sbjct: 150 EAVEDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEALDAYKKVLDIEGSNATDAMKRDYD 209

Query: 249 DLKLKVQTDISLREIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAALLS----NPMLQ 304
               KV+  +++                       PDI S+LG G    L     NP + 
Sbjct: 210 TAMKKVEQSLNVER--SAPAASNAESPDAAGGSGFPDIASMLGGGLGGGLGGLLKNPQVM 267

Query: 305 QMIFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSA 342
           Q   +++Q NP+A + +   ++NPA+K +   F++G  
Sbjct: 268 QAAQQMMQ-NPNAMQEM---MSNPAIKQMADKFQSGGG 301

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  100 bits (250), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 121/256 (47%), Gaps = 39/256 (15%)

Query: 6   INDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYXXXXXXXXXXXX 65
           +++K++A LIV+FL +  S   +++D +DSLNVAIDCI + +                  
Sbjct: 3   LSNKEIAALIVDFLSSSSSS--VNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFNGK 60

Query: 66  DLTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTS 125
            L  +L            S   +  ++ EP                    K+ I + D +
Sbjct: 61  KLPELL-----------ASAPSSGGVSGEPV-------------------KVHIPVEDAA 90

Query: 126 KNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVN 185
                      A+  K +GN+ M ++ + +AIE YT AI   P + +YYSNR+ AY  + 
Sbjct: 91  AKA-------KAEELKLQGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLK 143

Query: 186 DYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245
            YE A+ DA   I +D  +SK + RL   K   ++  +ALD YKK +++  +   + + R
Sbjct: 144 QYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVLDIEGEKATDVMKR 203

Query: 246 EFEDLKLKVQTDISLR 261
           ++E  K KV+T ++L 
Sbjct: 204 DYETAKKKVETSMNLE 219

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 57/84 (67%)

Query: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186
           +N S  D + A  FKDEGN  + S+DY+KAIE YT AI       I+YSNR++A+LK+++
Sbjct: 2   SNPSKPDAEAALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDN 61

Query: 187 YESAINDANFCISIDANFSKAYIR 210
           ++SA++D N  I +D N  KAY R
Sbjct: 62  FQSALHDCNDAIKLDNNNIKAYHR 85

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 62/103 (60%), Gaps = 3/103 (2%)

Query: 135 QIADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           + AD +K EGN    ++DY+KAI+ +T AI  S+ P + + YSNRS AY     YE A++
Sbjct: 3   KTADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETP-NHVLYSNRSAAYTSSKQYEQALS 61

Query: 193 DANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
           DA+ CI I+ +++K Y R        H+Y +A   Y + ++++
Sbjct: 62  DADECIKINPSWAKGYTRKGAALQGLHKYEEAEQCYNETLKID 104

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 47/90 (52%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A+  + EG       D+  A++ YT  I + P D   YSNR+ A  K+  +  AI+D N 
Sbjct: 385 AEEARLEGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNK 444

Query: 197 CISIDANFSKAYIRLANIKVQQHQYIDALD 226
            I  D +F +AY+R A  ++   ++  A++
Sbjct: 445 AIEKDPSFIRAYLRKATCQIAVKEFAGAIE 474

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 56/123 (45%), Gaps = 9/123 (7%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYES------- 189
           AD  K EGN+   +  + +AI  Y  A   +  D  Y +NRS A  +  DYE+       
Sbjct: 251 ADKAKAEGNKAYKARQFDEAISHYNQAWETFK-DITYLNNRSAAEYEKGDYETCIKTLTE 309

Query: 190 AINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKK-FIELNKDSVPEKITREFE 248
           A+ +A    +     +K++ R+ N   +      A++YY+K   E     +  K+ +  +
Sbjct: 310 AVENARELRTDYKIVAKSFARMGNAYAKLDDLKKAIEYYQKSLTEHRTPDILSKLRKAEK 369

Query: 249 DLK 251
           DLK
Sbjct: 370 DLK 372

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 62/101 (61%), Gaps = 3/101 (2%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           A+ +K EGN    ++D+K+A+E +TNAI  S+ P + + YSNRS AY  +  ++ A++DA
Sbjct: 4   AEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEP-NHVLYSNRSGAYASLKKFDEALSDA 62

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
             C+ I A++SK + RL           +A + YKK +EL+
Sbjct: 63  TECVKIKADWSKGHNRLGAAHFGLGNLDEAEESYKKALELD 103

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 83/189 (43%), Gaps = 22/189 (11%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D + A+  + +G       D+  A++ Y+  I + P D   YSNR+ A  K+  +  AI 
Sbjct: 388 DPEKAEKARLDGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIK 447

Query: 193 DANFCISIDANFSKAYIRLANIKVQQHQY---IDALDYYK-KFIELNKDSVPEKITREFE 248
           D +  I ID +F +AYIR A  ++   +Y   I+ LD  + K  E+N  S      RE +
Sbjct: 448 DCDKAIEIDPSFVRAYIRKATAQIAVQEYSAAIETLDVARTKDAEVNNGSS----IREID 503

Query: 249 DLKLKVQTDISLREIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAALLSNPMLQQMIF 308
            L +K     + ++                     P++ SIL D        P++Q ++ 
Sbjct: 504 QLYVK-----ATQQRFQPANTNESPEETYARAVKDPEVASILQD--------PVMQSILA 550

Query: 309 KIIQNNPDA 317
           +  Q NP A
Sbjct: 551 Q-AQQNPAA 558

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 55/109 (50%), Gaps = 8/109 (7%)

Query: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           D D++ A+  K EGN+L     + +AI  Y  A +    D  Y +NR+ A  +  DY SA
Sbjct: 252 DLDRENAEKAKAEGNQLYKQRKFDEAIAKYEEAWN-LQKDITYLNNRAAAEYEKGDYNSA 310

Query: 191 INDANFCI----SIDANF---SKAYIRLANIKVQQHQYIDALDYYKKFI 232
           I   N  +     + A++   +K++ RL N   +  +   A++YY+K +
Sbjct: 311 IKTLNEAVEQGRELRADYKVIAKSFARLGNAYYKLDEVKKAVEYYEKSL 359

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 59/101 (58%), Gaps = 3/101 (2%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           AD FK EGN+   S+DY KAIE +T AI  S+ P + + +SNRS  Y    D+  A++DA
Sbjct: 3   ADQFKQEGNQAFASKDYAKAIELFTKAIEVSEQP-NHVLFSNRSACYASNKDFVKALDDA 61

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
           N C+ I+ +++K Y RL           +A   YKK +EL+
Sbjct: 62  NECVKINPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALELD 102

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 57/207 (27%), Positives = 87/207 (42%), Gaps = 30/207 (14%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D + A+  + +G       D+ KA+E YT  I + P D   YSNR+ A  K+  +  AI 
Sbjct: 385 DPEKAEEARLQGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIR 444

Query: 193 DANFCISIDANFSKAYIRLANIKVQQHQY---IDALDYYK-KFIELNKDSVPEKITREFE 248
           D +  I  D NF +AYIR A  ++    Y   I+ LD  + K  E+N  +     TRE +
Sbjct: 445 DCDKAIEKDPNFVRAYIRKATGQIAIKDYAGAIETLDSARTKDAEVNSGAN----TREID 500

Query: 249 DLKLKVQTDISLREIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAALLSNPMLQQMIF 308
            L +K       +                      P++ SIL D        P++Q ++ 
Sbjct: 501 QLYIKAS-----QARFEPANANETPEEAYARATKDPEVASILQD--------PVMQSILS 547

Query: 309 KIIQN---------NPDAAKNIGYVLA 326
           +  QN         NPD  K I  ++A
Sbjct: 548 QAQQNPAALQEHMRNPDVFKKIQTLIA 574

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 60/122 (49%), Gaps = 10/122 (8%)

Query: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           D DK  A+  K EGN+L     + +AIE Y  A   +  D  Y +NR+ A  +  DYE+A
Sbjct: 249 DDDKSKAEAAKAEGNKLYKQRKFDEAIEKYNEAWETH-NDITYLNNRAAAEYEKGDYEAA 307

Query: 191 INDANFCI----SIDANF---SKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKI 243
           I      +     + A++   SK++ R+ N   +      A+DYY+K   L +   P+ +
Sbjct: 308 IETLTKAVEQGRELRADYKVISKSFARMGNSYHKLGDLKKAIDYYEK--SLTEHRTPDIL 365

Query: 244 TR 245
           T+
Sbjct: 366 TK 367

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 60/101 (59%), Gaps = 3/101 (2%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           AD +K +GN    ++DY KAIE +T AI  SK P + + YSNRS  Y  +  +  A+NDA
Sbjct: 5   ADEYKQQGNSAFTAKDYDKAIELFTKAIEVSKTP-NHVLYSNRSACYASLKKFSDALNDA 63

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
             CI+I+ ++SK Y RL    +      +A + YKK +EL+
Sbjct: 64  KECININPSWSKGYNRLGAAHLGLGDLDEAENNYKKALELD 104

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 46/90 (51%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A+  + EG       D+  A++ YT  I + P D   YSNR+ A  K+  +  AI D N 
Sbjct: 396 AEEARLEGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNK 455

Query: 197 CISIDANFSKAYIRLANIKVQQHQYIDALD 226
            I  D NF +AYIR A  ++   +Y  AL+
Sbjct: 456 AIEKDPNFVRAYIRKATAQIAVQEYAAALE 485

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 53/109 (48%), Gaps = 8/109 (7%)

Query: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           D  K  AD  K EGN+   +  + +AIE Y  A   +  D  Y +NR+ A  +  +Y++A
Sbjct: 256 DDSKAEADKEKAEGNKFYKARQFDEAIEHYNKAWELH-RDITYLNNRAAAEYEKGEYKTA 314

Query: 191 INDANFCI----SIDANF---SKAYIRLANIKVQQHQYIDALDYYKKFI 232
           I   N  +     + A++   S+++ R+ N   +       ++YY+K +
Sbjct: 315 IATLNDAVEQGREMRADYKVISRSFARIGNAYHKLGDLKKTIEYYQKSL 363

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 59/102 (57%), Gaps = 3/102 (2%)

Query: 136 IADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAIND 193
            AD +K +GN    ++DY KAIE +T AI  S+ P + + YSNRS  Y  +  +  A+ND
Sbjct: 4   TADEYKQQGNAAFTAKDYDKAIELFTKAIEVSETP-NHVLYSNRSACYTSLKKFSDALND 62

Query: 194 ANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
           AN C+ I+ ++SK Y RL    +      +A   YKK +EL+
Sbjct: 63  ANECVKINPSWSKGYNRLGAAHLGLGDLDEAESNYKKALELD 104

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 46/90 (51%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A+  + EG       D+  A++ YT  I + P D   YSNR+ A  K+  +  AI D N 
Sbjct: 396 AEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNK 455

Query: 197 CISIDANFSKAYIRLANIKVQQHQYIDALD 226
            I  D NF +AYIR A  ++   +Y  AL+
Sbjct: 456 AIEKDPNFVRAYIRKATAQIAVKEYASALE 485

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 68/147 (46%), Gaps = 15/147 (10%)

Query: 94  EPSSLNESVKKNQSNISNDNNEKISINLNDTSKNNFSDKDKQI-ADTFKDEGNRLMFSED 152
           EP S + + K+N S        K S  +         + D +I AD  K EGN+   +  
Sbjct: 224 EPQSDSTTSKENSSKAPQKEESKESEPME------VDEDDSKIEADKEKAEGNKFYKARQ 277

Query: 153 YKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCI----SIDANF---S 205
           + +AIE Y  A   +  D  Y +NR+ A  +  +YE+AI+  N  +     + A++   S
Sbjct: 278 FDEAIEHYNKAWELH-KDITYLNNRAAAEYEKGEYETAISTLNDAVEQGREMRADYKVIS 336

Query: 206 KAYIRLANIKVQQHQYIDALDYYKKFI 232
           K++ R+ N   +       ++YY+K +
Sbjct: 337 KSFARIGNAYHKLGDLKKTIEYYQKSL 363

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 56/100 (56%), Gaps = 1/100 (1%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPC-DPIYYSNRSVAYLKVNDYESAINDAN 195
           AD +K +GN    S+D+ KAIE +T AI   P  + + YSNRS AY     ++ A+NDA 
Sbjct: 5   ADEYKQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDAT 64

Query: 196 FCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
            C+ I+  +SK Y RL   +       +A   YK+ ++L+
Sbjct: 65  ECVKINPTWSKGYNRLGAAEFGLGNLEEAEKNYKEALKLD 104

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 49/94 (52%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D + A+  + EG       D+  A++ Y+  I + P D   YSNR+ A  K+  +  AI 
Sbjct: 385 DPEKAEEARLEGKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIK 444

Query: 193 DANFCISIDANFSKAYIRLANIKVQQHQYIDALD 226
           D +  I  D NF +AYIR A  ++   +Y +ALD
Sbjct: 445 DCDNAIKKDPNFVRAYIRKATAQIAIKEYANALD 478

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 8/101 (7%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           AD  K EGN+L  +  + +AIE Y  A +    D  Y +NRS A  +  D+E+AI   N 
Sbjct: 255 ADEAKVEGNKLYKAHKFDEAIEQYNKAWA-LNKDITYLNNRSAAEFEKGDFETAIATLNE 313

Query: 197 CI----SIDANF---SKAYIRLANIKVQQHQYIDALDYYKK 230
            +     + A++   +K++ R+ N   ++     ++DYY+K
Sbjct: 314 AVDQGRELRADYKIIAKSFARIGNAYHKKGDLKKSIDYYQK 354

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 59/101 (58%), Gaps = 3/101 (2%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           AD +K +GN    ++DY+KAI+ ++ AI  S+ P + ++YSNRS  Y  +  +  A+NDA
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETP-NHVFYSNRSACYASLKKFPEALNDA 62

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
             C+ I+  +SK Y RL    +      +A   YKK +EL+
Sbjct: 63  EECVKINPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALELD 103

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 46/90 (51%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A+  + EG       D+  A++ YT  I + P D   YSNR+ A  K+  +  AI D N 
Sbjct: 390 AEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNK 449

Query: 197 CISIDANFSKAYIRLANIKVQQHQYIDALD 226
            I  D NF +AYIR A  ++   ++  A++
Sbjct: 450 AIEKDPNFIRAYIRKATAQIAVKEFAAAIE 479

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 59/86 (68%), Gaps = 2/86 (2%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D ++A ++KDEGN+ +  +D+++A E YT AI   P   I+YSNR++A LK++++ +A+N
Sbjct: 5   DTELATSYKDEGNKFLKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALN 64

Query: 193 DANFCISIDANFSKAYIR--LANIKV 216
           D    I ++++  KAY R  LANI +
Sbjct: 65  DCTNAIELNSSNLKAYHRRGLANIGL 90

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 54/87 (62%), Gaps = 1/87 (1%)

Query: 139 TFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCI 198
             KD+GN    ++D++KAIE YT AIS    DP++YSNRS AY+ +N++E  + D    +
Sbjct: 106 ALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAAL 164

Query: 199 SIDANFSKAYIRLANIKVQQHQYIDAL 225
            +  ++SK ++R A+      Q+ DA+
Sbjct: 165 KLKPDYSKCWLRRASAYENLGQFSDAM 191

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (56%), Gaps = 3/102 (2%)

Query: 136 IADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAIND 193
            AD +K +GN    ++DY KAI+ +T AI  S+ P + + YSNRS  Y  +  +  A+ND
Sbjct: 4   TADEYKQQGNAAFTAKDYGKAIDLFTKAIEVSEAP-NHVLYSNRSACYTSLKKFTDALND 62

Query: 194 ANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
           A  C+ I+ ++SK Y RL    +      DA   YKK +EL+
Sbjct: 63  ATECVKINPSWSKGYNRLGAAHLGLGDLDDAESNYKKALELD 104

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 46/90 (51%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A+  + EG       D+  A++ YT  I + P D   YSNR+ A  K+  +  AI D N 
Sbjct: 393 AEEARLEGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNK 452

Query: 197 CISIDANFSKAYIRLANIKVQQHQYIDALD 226
            I  D NF +AYIR A  ++   ++  AL+
Sbjct: 453 AIEKDPNFVRAYIRKATAQIAVQEFAGALE 482

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           D  K  AD  K EGN+   +  +++AIE Y  A   +  D  Y +NR+ A  +  DYE+A
Sbjct: 253 DDSKVEADKEKAEGNKFYKARQFEEAIEHYNKAWELH-RDITYLNNRAAAEYEKGDYETA 311

Query: 191 I 191
           I
Sbjct: 312 I 312

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 55/82 (67%), Gaps = 2/82 (2%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A  FK+EGN  +  ++Y KAIE YT AI   P   I+YSNR++A LK+++++SA ND N 
Sbjct: 12  AVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNE 71

Query: 197 CISIDANFSKAYIR--LANIKV 216
            +++D+   KAY R  LAN+ +
Sbjct: 72  ALTLDSKNVKAYHRRGLANVGL 93

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 57/101 (56%), Gaps = 3/101 (2%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           AD FK +GN    ++DY KAI+ +T AI  S+ P + + YSNRS  Y     +E A+ DA
Sbjct: 3   ADEFKQQGNAAFLAKDYVKAIDLFTKAIEVSETP-NHVLYSNRSACYASNKKFEEALKDA 61

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
             C+ I  ++SK Y R+   +    Q  +A   YK+ +EL+
Sbjct: 62  EECVKISPSWSKGYNRVGAAQFGLSQLDEAEKSYKRALELD 102

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 48/90 (53%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A+  + +G       D+  A++ YT  + + P D   +SNR+ A  K+  +  AI D N 
Sbjct: 380 AEEARLQGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNK 439

Query: 197 CISIDANFSKAYIRLANIKVQQHQYIDALD 226
            +SID NF +AYIR A  ++   ++  A++
Sbjct: 440 AVSIDPNFVRAYIRKATAQIAVKEFAAAIE 469

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 53/103 (51%), Gaps = 8/103 (7%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A+  K EGN+L  +  +++AIE Y  A   +  D  Y +NRS A  +  DY++AI   N 
Sbjct: 246 AEAEKAEGNKLYKARQFEEAIEHYNKAWELH-KDITYLNNRSAAEFEKGDYDTAIKTLND 304

Query: 197 CI----SIDANF---SKAYIRLANIKVQQHQYIDALDYYKKFI 232
            +     + A++   +K++ R+ N   +      A+++Y + +
Sbjct: 305 AVEQGRELRADYKTIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 53/85 (62%)

Query: 140 FKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCIS 199
           +KD+GN+ + S+DY +AIE YT AI    C  I++SNR++A LK++ ++SA+ D++  I 
Sbjct: 12  YKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIE 71

Query: 200 IDANFSKAYIRLANIKVQQHQYIDA 224
           +D++  K Y R          +I A
Sbjct: 72  LDSSNVKGYHRRGMAYAGLQDFISA 96

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 55/101 (54%), Gaps = 1/101 (0%)

Query: 136 IADTFKDEGNRLMFSEDYKKAIECYTNAISKYPC-DPIYYSNRSVAYLKVNDYESAINDA 194
            AD  K +GN    S+D+  AIE +T AI+     + + YSNRS  Y  +  ++ A+NDA
Sbjct: 3   TADELKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDA 62

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
             C+ I+ ++SK Y R+    +      DA   YKK +EL+
Sbjct: 63  QQCVKINPDWSKGYNRMGAAHLGLGDLDDAESNYKKALELD 103

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 45/90 (50%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A+  + EG       D+  A++ YT  I + P D   YSNR+ A  K+  +  AI D   
Sbjct: 390 AEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEK 449

Query: 197 CISIDANFSKAYIRLANIKVQQHQYIDALD 226
            I  D NF +AY+R A  ++    ++ AL+
Sbjct: 450 AIEKDPNFVRAYLRKATAQIAIKDFVKALE 479

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 51/97 (52%), Gaps = 8/97 (8%)

Query: 143 EGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCI---- 198
           EGN+L  S  + +AI  Y  A   +  D  Y +NRS A  +  D+E+A+N  N  +    
Sbjct: 262 EGNKLYKSHKFDEAIAEYNKAWDLH-KDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGR 320

Query: 199 SIDANF---SKAYIRLANIKVQQHQYIDALDYYKKFI 232
            + A++   +K++ R+ N   +Q     A++YY+K +
Sbjct: 321 ELRADYKLIAKSFARMGNAYSKQKNLKKAIEYYQKSL 357

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 57/101 (56%), Gaps = 3/101 (2%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           AD +K +GN    +++Y  AIE +T AI  S+ P   + +SNRS  Y  +  +  A+NDA
Sbjct: 5   ADEYKQQGNAAFTAKNYDGAIELFTKAIEVSETPSH-VLFSNRSACYTSLKKFSDALNDA 63

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
           N C+ I+ ++SK Y RL    +      +A   YKK +EL+
Sbjct: 64  NECVKINPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELD 104

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 47/90 (52%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A+  + EG       D+  A++ YT  I + P D   YSNR+ A  K+  +  AI D N 
Sbjct: 396 AEEARLEGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNK 455

Query: 197 CISIDANFSKAYIRLANIKVQQHQYIDALD 226
            I  D NF +AYIR+A  ++   ++  AL+
Sbjct: 456 AIEKDPNFVRAYIRMAAAQIAVKEFAAALE 485

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 52/109 (47%), Gaps = 8/109 (7%)

Query: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           D  K  AD  K EGN+   +  + +AIE Y  A   +  D  Y +NR+ A  +  DYE+ 
Sbjct: 256 DNSKAEADNEKAEGNKFYKAHQFDEAIEHYNRAWELH-KDITYLNNRAAAEYEKGDYETV 314

Query: 191 INDANFCIS----IDANF---SKAYIRLANIKVQQHQYIDALDYYKKFI 232
           I   N  +     + A++   SK++ R+ N   +       ++YY+K +
Sbjct: 315 IATLNDAVEKGRDMRADYKVISKSFARIGNAYHKLGDLKKTIEYYQKSL 363

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 69/132 (52%), Gaps = 12/132 (9%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDP--IYYSNRSVAYLKVNDYESAINDA 194
           AD +K +GN    +++Y+KA++ ++ AI   P +P  + YSNRS  Y  +  +  A+NDA
Sbjct: 5   ADEYKQQGNTAFSAKEYEKAVDLFSKAIEVSP-EPNHVLYSNRSACYTSLKKFTDALNDA 63

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITRE-FEDLK-- 251
           N C  I+  +SK Y R+           +A   YKK +EL+  +   K+ +E  E +K  
Sbjct: 64  NECTKINPTWSKGYNRVGAAHYGLGDLDEAEKSYKKALELDASN---KVAQEGLEQVKRT 120

Query: 252 ---LKVQTDISL 260
               K Q D+ L
Sbjct: 121 QEARKAQPDMGL 132

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%)

Query: 153 YKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIRLA 212
           +  A++ YT  I++ P D   YSNR+ A  K+  +  AI+D    +  D NF KAYIR A
Sbjct: 408 WPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYIRKA 467

Query: 213 NIKVQQHQYIDALD 226
             ++   +Y  AL+
Sbjct: 468 TAQIAIKEYSSALE 481

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 83/183 (45%), Gaps = 29/183 (15%)

Query: 82  ITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKNNFSDKDKQIADTFK 141
           + +TKET   T+  S   E V  N  N+  D+                +D  K++AD  K
Sbjct: 219 VAATKETKTETVPESKEKEPVAANPENMEVDD----------------ADVQKKLADAEK 262

Query: 142 DEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCI--- 198
           DEGN+L  +  + +AIE Y  A   +  D  Y +N++ A  +  DYE+ I      I   
Sbjct: 263 DEGNKLYKAHKFDEAIEHYDKAWELH-NDITYLNNKAAAQYEKGDYETTIKTLEDAIEKG 321

Query: 199 -SIDANF---SKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKIT--REFEDLKL 252
             + A++   +KA+ R+ N   + +    A +++ K   L +   P  +T  R  E  K+
Sbjct: 322 RELRADYKIIAKAFTRMGNAYEKLNDLKKAAEFFNK--SLTEFRTPATLTKLRSLEK-KI 378

Query: 253 KVQ 255
           KVQ
Sbjct: 379 KVQ 381

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 58/101 (57%), Gaps = 3/101 (2%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           A+ FK +GN    ++DY+KA E +T AI  S+ P + + YSNRS  +  +  +  A+NDA
Sbjct: 3   AEEFKKQGNAAFVAKDYEKASELFTKAIEASEAP-NHVLYSNRSACFTSLKKFNEALNDA 61

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
           N C+ I+  +SK Y R+        +  +A   YKK +E++
Sbjct: 62  NECVKINPAWSKGYNRVGAAYFGLGKLDEAEQGYKKALEID 102

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 48/94 (51%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D + A+  + +G       D+  A++ YT    + P D   YSNR+ A  K+  +  AI 
Sbjct: 397 DPEKAEEARLQGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIK 456

Query: 193 DANFCISIDANFSKAYIRLANIKVQQHQYIDALD 226
           D +  IS D NF +AYIR A  ++   ++  A++
Sbjct: 457 DCDMAISKDPNFIRAYIRKATAQIAVREFASAIE 490

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 60/119 (50%), Gaps = 10/119 (8%)

Query: 134 KQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIND 193
           K+ AD  K EGN+   +  + +AIE Y  A   +  D  Y +NRS A  +  DYE AI  
Sbjct: 264 KKNADAEKAEGNKFYKARKFDEAIEHYNKAWDLH-KDVTYLNNRSAAEYEKGDYEQAIKT 322

Query: 194 ANFCI----SIDANF---SKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245
               +     + A++   SK++ R+ N  ++   +  A+++Y+K   L +   P+ +T+
Sbjct: 323 LTEAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAIEFYQK--SLTEHRTPDILTK 379

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 53/82 (64%), Gaps = 1/82 (1%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYE 188
           F+D  +Q A  FK+EGN  +  ++Y KAIE Y+ AI   P   I++SNR++A LK+++++
Sbjct: 5   FADAKEQ-AVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQ 63

Query: 189 SAINDANFCISIDANFSKAYIR 210
           S +ND +  + +D    KAY R
Sbjct: 64  SCMNDCDVALRLDPKNIKAYHR 85

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 56/101 (55%), Gaps = 3/101 (2%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           AD +K +GN    ++D++KAIE +T AI  S+ P + + YSNRS  Y     +  A+ DA
Sbjct: 3   ADEYKQQGNAAFAAKDFEKAIELFTKAIEVSEKP-NHVLYSNRSACYTSTKQFNKALEDA 61

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
             C++I+  +SK Y R+           +A   YKK +EL+
Sbjct: 62  KQCVNINPAWSKGYNRVGAAHFGLGDLDEAEQGYKKALELD 102

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 49/94 (52%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D + A+  + +G       D+  A++ YT  I + P D   YSNR+ A  K+  +  AI 
Sbjct: 389 DPEKAEEARLQGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIK 448

Query: 193 DANFCISIDANFSKAYIRLANIKVQQHQYIDALD 226
           D N  IS D NF +AYIR A  ++   +++  ++
Sbjct: 449 DCNVAISKDPNFIRAYIRKATAQIAVREFVSVIE 482

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 61/119 (51%), Gaps = 10/119 (8%)

Query: 134 KQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIND 193
           K  AD  K EGN+   +  + +AIE Y+ A   +  D  Y +NR+ A  +  +YE+AI  
Sbjct: 256 KAKADAEKAEGNKFYKARKFDEAIEHYSKAWELH-KDITYLNNRAAAEYEKGEYETAIKT 314

Query: 194 ANFCI----SIDANF---SKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245
               +     + A++   SK++ R+ N   + ++   A+++Y+K   L +   PE +T+
Sbjct: 315 LTEAVEQGRELRADYKVISKSFARIGNSYHKLNELKKAIEFYQK--SLTEHRTPEILTK 371

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 48/166 (28%), Positives = 77/166 (46%), Gaps = 13/166 (7%)

Query: 98  LNESVKKNQSNISNDNNEKISINLNDTSKNNFSDKDKQIADTFKDEGNRLMFSE-----D 152
           L ++++  Q +++     +I   L +T K     + K   D  K E  RL   E     D
Sbjct: 357 LKKAIEFYQRSLTEHRTPEILTKLRNTEKELKLREAKSYIDPEKAEEARLQGKEFFTKGD 416

Query: 153 YKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIRLA 212
           +  A+  YT  I + P D   YSNR+    K+  +  AI D +  IS D NF +AYIR A
Sbjct: 417 WPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDPNFVRAYIRKA 476

Query: 213 NIKVQQHQYIDALD----YYKKFIELNKDSVPEKITREFEDLKLKV 254
           + ++   ++  A++       K +E+NK +      RE E L +K 
Sbjct: 477 SAQIAVREFAPAMETLDAARAKDLEINKGAN----AREIEQLYVKA 518

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 57/101 (56%), Gaps = 3/101 (2%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           A+ FK +GN    ++D++KA E ++ AI  S+ P + + YSNRS  Y  +  ++ A+ DA
Sbjct: 3   AEEFKKQGNAAFVAKDFEKAAELFSKAIESSETP-NHVLYSNRSACYTSLKKFKEALEDA 61

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
             C+ I+  +SK Y R+   +       DA   YKK +E++
Sbjct: 62  EECVKINPTWSKGYNRVGAAQYGLGNLDDAEKEYKKALEID 102

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 66/137 (48%), Gaps = 17/137 (12%)

Query: 134 KQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIND 193
           K  AD  K EGN+   +  + +AIE Y  A   +  D  Y +NRS A  +  DYE AI  
Sbjct: 264 KAKADAEKAEGNKYYKARKFDEAIEHYNKAWDLH-RDVTYLNNRSAAEYEKGDYEQAIKT 322

Query: 194 ANFCI----SIDANF---SKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITRE 246
               +     + A++   SK++ R+ N  ++      A+++Y++   L +   PE +T  
Sbjct: 323 LTEAVDQGREMRADYKLISKSFARIGNAYLKMDDLKKAIEFYQR--SLTEHRTPEILT-- 378

Query: 247 FEDLKLK-VQTDISLRE 262
               KL+  + ++ LRE
Sbjct: 379 ----KLRNTEKELKLRE 391

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 55/101 (54%), Gaps = 3/101 (2%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           AD +K +GN    ++DY+KA E +  AI  S+ P + + YSNRS  Y  +  +   + DA
Sbjct: 4   ADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQP-NHVLYSNRSACYTSLKKFAEGLKDA 62

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
             C+ I+  +SK Y R+   +   +   DA   Y+K +EL+
Sbjct: 63  EECVKINPGWSKGYNRVGAAQFGLNNLEDAEKSYQKALELD 103

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 49/94 (52%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D + A+  + EG       D+  A++ YT  I + P D   YSNR+ A  K+  +  AI 
Sbjct: 378 DPEKAEEARLEGKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIA 437

Query: 193 DANFCISIDANFSKAYIRLANIKVQQHQYIDALD 226
           D +  I  D NF +AYIR A+ ++   ++  A++
Sbjct: 438 DCDRAIEKDPNFIRAYIRKASAQIAVKEFAAAVE 471

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 56/121 (46%), Gaps = 13/121 (10%)

Query: 122 NDTSKNNFSDKDKQIA-DTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVA 180
           N+       +K  Q+A +  K EGN+   +  + +AIE Y  A   +  D  Y +NR+ A
Sbjct: 232 NEPEPMEVDEKGPQVAAEEEKAEGNKFYKARKFDEAIEHYNKAWELH-KDITYLNNRAAA 290

Query: 181 YLKVNDYESAINDANFCISIDAN---------FSKAYIRLANIKVQQHQYIDALDYYKKF 231
             +  DYE+AI  A    ++D            +K++ R+ N   +      ++++Y+K 
Sbjct: 291 EYEKGDYETAI--ATLTNAVDEGREMRADYKVIAKSFARIGNAYHKLGDLKKSINFYQKS 348

Query: 232 I 232
           +
Sbjct: 349 L 349

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 3/82 (3%)

Query: 132 KDKQIADT---FKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYE 188
           +D   A T   +K+EGN  + ++DY +A+E YT AI       I++SNR++A LK++ ++
Sbjct: 30  RDSMTAATALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQ 89

Query: 189 SAINDANFCISIDANFSKAYIR 210
           SA+ D+   I +DA   KAY R
Sbjct: 90  SALEDSARAIELDAGNVKAYHR 111

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 56/101 (55%), Gaps = 3/101 (2%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           A+ +K EGN    ++D++KAIE +  AI  S+ P + + YSNRS  Y  +  +  A+ DA
Sbjct: 4   AEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQP-NHVLYSNRSACYASMRKFREALADA 62

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
             C+ I  ++SK + RL           +A + YKK +EL+
Sbjct: 63  QECVRIKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALELD 103

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 63/126 (50%), Gaps = 8/126 (6%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D + A+  + +G     + D+  A++ YT  I + P D   YSNR+ A  K+  +  AI 
Sbjct: 384 DPEKAEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIK 443

Query: 193 DANFCISIDANFSKAYIRLANIKVQQHQY---IDALDYYK-KFIELNKDSVPEKITREFE 248
           D +  I  D NF +AYIR A  ++   +Y   I+ LD  + K  E+N  S     TRE +
Sbjct: 444 DCDMAIQKDPNFVRAYIRKATAQIAVQEYAAAIETLDTAREKDAEVNNGSN----TREID 499

Query: 249 DLKLKV 254
            L +K 
Sbjct: 500 QLYIKA 505

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 54/116 (46%), Gaps = 10/116 (8%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D+  A+  K +GN L     + +AI  Y  A   +  D  Y +NR+ A  +  DYESAI 
Sbjct: 250 DRSKAEEAKAKGNELYKKRQFDEAIANYEKAWDLH-KDITYLNNRAAAEYEKGDYESAIK 308

Query: 193 DANFCI----SIDANF---SKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPE 241
                +     + A++   +K++ RL N   +      A++YY+K   L +   PE
Sbjct: 309 TLEKAVEEGRELRADYKVIAKSFARLGNAHYKLADLKKAIEYYEK--SLTEHRTPE 362

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 57/101 (56%), Gaps = 3/101 (2%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           AD +K +GN    ++DY KAI+ ++ AI  S+ P + + YSNRS  Y  +  + +A+ DA
Sbjct: 5   ADEYKQQGNAAFVAKDYDKAIDLFSKAIDVSEQP-NHVLYSNRSACYTSLKKFVNALKDA 63

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
             C+ I+ ++SK Y R+           +A   YKK +EL+
Sbjct: 64  EECVKINPSWSKGYNRVGAAHFGMGDLDEAEAGYKKALELD 104

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 59/122 (48%), Gaps = 8/122 (6%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A+  + EG       D+  A++ YT  I + P D   YSNR+    K+  +  AI+D N 
Sbjct: 397 AEEARLEGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNK 456

Query: 197 CISIDANFSKAYIRLANIKVQQHQYIDALD----YYKKFIELNKDSVPEKITREFEDLKL 252
            I  D NF +AYIR A  ++   ++  AL+       K  E+NK +     TRE + L +
Sbjct: 457 AIEKDPNFVRAYIRKATAQIAVREFSSALETLDAARSKDAEVNKSAN----TREIDQLYI 512

Query: 253 KV 254
           K 
Sbjct: 513 KA 514

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 76/159 (47%), Gaps = 16/159 (10%)

Query: 94  EPSSLNESVKKNQSNISNDNNEKISINLNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDY 153
           EP      VKK +  +  D  E++ ++ N+       +  K+ A+  K EGN+L  +  +
Sbjct: 226 EPKKEETPVKKEEPVVQADEPEQMDVDSNE------DENAKKRAEAAKAEGNKLYKARQF 279

Query: 154 KKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCI----SIDANF---SK 206
            +A+  Y  A   +  D  Y +NRS A  +  DYE++I      +     + A++   +K
Sbjct: 280 DEAVAKYNEAWEAH-NDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGREMRADYKVIAK 338

Query: 207 AYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245
           ++ R+ N   + +    A+D+YKK   L +   PE +++
Sbjct: 339 SFARMGNCYTKLNDLKKAIDFYKK--SLTEHRTPEILSK 375

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 51/81 (62%)

Query: 130 SDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYES 189
           SD+D   A  FK++GN  +  +++ KA E Y+ AI       IY+SNR+ A+LK++++++
Sbjct: 5   SDEDVNKALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQT 64

Query: 190 AINDANFCISIDANFSKAYIR 210
           A+ND N  I +D    KAY R
Sbjct: 65  ALNDCNKAIELDPKNVKAYHR 85

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 54/86 (62%)

Query: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186
           +N ++ D+  A   K+EGN L+  + + KAIE YT AI       IY+SNR++++ KV++
Sbjct: 2   SNPTEADRVKAHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDN 61

Query: 187 YESAINDANFCISIDANFSKAYIRLA 212
           ++SA+ND +  I +D    KAY R A
Sbjct: 62  FQSALNDCDEAIKLDPKNIKAYHRRA 87

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 54/101 (53%), Gaps = 3/101 (2%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           A  +KD+GN    +++Y +AIE +T AI  S+ P + + YSNRS  Y     +   + DA
Sbjct: 5   AQEYKDQGNAAFVAKNYDEAIEKFTKAIEVSETP-NHVLYSNRSACYTSKKQFVKGLEDA 63

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
           N C+ I+  +SK Y R+           +A   YKK +EL+
Sbjct: 64  NECVKINPTWSKGYNRVGAAHFGMGDLDEAEKAYKKALELD 104

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 47/90 (52%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A+  + EG       D+  A++ YT  I++ P D   YSNR+ A  K+  +  AI D N 
Sbjct: 389 AEEARLEGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNT 448

Query: 197 CISIDANFSKAYIRLANIKVQQHQYIDALD 226
            I  D NF +AYIR A  ++    ++ A++
Sbjct: 449 AIEKDPNFIRAYIRKATAQIAIKDFVPAIE 478

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 59/109 (54%), Gaps = 8/109 (7%)

Query: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           D+ K  AD  K EGN+L  +  + +AIE Y  A   +  D  Y +NRS A  +  DY++A
Sbjct: 249 DESKIAADAEKAEGNKLYKAHKFDEAIEHYNKAWELH-NDITYLNNRSAAEFEKGDYQTA 307

Query: 191 INDANFCI----SIDANF---SKAYIRLANIKVQQHQYIDALDYYKKFI 232
           I   +  +     + A++   +K++ R+AN  ++ +    A++YY+K +
Sbjct: 308 IETLHEAVEKGREMRADYKLVAKSFTRIANSYMKLNDIKSAINYYQKSL 356

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/81 (40%), Positives = 48/81 (59%)

Query: 130 SDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYES 189
           S  D   A  FK+ GN  + ++DY  AIE YT AI       IY+SNR++ +LK+++++S
Sbjct: 5   SAADAAKALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQS 64

Query: 190 AINDANFCISIDANFSKAYIR 210
            IND +  + ID    KAY R
Sbjct: 65  GINDCDKALEIDPKNIKAYHR 85

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 55/90 (61%), Gaps = 6/90 (6%)

Query: 140 FKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCIS 199
            K+EGN  +  +D+ KAI+ YT AI       IY+SNR++A+LK+++++S++ND +  + 
Sbjct: 15  LKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALK 74

Query: 200 IDANFSKAYIRLANIKVQQHQYIDALDYYK 229
           +D   +KAY R      +   YI  L++ K
Sbjct: 75  LDPKNAKAYHR------RGLSYIGLLEFKK 98

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 52/86 (60%)

Query: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186
           +N ++ D+  A   K+EGN  +  + + KAIE YT AI       IY+SNR+ A+ KV++
Sbjct: 2   SNPTEADRANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDN 61

Query: 187 YESAINDANFCISIDANFSKAYIRLA 212
           ++SA+ND +  + +D    KAY R A
Sbjct: 62  FQSALNDCDEALKLDPKNIKAYHRRA 87

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D+  A   K+EGN  +  + + KAIE YT AI       IY+SNR+ A+ KV++++SA+N
Sbjct: 8   DRAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALN 67

Query: 193 DANFCISIDANFSKAYIRLA 212
           D +  I +D    KAY R A
Sbjct: 68  DCDEAIKLDPKNIKAYHRRA 87

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 80/185 (43%), Gaps = 22/185 (11%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A+  + EG       D+  A++ YT  I + P D   YSNR+ A  K+  +  AI+D N 
Sbjct: 385 AEEARLEGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNK 444

Query: 197 CISIDANFSKAYIR--LANIKVQQHQY-IDALDYYK-KFIELNKDSVPEKITREFEDLKL 252
            I  D NF +AYIR   A I V+   Y I+ LD  + K  E+N  +      RE + L +
Sbjct: 445 AIEKDPNFVRAYIRKATAQIAVKDFSYAIETLDAARTKDAEVNGGAN----AREIDQLYM 500

Query: 253 KVQTDISLREIXXXXXXXXXXXXXXXXXXXXPDIGSILGDGFAALLSNPMLQQMIFKIIQ 312
           K     + ++                     P++  I+ D        P+LQ  I +  Q
Sbjct: 501 K-----AAQQRFQPATGDETPEQTYERAMRDPEVAKIMQD--------PVLQS-ILQQAQ 546

Query: 313 NNPDA 317
           N+P A
Sbjct: 547 NDPAA 551

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 69/135 (51%), Gaps = 12/135 (8%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAI--SKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           AD +K +GN    ++ Y +A++ +T AI  S+ P + + YSNRS +Y     +  A+ DA
Sbjct: 5   ADEYKQQGNSAFAAKKYDEAVDLFTKAIEVSETP-NHVLYSNRSASYASEQKFNEALKDA 63

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITRE-FEDL--- 250
             C  I+ +++K Y R            DA   YKK +EL+ ++   KI +E  E +   
Sbjct: 64  LECTKINPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDANN---KIAKEGIEQIQRV 120

Query: 251 --KLKVQTDISLREI 263
             + + Q D+ L E+
Sbjct: 121 QSQRQAQPDLGLTEM 135

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 62/120 (51%), Gaps = 14/120 (11%)

Query: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDP--IYYSNRSVAYLKVNDYE 188
           D+ K  A+  K EGN+   + ++ +AI CY  A   +  D    Y +NRS A  +  +Y+
Sbjct: 245 DESKVAAEEAKVEGNKAYKARNFDEAIACYNKA---WELDNNITYLNNRSAAEFEKGEYD 301

Query: 189 SAINDANFCI----SIDANF---SKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPE 241
           +AIN  N  I     + A++   +K++ R+ N  V+     +A+++Y+K   L +   PE
Sbjct: 302 TAINTLNEAIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAINHYQK--SLTEHRTPE 359

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 45/72 (62%)

Query: 141 KDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISI 200
           K+EGN  +  + + KAIE YT AI       IY+SNR+ A+ KV++++SA+ND +  I +
Sbjct: 16  KNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKL 75

Query: 201 DANFSKAYIRLA 212
           D    KAY R A
Sbjct: 76  DPKNIKAYHRRA 87

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 52/90 (57%), Gaps = 6/90 (6%)

Query: 140 FKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCIS 199
            K+EGN+ +  + Y KA E YT AI   P + I YSNR+   LK+++++S+++DA   I 
Sbjct: 16  LKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKRAIE 75

Query: 200 IDANFSKAYIRLANIKVQQHQYIDALDYYK 229
           +D N  KAY R A        YI  L++ K
Sbjct: 76  LDNNNLKAYHRRA------MSYIGLLEFRK 99

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 47/76 (61%)

Query: 135 QIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           Q A   K+EGN+ +  + Y KA+E YT AI       I++SNR++A LK+++++S ++D 
Sbjct: 11  QQAIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDC 70

Query: 195 NFCISIDANFSKAYIR 210
           N  + +D    KAY R
Sbjct: 71  NSALELDPKNIKAYHR 86

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 48/87 (55%)

Query: 143 EGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDA 202
           EG +   + +Y KA++CYT  I   P  P+ + NR+  + K+      I+D +  IS+D 
Sbjct: 435 EGKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDP 494

Query: 203 NFSKAYIRLANIKVQQHQYIDALDYYK 229
           ++ KAY+R    ++ +    +AL+ ++
Sbjct: 495 SYIKAYVRKGFAQITERDLDEALETWE 521

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 58/104 (55%), Gaps = 1/104 (0%)

Query: 140 FKDEGNRLMFSEDYKKAIECYTNAISKYPCDP-IYYSNRSVAYLKVNDYESAINDANFCI 198
            K+ GN+    + Y++A+  +T+A+S+   +  I YSNR+ A++ +  Y  A+ D   C+
Sbjct: 11  LKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCV 70

Query: 199 SIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEK 242
            +  N+ K Y R+    +   +  +A + +KK ++LN+ +V  K
Sbjct: 71  ELAPNWDKGYSRVGVAYLGLQKLDEAEENFKKALQLNEQNVHAK 114

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 58/106 (54%), Gaps = 6/106 (5%)

Query: 130 SDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYES 189
           S +D   A  FK++GN  +   DY  AIE Y+ AI+      IY+SNR++A+LK +++ S
Sbjct: 5   SQEDIATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYS 64

Query: 190 AINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
           A+ D +  + +D    KAY R      +   Y+  L++ K   +LN
Sbjct: 65  AVVDCDNALKLDPKNIKAYHR------RGLSYVGILEFRKAKNDLN 104

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 56/105 (53%), Gaps = 8/105 (7%)

Query: 121 LNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVA 180
           LND +K  +       A   K++GN L   +D++ AI+ YT A+S    DP+YYSN S  
Sbjct: 86  LNDKTKEEW-------AGALKEKGNALFKKKDFENAIKYYTFALS-LKEDPVYYSNISAC 137

Query: 181 YLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
           Y  + +YE  I  A   +++  ++SK  +R AN   +   + DA+
Sbjct: 138 YSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAM 182

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           D+ K  A   KD+GN L   + ++ AIE Y +AI K   DP+++SN S  Y+ + D +  
Sbjct: 87  DQKKVYATALKDKGNALFKEKRFEDAIEFYNHAI-KLHEDPVFHSNISACYVSLGDLDKV 145

Query: 191 INDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
           +  +   + +  ++SKA +R A+      +Y DA+
Sbjct: 146 VESSTRALELKPDYSKALLRRASAYENMGRYQDAM 180

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 60/112 (53%), Gaps = 2/112 (1%)

Query: 114 NEKISINLNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIY 173
           NEK   +L++ ++ +   KDK  A   KD+GN    ++ Y +AI+ Y+ AI +   DP++
Sbjct: 73  NEKGEPDLSNLAELSDEQKDK-YAMGLKDKGNEFFKNKKYDEAIQYYSWAI-EVKEDPVF 130

Query: 174 YSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
           YSNRS  Y+ +   E  + D    + +  ++SK  +R A+       + DA+
Sbjct: 131 YSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAM 182

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 52/99 (52%), Gaps = 2/99 (2%)

Query: 128 NFSDKDKQ-IADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186
            F+++ K+  A   KD+GN     + Y++AI+ Y  A+ K   DP++YSNRS  Y+ +N 
Sbjct: 85  TFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCAL-KLKEDPVFYSNRSACYVPLNK 143

Query: 187 YESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
            E  + D    + +  ++SK  +R A        Y DA+
Sbjct: 144 LEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAM 182

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 49/81 (60%), Gaps = 2/81 (2%)

Query: 130 SDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYES 189
           +D DK +   +K+EGN  +  +DY KAIE Y  AI       +Y+SNR++ +LK+++++ 
Sbjct: 4   TDADKAL--EYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQC 61

Query: 190 AINDANFCISIDANFSKAYIR 210
           A  D +  +++D    KAY R
Sbjct: 62  ASQDCDKALALDPKNVKAYHR 82

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 49/81 (60%)

Query: 130 SDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYES 189
           S  D   A  +KD+GN  +  +D+ KA E YT AI       I++SNR++A+LK ++++ 
Sbjct: 5   SAADSAKALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQL 64

Query: 190 AINDANFCISIDANFSKAYIR 210
           ++ND +  + +D+   KAY R
Sbjct: 65  SLNDCDKALELDSKNIKAYHR 85

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 46/92 (50%)

Query: 134 KQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIND 193
           ++ A   KD+GN    S+++  AI+ Y +AI   P DP++YSN S  Y+   D    +  
Sbjct: 122 QEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEY 181

Query: 194 ANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
               + I  + SKA +R A+       + DA+
Sbjct: 182 TTKALEIKPDHSKALLRRASANESLGNFTDAM 213

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           ++ K+I+   KD+GN+   ++DY  AI+ Y  A+     DPI+YSN S  Y+ +   +  
Sbjct: 116 EEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKV 174

Query: 191 INDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
           I  +   + ++ N+SKA +R A+       Y DAL
Sbjct: 175 IESSTKALELNPNYSKALLRRASANESLENYSDAL 209

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 58/101 (57%), Gaps = 2/101 (1%)

Query: 126 KNNFSDKDKQ-IADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKV 184
           K+ F++++K+  +   KD+GN L  ++ +++AI+ Y  AI +   +PI+YSN S  Y+ +
Sbjct: 99  KDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAI-ELKENPIFYSNLSACYVSL 157

Query: 185 NDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
           N  E  I   N  + +  ++SK  +R AN   +   Y DA+
Sbjct: 158 NKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAM 198

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 57/103 (55%), Gaps = 2/103 (1%)

Query: 124 TSKNNFSDKDKQ-IADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYL 182
           + K++FSD+ K+  A   KD+GN     +D++ A++ Y  A++    DP++YSN S  Y+
Sbjct: 91  SGKDSFSDELKEKYAMALKDKGNDYFKKQDFENALKYYNYALT-LKQDPVFYSNISACYV 149

Query: 183 KVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
            +   E  +  +   + +  ++SKA +R A+       Y+DA+
Sbjct: 150 SLGQLEKVVESSTEALKLKHDYSKALLRRASAYESLANYVDAM 192

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 139 TFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCI 198
             KD+GN L   +  ++AI+ Y  A+ ++  DP++Y+N S  Y+ +ND+E  + + N  +
Sbjct: 108 ALKDKGNELFKEKAVEEAIKYYQWAL-EFKKDPVFYANISACYVSLNDFEKVLENCNKAL 166

Query: 199 SIDANFSKAYIRLANIKVQQHQYIDAL 225
            +  ++SK  +R AN       + DA+
Sbjct: 167 ELKPDYSKVLLRRANTYENMENFADAM 193

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 59/112 (52%), Gaps = 2/112 (1%)

Query: 114 NEKISINLNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIY 173
           +EK   +L    + +  +KDK  A   KD+GN    ++ ++ A++ Y+ AI +   DP++
Sbjct: 74  DEKGEPDLGKVDELSAEEKDK-FAMGLKDKGNEFFKNKQFEDALKYYSLAI-EVKEDPVF 131

Query: 174 YSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
           YSNRS  Y+ +   E  + D    + +  ++SK  +R A+      ++ DA+
Sbjct: 132 YSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAM 183

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 33/51 (64%)

Query: 141 KDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAI 191
           K++GN L     Y++A+ CY   I+  P +P+ YSN+++A +K+ +Y  AI
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAI 58

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 55/100 (55%), Gaps = 2/100 (2%)

Query: 127 NNFSDKDKQ-IADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVN 185
           ++F+++ K+  +   KD+GN     + Y++AI+ Y+ A+ +   DP++YSNRS  ++ +N
Sbjct: 87  DSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCAL-RLKKDPVFYSNRSACWVPLN 145

Query: 186 DYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
             E  + D    + +  ++SK  +R A        + DA+
Sbjct: 146 KLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAM 185

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 1/96 (1%)

Query: 130 SDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYES 189
           +D+  + A   KD+GN     +DY+ A++ Y  A+     DP++YSN S  Y+ +N+ + 
Sbjct: 101 ADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALI-LKKDPVFYSNMSACYVSLNELDK 159

Query: 190 AINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
            I  +   + +  ++SKA +R A    Q   Y DA+
Sbjct: 160 VIEMSTKALELKPDYSKALLRRATANEQLENYSDAM 195

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 43/90 (47%)

Query: 136 IADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDAN 195
            A   KD+GN    ++ +  AI+ Y  AI   P DP++YSN S  Y+   D +  +    
Sbjct: 130 FAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTT 189

Query: 196 FCISIDANFSKAYIRLANIKVQQHQYIDAL 225
             + I  + SKA +R A+       + DA+
Sbjct: 190 KALEIKPDHSKALLRRASANESLGNFTDAM 219

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 62/127 (48%), Gaps = 16/127 (12%)

Query: 86  KETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKNNFSDKDKQIADTFKDEGN 145
           +E TP T +P  L +S    + N+S+ ++      L + +KN +       A   KD+GN
Sbjct: 74  QEDTPTTKKPIYLVDS--NGEPNLSDIDS------LTEETKNEW-------AMALKDKGN 118

Query: 146 RLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFS 205
            L  +  ++ AI+ Y  A+ K   DPIYYSN S  Y  +  YE  I  A   + +   FS
Sbjct: 119 ELFKTSKFEDAIKYYHYAL-KLKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFS 177

Query: 206 KAYIRLA 212
           K  +R A
Sbjct: 178 KVLMRRA 184

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%)

Query: 140 FKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCIS 199
            K+ GN    ++++ +AI+ Y  AI   P +P++YSN S  Y+   D E  I      + 
Sbjct: 130 LKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALE 189

Query: 200 IDANFSKAYIRLANIKVQQHQYIDAL 225
           I  + SKA +R A+       + DA+
Sbjct: 190 IKPDHSKALLRRASANESLGNFTDAM 215

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 57/103 (55%), Gaps = 2/103 (1%)

Query: 124 TSKNNFSDKDK-QIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYL 182
           ++K NF+ ++K + A   KD+GN+   ++ Y  AI+ Y  A+ +   DP++YSN S  Y+
Sbjct: 85  SNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWAL-ELKEDPVFYSNLSACYV 143

Query: 183 KVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
            V D +  +  +   + +  ++SK  +R A+      ++ DA+
Sbjct: 144 SVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAM 186

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 73/151 (48%), Gaps = 22/151 (14%)

Query: 130 SDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYES 189
           S++  Q A  FK++GN  +  + Y +A+E Y+ AI       I++SNR+ + LK++++ +
Sbjct: 5   SEEAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLT 64

Query: 190 AINDANFCISIDA-----------------NFSKAYIRLANI---KVQQHQYIDALDYYK 229
           A+ D N  I +D                   FSKA   L  I   K  +   + AL+  +
Sbjct: 65  ALEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTILQVKPNEQSALKALEVCE 124

Query: 230 KFIELNKDSVPEKITREFEDLKLKVQTDISL 260
           +FI   ++   + I+ + E+ K+ V   + L
Sbjct: 125 RFIR--EERFKKAISGDGEESKVNVCASLQL 153

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 49/95 (51%), Gaps = 1/95 (1%)

Query: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           ++ ++ A   KD+GN     + +  AI+ Y  A+ +   DP++YSNRS  Y+ +   E  
Sbjct: 96  EQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNLAL-ELKKDPVFYSNRSACYVSMGQLEKV 154

Query: 191 INDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
           + D    + + +++SK  +R A+       Y DA+
Sbjct: 155 VEDTTAALKLKSDYSKCLLRRASANESLGNYADAM 189

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 39/70 (55%)

Query: 141 KDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISI 200
           K+EGN L     Y+ AI CY   I+  P +P+ +SN+++A +K+ ++  AI      + +
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 201 DANFSKAYIR 210
            A+   A +R
Sbjct: 68  AASPQHAALR 77

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 55/103 (53%), Gaps = 2/103 (1%)

Query: 124 TSKNNFSDKDK-QIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYL 182
           + K NF+ ++K + A   KD+GN+   ++ Y  AI+ Y  A+ +   DP++YSN S  Y+
Sbjct: 85  SKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWAL-ELKEDPVFYSNLSACYV 143

Query: 183 KVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
            V D +  +  +   + I  ++SK  +R A+       + DA+
Sbjct: 144 SVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAM 186

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 56/103 (54%), Gaps = 2/103 (1%)

Query: 124 TSKNNFSDKDK-QIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYL 182
           ++K NF+ ++K + A   KD+GN+   ++ Y  AI+ Y  A+ +   DP++YSN S  Y+
Sbjct: 85  SNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWAL-ELKDDPVFYSNLSACYV 143

Query: 183 KVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
            V D +  +  +   + +  ++SK  +R A+       + DA+
Sbjct: 144 SVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAM 186

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 43/86 (50%)

Query: 140 FKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCIS 199
            K++GN    ++++ +AI+ Y  AI   P DP++YSN S  Y+   D    +      + 
Sbjct: 127 LKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALE 186

Query: 200 IDANFSKAYIRLANIKVQQHQYIDAL 225
           I  + SKA +R A+       + DA+
Sbjct: 187 IKPDHSKALLRRASANESLGNFTDAM 212

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 46/87 (52%), Gaps = 1/87 (1%)

Query: 139 TFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCI 198
             KD+GN     +DY  A++ Y  A++    DP++YSN S  Y+ +N  +  + ++   +
Sbjct: 108 ALKDKGNEFFKQKDYDNALKYYDYALT-LKKDPVFYSNISACYVSMNQLDKVVENSTKAL 166

Query: 199 SIDANFSKAYIRLANIKVQQHQYIDAL 225
            +  ++SKA +R A+       Y DA+
Sbjct: 167 ELKPDYSKALLRRASANESLENYPDAM 193

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 45/79 (56%), Gaps = 1/79 (1%)

Query: 135 QIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           + A   K++GN+   S+D + AI+ Y  A+ +   DP++YSN S  Y  +N  +  I  +
Sbjct: 156 KFAKELKNKGNQYFKSKDNENAIKYYEYAL-RLDQDPVFYSNISACYFAMNQLDKVIESS 214

Query: 195 NFCISIDANFSKAYIRLAN 213
           N  + +  ++SKA +R AN
Sbjct: 215 NKALELKPDYSKALLRRAN 233

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 53/95 (55%), Gaps = 6/95 (6%)

Query: 135 QIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDA 194
           Q A  FK++GN  +  + Y++A+E Y+ AI       IY+SNR+ + L+++++ +A  D 
Sbjct: 8   QQALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDC 67

Query: 195 NFCISIDANFSKAYIRLANIKVQQHQYIDALDYYK 229
           +  I++D    KA      I  +   Y+  L+++K
Sbjct: 68  DKAIALDPKNIKA------IHRRGLSYVGLLEFFK 96

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 58/119 (48%), Gaps = 3/119 (2%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D Q A T+   G   M   DY  A + +  A+++   +PI++ +  V Y +++ Y  A++
Sbjct: 307 DSQDATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALD 366

Query: 193 DANFCISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKDSVPEKITREFEDL 250
                I ++   S+ +  L  + +   +Q  DALD YK+   L+ +++   I +  E L
Sbjct: 367 AYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPENI--HIRKRLESL 423

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%)

Query: 138 DTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAI 191
           D FK EGN+     +Y  AI+ Y   I   P +PI YSN+++A +K N  + A+
Sbjct: 4   DHFKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAV 57

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 55/103 (53%), Gaps = 2/103 (1%)

Query: 124 TSKNNFSDKDK-QIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYL 182
           + K +F+ ++K + A   KD+GN+   ++ Y  AI+ Y  A+ +   DP++YSN S  Y+
Sbjct: 85  SKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWAL-ELKEDPVFYSNLSACYV 143

Query: 183 KVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
            V D +  +  +   + +  ++SK  +R A+       + DA+
Sbjct: 144 SVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAM 186

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 58/124 (46%), Gaps = 3/124 (2%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D   A T+   G   M   DY  A + +  A+++   +PI++ +  V Y +++ Y  A++
Sbjct: 301 DPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALD 360

Query: 193 DANFCISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKDSVPEKITREFEDLK 251
                I ++   S+ +  L  + +    Q  DALD YK+   L+ D+V   I    E L 
Sbjct: 361 AYTRAIRLNPYISEVWYDLGTLYETCNKQLNDALDAYKQAARLDPDNV--HIRERLESLA 418

Query: 252 LKVQ 255
            ++Q
Sbjct: 419 QQLQ 422

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 44/89 (49%), Gaps = 1/89 (1%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A   KD GN     +DY  A++ Y  A+     DP++YSN S  Y+ +   +  + ++  
Sbjct: 101 ATALKDRGNEFFKKKDYDNALKYYNYALV-VKKDPVFYSNISACYVSLGQLDKVVENSTK 159

Query: 197 CISIDANFSKAYIRLANIKVQQHQYIDAL 225
            + +  ++SKA +R A+       Y DA+
Sbjct: 160 ALELKPDYSKALLRRASANESLENYADAM 188

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 49/87 (56%), Gaps = 2/87 (2%)

Query: 128 NFSDKDKQI-ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186
           NF+++ K+  +   KD+GN+    + Y+ A++ Y  A+     DP++YSN S  Y+ + +
Sbjct: 89  NFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALD-LKQDPVFYSNISACYVSLGN 147

Query: 187 YESAINDANFCISIDANFSKAYIRLAN 213
            E  +  +   + +  ++SKA +R A+
Sbjct: 148 LEKVVESSTKALELKPDYSKALLRRAS 174

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 50/106 (47%), Gaps = 1/106 (0%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D + + T+   G   M   DY  A E +  A+++   +PI++ +  V Y ++  Y  A++
Sbjct: 282 DSEDSTTWYHLGRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQIYQYRDALD 341

Query: 193 DANFCISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKD 237
                I ++   S+ +  L  + +   +Q  DALD YK+   L  D
Sbjct: 342 AYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLEPD 387

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 44/89 (49%), Gaps = 6/89 (6%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCD-----PIYYSNRSVAYLK 183
           +  +  +IA  FK++GN L   + ++ A E Y  AI    CD        Y+NR+   L+
Sbjct: 66  YEGEPHEIAGNFKNQGNDLYKVKRFRDARELYNKAID-VKCDDDKINESLYANRAACELE 124

Query: 184 VNDYESAINDANFCISIDANFSKAYIRLA 212
           + +Y   IND    +S++    K Y R+A
Sbjct: 125 LKNYRRCINDCKMALSLNPKNIKCYFRMA 153

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 57/119 (47%), Gaps = 3/119 (2%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D   A T+   G   M   DY  A + +  A+++   +PI++ +  V Y +++ Y  A++
Sbjct: 300 DPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALD 359

Query: 193 DANFCISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKDSVPEKITREFEDL 250
                I ++   S+ +  L  + +   +Q  DALD Y++   L+ D+V   I +  E L
Sbjct: 360 AYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYRQASRLDPDNV--HIKKRLEAL 416

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%)

Query: 138 DTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAI 191
           + +K+EGNR      YK A E Y   +   P +PI YSN+++A +K+  Y   +
Sbjct: 4   EQYKEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVV 57

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 52/104 (50%), Gaps = 1/104 (0%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A T+   G   M   DY  A + +  A+++   +PI++ +  V Y +++ Y  A++    
Sbjct: 276 ATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTR 335

Query: 197 CISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKDSV 239
            I ++   S+ +  L  + +   +Q  DALD YK+   L+ ++V
Sbjct: 336 AIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPENV 379

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%)

Query: 138 DTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDAN 195
           DT K +GN      DY+ A+  Y  AI+  P +PI YSN ++  +K+  +  A++  N
Sbjct: 5   DTLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACN 62

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 53/108 (49%), Gaps = 1/108 (0%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D   A T+   G   M   DY  A + +  A+++   +PI++ +  V Y +++ Y  A++
Sbjct: 311 DPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALD 370

Query: 193 DANFCISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKDSV 239
                I ++   S+ +  L  + +   +Q  DALD YK+   L+ +++
Sbjct: 371 AYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPENI 418

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 61/125 (48%), Gaps = 6/125 (4%)

Query: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           + D   A T+   G   M   DY  A + +  A+++   +PI++ +  V Y +++ Y  A
Sbjct: 292 EADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 351

Query: 191 INDANFCISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKDSVP-----EKIT 244
           ++     I ++   S+ +  L  + +   +Q  DALD YK+   L+ ++V      E +T
Sbjct: 352 LDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVHIRERLEALT 411

Query: 245 REFED 249
           ++ E+
Sbjct: 412 KQLEN 416

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 40.0 bits (92), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 32/51 (62%)

Query: 141 KDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAI 191
           K+ GN L     Y++A++ Y   I+  P +P+ YSN+++A +K+ +Y  AI
Sbjct: 12  KELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAI 62

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 55/113 (48%), Gaps = 3/113 (2%)

Query: 139 TFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCI 198
           T+   G   M   DY  A + +  A+++   +PI++ +  V Y +++ Y  A++     I
Sbjct: 308 TWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAI 367

Query: 199 SIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKDSVPEKITREFEDL 250
            ++   S+ +  L  + +   +Q  DALD YK+   L+ ++V   I +  E L
Sbjct: 368 RLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPENV--HIRKRLESL 418

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 36/64 (56%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           +D  + +GN L    +Y+ A+  Y NA    P +P++ +N S+A LK+  +E A++  + 
Sbjct: 8   SDHLRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDR 67

Query: 197 CISI 200
            + I
Sbjct: 68  ALEI 71

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 61/125 (48%), Gaps = 6/125 (4%)

Query: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           + D   A T+   G   M   DY  A + +  A+++   +PI++ +  V Y +++ Y  A
Sbjct: 284 EADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 343

Query: 191 INDANFCISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKDSVP-----EKIT 244
           ++     I ++   S+ +  L  + +   +Q  DALD YK+   L+ ++V      E +T
Sbjct: 344 LDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVHIRERLEALT 403

Query: 245 REFED 249
           ++ E+
Sbjct: 404 KQLEN 408

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 51/106 (48%), Gaps = 1/106 (0%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D   A T+   G   M   DY  A + +  A+++   +PI++ +  V Y +++ Y  A++
Sbjct: 300 DPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALD 359

Query: 193 DANFCISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKD 237
                I ++   S+ +  L  + +   +Q  DALD YK+   L+ +
Sbjct: 360 AYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPE 405

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 39.7 bits (91), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 31/55 (56%)

Query: 141 KDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDAN 195
           K EGNRL    DY  A + Y   I + P +PI YSN++++ +K   ++ AI   N
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCN 61

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 42.0 bits (97), Expect = 0.002,   Method: Composition-based stats.
 Identities = 27/108 (25%), Positives = 53/108 (49%), Gaps = 1/108 (0%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D   A T+   G   M   DY  A + +  A+++   +PI++ +  V Y +++ Y  A++
Sbjct: 281 DPSDATTWYHLGRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALD 340

Query: 193 DANFCISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKDSV 239
                I ++   S+ +  L  + +   +Q  DALD YK+   L+ ++V
Sbjct: 341 AYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPENV 388

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 61/125 (48%), Gaps = 6/125 (4%)

Query: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           + D   A T+   G   M   DY  A + +  A+++   +PI++ +  V Y +++ Y  A
Sbjct: 290 EADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 349

Query: 191 INDANFCISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKDSVP-----EKIT 244
           ++     I ++   S+ +  L  + +   +Q  DALD YK+   L+ ++V      E +T
Sbjct: 350 LDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVHIRERLEALT 409

Query: 245 REFED 249
           ++ E+
Sbjct: 410 KQLEN 414

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 61/125 (48%), Gaps = 6/125 (4%)

Query: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           + D   A T+   G   M   DY  A + +  A+++   +PI++ +  V Y +++ Y  A
Sbjct: 294 EADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 353

Query: 191 INDANFCISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKDSVP-----EKIT 244
           ++     I ++   S+ +  L  + +   +Q  DALD YK+   L+ +++      E +T
Sbjct: 354 LDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNIHIRERLEALT 413

Query: 245 REFED 249
           ++ E+
Sbjct: 414 KQLEN 418

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 68/145 (46%), Gaps = 17/145 (11%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPI-----YYSNRSVAYLK 183
           +  +  +IA+ FK++GN L   + ++ A E YT  I +  CD        Y+NR+   L+
Sbjct: 70  YEGEPHEIAENFKNQGNDLYKVKRFRDAREIYTKGI-EMKCDVAKINESLYANRAACQLE 128

Query: 184 VNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDA---LDYYKKFIELNKD--- 237
           + ++ S I+D    ++ +    K Y R+       +++  A   +++ +K    NK    
Sbjct: 129 LKNFRSCISDCKTALTYNPKNIKCYFRMGKAFTAINKFESARESIEFGQKIDNDNKSFEN 188

Query: 238 -----SVPEKITREFEDLKLKVQTD 257
                   E+  R++E+ KLK Q D
Sbjct: 189 LLNIIKNKEEEIRKYEEKKLKAQQD 213

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 40.8 bits (94), Expect = 0.005,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 60/124 (48%), Gaps = 3/124 (2%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D   A T+   G   M   DY  A + +  A+++   +PI++ +  V Y +++ Y  A++
Sbjct: 294 DPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALD 353

Query: 193 DANFCISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKDSVPEKITREFEDLK 251
                I ++   S+ +  L  + +   +Q  DALD YK+   L+ +++   I +  E L 
Sbjct: 354 AYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARLDPENI--HIRKRLETLT 411

Query: 252 LKVQ 255
            +++
Sbjct: 412 AQLE 415

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 6/89 (6%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCD-----PIYYSNRSVAYLK 183
           +  +  ++A+ FK++GN L  ++ YK A E Y   I    CD        +SNR+   L+
Sbjct: 70  YEGEPHEVAENFKNQGNDLYRAKRYKDAREIYNRGID-IKCDDSKVNESLFSNRAACELE 128

Query: 184 VNDYESAINDANFCISIDANFSKAYIRLA 212
           + +Y   +ND    +  +    K Y R+A
Sbjct: 129 LKNYRRCVNDCKRALQYNVKNIKCYYRIA 157

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 46/88 (52%), Gaps = 4/88 (4%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAIS-KYPCDPI---YYSNRSVAYLKV 184
           +  +  ++A+ FK++GN L   + +++A + Y   I  K   D I    ++NR+   L++
Sbjct: 72  YEGEPHEVAENFKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLEL 131

Query: 185 NDYESAINDANFCISIDANFSKAYIRLA 212
            +Y S IND    ++++    K Y R+ 
Sbjct: 132 KNYRSCINDCKHALTLNPKNIKCYYRMG 159

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 52/104 (50%), Gaps = 1/104 (0%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A T+   G   M   DY  A + + +A+++   +P ++ +  V Y +++ Y  A++    
Sbjct: 316 ATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTR 375

Query: 197 CISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKDSV 239
            I ++   S+ +  L  + +   +Q  DALD YK+   L+ ++V
Sbjct: 376 AIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDTNNV 419

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 59/125 (47%), Gaps = 3/125 (2%)

Query: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           + D   A T+   G   M   DY  A + +  A+++   +P ++ +  V Y +++ Y  A
Sbjct: 306 EADSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDA 365

Query: 191 INDANFCISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKDSVPEKITREFED 249
           ++     I ++   S+ +  L  + +   +Q  DALD YK+ + L+ ++V   I    E 
Sbjct: 366 LDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAVRLDPNNV--HIRERLEA 423

Query: 250 LKLKV 254
           L  ++
Sbjct: 424 LTAQL 428

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 38.1 bits (87), Expect = 0.007,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 7/61 (11%)

Query: 131 DKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           +KDKQ       +GN L     Y +A++ Y   I+  P +P+ YSN+++A +K+ ++  A
Sbjct: 9   EKDKQ-------QGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQA 61

Query: 191 I 191
           I
Sbjct: 62  I 62

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 6/87 (6%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCD-----PIYYSNRSVAYLK 183
           +  +  +IA+ FK +GN L  ++ +K A E YT  I+   C+        ++NR+   L+
Sbjct: 75  YEGEPHEIAENFKKQGNELYKAKRFKDARELYTKGIA-VECEDKSINESLFANRAACELE 133

Query: 184 VNDYESAINDANFCISIDANFSKAYIR 210
           + +Y   I D +  ++I+    K Y R
Sbjct: 134 LKNYRRCIEDCSKALTINPKNIKCYYR 160

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 51/104 (49%), Gaps = 1/104 (0%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A T+   G   M   DY  A + +  A+++   +P ++ +  V Y +++ Y  A++    
Sbjct: 308 ATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTR 367

Query: 197 CISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKDSV 239
            I ++   S+ +  L  + +   +Q  DALD YK+   L+ ++V
Sbjct: 368 AIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPNNV 411

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 52/104 (50%), Gaps = 1/104 (0%)

Query: 137 ADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANF 196
           A T+   G   M   DY  A + + +A+++   +P ++ +  V Y +++ Y  A++    
Sbjct: 312 ATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTR 371

Query: 197 CISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIELNKDSV 239
            I ++   S+ +  L  + +   +Q  DALD YK+   L+ ++V
Sbjct: 372 AIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDTNNV 415

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%)

Query: 138 DTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAI 191
           +  K +GN    +  Y +AI  Y   IS  P +PI YSN+++A LK + ++ AI
Sbjct: 4   EELKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAI 57

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 37.7 bits (86), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%)

Query: 138 DTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           +T K++GN    + ++  A E Y   I   P +PI YSNR++A +K+  +   I+
Sbjct: 5   ETVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETID 59

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 45/89 (50%), Gaps = 6/89 (6%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCD-----PIYYSNRSVAYLK 183
           +  +  +IA+ FK +GN L  ++ +K A E YT  ++   C+        ++NR+   L+
Sbjct: 75  YEGEPHEIAENFKKQGNELYKAKRFKDARELYTKGVA-VECEDKSINESLFANRAACELE 133

Query: 184 VNDYESAINDANFCISIDANFSKAYIRLA 212
           + +Y   + D    ++I+    K Y R++
Sbjct: 134 LKNYRKCVEDCGKALTINPKNIKCYYRIS 162

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 44/87 (50%), Gaps = 6/87 (6%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCD-----PIYYSNRSVAYLK 183
           +  +  +IA+ FK +GN L  ++ +K A E Y+  ++   C+        Y+NR+   L+
Sbjct: 75  YEGEPHEIAENFKKQGNELYKAKRFKDARELYSKGLA-VECEDKSINESLYANRAACELE 133

Query: 184 VNDYESAINDANFCISIDANFSKAYIR 210
           + +Y   I D +  ++I+    K Y R
Sbjct: 134 LKNYRRCIEDCSKALTINPKNVKCYYR 160

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 6/89 (6%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPI-----YYSNRSVAYLK 183
           +  +  +IA  FK++GN L  ++ +K A E Y   I +  CD        Y+NR+   L+
Sbjct: 70  YEGEPHEIAGNFKNQGNDLYKAKRFKDARELYNKGI-EIKCDDTSINESLYANRAACELE 128

Query: 184 VNDYESAINDANFCISIDANFSKAYIRLA 212
           + +Y   +ND    +  +    K Y R+ 
Sbjct: 129 IKNYRRCLNDCKTALQYNPKNLKCYYRMG 157

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 1/103 (0%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           D   A T+   G   M   DY  A + +  A+++   +PI++ +  V Y +++ Y  A++
Sbjct: 309 DPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALD 368

Query: 193 DANFCISIDANFSKAYIRLANI-KVQQHQYIDALDYYKKFIEL 234
                I ++   S+ +  L  + +   +Q  DALD YK+   L
Sbjct: 369 AYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARL 411

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 4/88 (4%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAIS-KYPCDPI---YYSNRSVAYLKV 184
           +  +  +IA+ FK +GN L   + ++ A E Y+  I  K   + I    Y+NR+   L++
Sbjct: 73  YEGEPHEIAENFKKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEI 132

Query: 185 NDYESAINDANFCISIDANFSKAYIRLA 212
            +Y   IND    + ++    K Y R+A
Sbjct: 133 KNYRRCINDCKQALQLNPKNIKCYYRIA 160

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 52/131 (39%), Gaps = 10/131 (7%)

Query: 110 SNDNNEKISINLNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPC 169
             D    ++ NL       +  +  +IA  FK+ GN     + Y+ A E YT  I    C
Sbjct: 47  ETDGEGGVNDNLEALKALAYEGEPHEIAGNFKNRGNEFYKLKQYRDAREVYTKGID-VKC 105

Query: 170 D-----PIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDA 224
           D        Y+NR+   L++ ++   I D    +S +    K Y R+    +     +D 
Sbjct: 106 DDDKINESLYANRAACELELKNFRKCIEDCKKALSFNVKNIKCYYRMGKAFLS----VDR 161

Query: 225 LDYYKKFIELN 235
            D  K+ IE  
Sbjct: 162 FDESKESIEFG 172

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 6/84 (7%)

Query: 135 QIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCD-----PIYYSNRSVAYLKVNDYES 189
           ++A+ FK++GN L   + YK A E Y   I +  CD        +SNR+   L++ +Y  
Sbjct: 76  EVAENFKNQGNELYKVKRYKDAREIYNKGI-EIKCDSNKINESLFSNRAACELELKNYRR 134

Query: 190 AINDANFCISIDANFSKAYIRLAN 213
            +ND    +  +    K + R+A 
Sbjct: 135 CVNDCRQALQFNPTNIKCFYRIAR 158

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 50/103 (48%), Gaps = 6/103 (5%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPI-----YYSNRSVAYLK 183
           +  +  +IA  FK++GN L   + +K A   Y  A+    CD +      Y N +   L+
Sbjct: 62  YEGEPHEIATNFKNQGNDLYKGKRFKDARAMYLKALD-VKCDVLSINESLYLNLAACELE 120

Query: 184 VNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALD 226
           + +Y S IN     + ++A   KA+ R+    ++  ++ D+L+
Sbjct: 121 IKNYRSCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSLE 163

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%)

Query: 135 QIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAIN 192
           + A+  K +GN    + DY+ AI  Y  A +    +PIY+SN + A +K+  ++ A+N
Sbjct: 39  ETAEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVN 96

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 53/107 (49%), Gaps = 7/107 (6%)

Query: 119 INLNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRS 178
           + L +T++ N      + A   K  GN     +DY+ AI  Y  A+ +   DP++YSN +
Sbjct: 74  MKLAETAEKN------EYASELKKRGNAYFKVKDYENAINYYKFAL-QLKNDPVFYSNMA 126

Query: 179 VAYLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDAL 225
             Y+ +   + AI   +  + ++ ++SK  ++ A +     ++ DAL
Sbjct: 127 ACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADAL 173

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 37.0 bits (84), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 28/57 (49%)

Query: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLK 183
           N   DK       FKD GN      +Y  AIE Y   IS  P + + YSN ++AYLK
Sbjct: 25  NGLQDKLTMSFQHFKDIGNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLK 81

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 38.1 bits (87), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 59/119 (49%), Gaps = 6/119 (5%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCD-----PIYYSNRSVAYLK 183
           +  +  +IA+ FK++ N L   + ++ A E YT  I  + C+        ++NR+   L+
Sbjct: 77  YEGEPHEIAENFKNQANDLYKVKRFRDARELYTKGIKVF-CEDKSINESLFANRAACELE 135

Query: 184 VNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEK 242
           + +Y S + D    + I+    K + R+    +   ++ +A D     +++++++VP K
Sbjct: 136 LKNYRSCVADCQKAMEINPMNLKCFYRMGKAFLALGKFKEAHDAVSFGLKIDEENVPLK 194

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 4/88 (4%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAIS-KYPCDPI---YYSNRSVAYLKV 184
           +  +  ++A  FK++GN L   + YK A   Y+  I  K   D I    Y NR+   L++
Sbjct: 71  YEGEPHEVAANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELEL 130

Query: 185 NDYESAINDANFCISIDANFSKAYIRLA 212
            ++ S IND    ++ +A   KA+ R+ 
Sbjct: 131 RNFRSCINDCKKALNFNAKCVKAFYRMG 158

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 44/87 (50%), Gaps = 6/87 (6%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIY-----YSNRSVAYLK 183
           +  +  +IA  FK +GN L  ++ +K A E Y   ++   C+  +     ++N++   L+
Sbjct: 75  YEGEPHEIAGGFKKQGNELYKAKRFKDARELYIKGLN-VECEDKFINESLFANKAACELE 133

Query: 184 VNDYESAINDANFCISIDANFSKAYIR 210
           + +Y   I D +  +SI+   +K Y R
Sbjct: 134 LKNYRRCIEDCSKALSINPKNTKCYYR 160

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 35.4 bits (80), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%)

Query: 138 DTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           + FK +GN      ++  A+  Y  AI+  P +P+ YSN ++A +K+N+Y  A
Sbjct: 5   EEFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADA 57

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 37.4 bits (85), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 31/54 (57%)

Query: 176 NRSVAYLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYK 229
           NR+  + K+N  + A+ DA + I++DA   K YIR   +  +  +Y +AL  Y+
Sbjct: 75  NRAATFEKLNKLDRALADAAYMITVDAYNLKGYIRRGKVLQKLGRYEEALQVYE 128

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 37.0 bits (84), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 78/190 (41%), Gaps = 43/190 (22%)

Query: 32  NIDSL-NVAIDCIQQCYNLNEAYXXXXXXXXXXXXDLTSILNNFAKNNYKNITSTKETTP 90
           N+D+L N+AI  I + Y+ N                   ILN + KN Y N    + TT 
Sbjct: 351 NLDALENLAISYINEGYDTN----------------ALKILNRWVKNKYPNFEHYEATT- 393

Query: 91  LTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKNNFSDKDKQIADTFKDEGNRLMF- 149
                    E  K+ +S++ +D    +S N N      F+    ++A++  +   +L   
Sbjct: 394 ---------EESKRIESDLEDD----LSHNFNAVMIKKFN----RLAESLPEHDAKLELI 436

Query: 150 -------SEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDA 202
                   +D+ K IEC+  ++   P D + ++    +    N  E AI   +  +++  
Sbjct: 437 RGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLKP 496

Query: 203 NFSKAYIRLA 212
           +F +A   LA
Sbjct: 497 SFVRARYNLA 506

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 34.7 bits (78), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%)

Query: 138 DTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAI 191
           + +K  GN      +Y KA+E Y   I   P +PI YSN +++ +K+  Y  A+
Sbjct: 4   EEYKTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEAL 57

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 41/90 (45%), Gaps = 6/90 (6%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCD-----PIYYSNRSVAYLK 183
           +  +  +IA+ FK++GN L  +  YK A E Y   +  + CD        + NR+   L+
Sbjct: 72  YEGEPHEIAENFKNQGNDLYRARRYKDARELYNKGVEVH-CDDDAINESLFLNRAACELE 130

Query: 184 VNDYESAINDANFCISIDANFSKAYIRLAN 213
           + ++   IND    +  +    K + R+  
Sbjct: 131 LKNHRRCINDCKEALRYNPKNVKCFYRMGR 160

>KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.470
           YDR244W
          Length = 562

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 42/90 (46%)

Query: 151 EDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIR 210
           +D+ K IEC+  A+++ P D + ++    A    N  E +I      I +  +F +A   
Sbjct: 420 DDFDKTIECFKAALNENPTDELMWNRLGAALANSNRSEDSIKAYYKAIQLKPSFVRARYN 479

Query: 211 LANIKVQQHQYIDALDYYKKFIELNKDSVP 240
           LA   +  H Y +A ++    + +++   P
Sbjct: 480 LAVACMNIHCYKEAAEHLLTALSMHEVGTP 509

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 52/121 (42%), Gaps = 27/121 (22%)

Query: 140 FKDEGNRLMFSEDYKKAIECYT---NAISKY-PCDPIYYSNRSVAYLKVNDYESAINDAN 195
           FK  G+ L  + DY  A++ Y    N + +Y P   I YSN     LK+ +Y  +I D  
Sbjct: 417 FKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIEDCK 476

Query: 196 FCISI-------------------DANFSKAYIRLANIKVQQHQYID----ALDYYKKFI 232
             +S+                     +F   + +L   + + +++++    ALD Y+K I
Sbjct: 477 IALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQKLI 536

Query: 233 E 233
           E
Sbjct: 537 E 537

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 56/132 (42%), Gaps = 19/132 (14%)

Query: 151 EDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIR 210
           EDY K I+C+  A++  P D + ++    +    N  E AI   +  + +  +F +A   
Sbjct: 436 EDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYN 495

Query: 211 LANIKVQQHQYIDALDYYKKFIELNK-DSVP-------------EKITREF-----EDLK 251
           LA   +    Y +A +Y    + +++ + VP             E + R F      DL 
Sbjct: 496 LAVSSMNIGCYKEAAEYLLTALSMHEVEGVPVASGGSIPSTNILETLKRAFIAMERRDLL 555

Query: 252 LKVQTDISLREI 263
            KVQ  + L++ 
Sbjct: 556 EKVQPGMDLQQF 567

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 35.0 bits (79), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 51/117 (43%), Gaps = 7/117 (5%)

Query: 126 KNNFSDKDKQIADTFKDE-------GNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRS 178
           K N +D    + D F+D+       GN     +D+ +AI  +  A    P     Y+ + 
Sbjct: 572 KTNLTDLSNILMDEFRDKPETWCAVGNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQG 631

Query: 179 VAYLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELN 235
             YL ++ Y++A       IS D +   AY  +    ++  +Y  AL Y++K   +N
Sbjct: 632 HEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSIN 688

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 60/138 (43%), Gaps = 7/138 (5%)

Query: 113 NNEKISINLNDTSKNNFSDK---DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPC 169
            +E +S++  DT+K  +      D    + +   G   M   +Y++A+  +  A S  P 
Sbjct: 631 GHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPS 690

Query: 170 DPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYK 229
           + I      V   K+ + E A+N       I    S A  + A++     +Y  ALD ++
Sbjct: 691 NAILICCCGVTMEKLGNQEKALNYYELACQIQPTSSLAKFKRAHLLYSMAKYTQALDAFE 750

Query: 230 KFIELNKDSVPEKITREF 247
           + I++     PE+ T +F
Sbjct: 751 ELIKI----APEEATVQF 764

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 33.1 bits (74), Expect = 0.32,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 27/53 (50%)

Query: 138 DTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESA 190
           +  K +GN     +DY  A+  Y   +     +PI +SNR++  +K+N  + A
Sbjct: 5   ERLKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEA 57

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 49/107 (45%), Gaps = 6/107 (5%)

Query: 111 NDNNEKISINLNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCD 170
           +D N   ++ L+      +  +  +IA+ FK +GN     + Y+ A   Y   I +  C+
Sbjct: 48  SDGNGGSNVTLDALKALAYEGEPHEIAENFKKQGNEAYKLKQYRNARVLYERGI-EVNCN 106

Query: 171 -----PIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIRLA 212
                 + + N++   L++ +Y S IND    +S +    K Y R+A
Sbjct: 107 NDKINELLFVNKAACELEMKNYRSCINDCKKALSFNPLNVKCYFRMA 153

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 43/85 (50%), Gaps = 4/85 (4%)

Query: 120 NLNDTSKNNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISK----YPCDPIYYS 175
           N+  T   N ++ ++   + FK++G     + DY  A + Y  +++     +P   + +S
Sbjct: 308 NVPATYSPNLTELERHSFEEFKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFS 367

Query: 176 NRSVAYLKVNDYESAINDANFCISI 200
           N  +  LKV +Y  A++DA+  + +
Sbjct: 368 NIIICRLKVGEYREALSDASSALKL 392

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 33.1 bits (74), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 140 FKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAI 191
            K EGN      DY +A   Y   I   P +PI YSN++++ +K  ++  A+
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAV 57

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 12/97 (12%)

Query: 174 YSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIE 233
           Y N S  Y K+ + + A   ++  I I+    K YIR+  +  +Q +  +A   YKK + 
Sbjct: 74  YDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKCYKKGLL 133

Query: 234 LNKDS-------VPEKITREFEDLKLKVQTDISLREI 263
           ++++        VPEK    F D+ +K Q DI  + I
Sbjct: 134 MSREMLQKFDIVVPEK----FRDI-IKQQRDIVKKRI 165

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 44/94 (46%), Gaps = 6/94 (6%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYS-----NRSVAYLK 183
           +  +  ++A+ FK++GN L   + ++ A   Y   I +  CD    S     NR+   L+
Sbjct: 69  YDGEPHEVAENFKNQGNDLYKVKRFRDARVMYNKGI-EVKCDDAGISELLLLNRAACELE 127

Query: 184 VNDYESAINDANFCISIDANFSKAYIRLANIKVQ 217
           + +Y   IND    + ++    KA+ R+    +Q
Sbjct: 128 LKNYRRCINDCREALKLNPKNPKAFFRIGKAFLQ 161

>Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032W
           (REAL)
          Length = 370

 Score = 33.9 bits (76), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 22/125 (17%)

Query: 135 QIADTFKDEGNRLMFSEDYKKAIECYT---NAISKYPCDP---------------IYYSN 176
           + A T K+ G  L   +DY+ A   Y    N I++Y  +P                 Y N
Sbjct: 238 KAASTIKESGTLLFKKKDYENAFFKYRKSLNYINEYMPEPDLDKEKNEQFTDLKMKVYLN 297

Query: 177 RSVAYLKVNDYESAINDANFCISID----ANFSKAYIRLANIKVQQHQYIDALDYYKKFI 232
            S+A   +  Y+SAI  A + + +D     + +KAY R  N  +++ +  +AL  Y+   
Sbjct: 298 LSLALFNLERYDSAITYATYLLEMDNVPNKDRAKAYYRRGNSYLRKKRLDEALRDYRLCK 357

Query: 233 ELNKD 237
           E+N D
Sbjct: 358 EMNPD 362

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 31/62 (50%)

Query: 151 EDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIR 210
           +D+ K +EC+ NA+   P D + ++    +    N  E AI   +  I++  +F +A   
Sbjct: 455 DDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRARYN 514

Query: 211 LA 212
           LA
Sbjct: 515 LA 516

>AEL062C Chr5 complement(519416..520567) [1152 bp, 383 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR032W
           (CPR7)
          Length = 383

 Score = 33.5 bits (75), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 12/90 (13%)

Query: 174 YSNRSVAYLKVNDYESAINDANFCISID----ANFSKAYIRLANIKVQQHQYIDALDYYK 229
           Y N ++A   +  Y+SAI+  N+ + +D     + +KAY R  N  + ++   +AL  YK
Sbjct: 286 YLNMTLALFNMGSYDSAISYTNYVLEMDRVPSMDLAKAYYRRGNCYLAKNLLEEALSNYK 345

Query: 230 KFIELNKD--------SVPEKITREFEDLK 251
           +  E N D        SV  K+    E  K
Sbjct: 346 RCKEHNSDEAVDMKIASVESKLAARLEKTK 375

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 38/72 (52%)

Query: 167 YPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALD 226
           +P   I   NR+ ++ ++N+   A+ DA+  I +DA   K YIR   I  +  Q  +AL 
Sbjct: 66  HPRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDKEALY 125

Query: 227 YYKKFIELNKDS 238
            Y++ +   K++
Sbjct: 126 VYREGLSKAKEA 137

>ZYRO0F00374g Chr6 complement(37241..39097) [1857 bp, 618 aa] {ON}
           similar to gnl|GLV|CAGL0A01155g Candida glabrata
           CAGL0A01155g and weakly similar to YPL269W
           uniprot|P32526 Saccharomyces cerevisiae YPL269W KAR9
           Karyogamy protein required for correct positioning of
           the mitotic spindle and for orienting cytoplasmic
           microtubules localizes at the shmoo tip in mating cells
           and at the tip of the growing bud in small-budded cells
           through anaphase
          Length = 618

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 18  FLENVISKKEISQDNIDSLNVAIDC-IQQCYNLNE 51
            LE  +   EIS+DNID+L + ID  I QC+ + E
Sbjct: 143 LLEASLEFDEISKDNIDTLGIVIDTNINQCFEVQE 177

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 34/68 (50%), Gaps = 2/68 (2%)

Query: 147 LMF--SEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANF 204
           L+F  + DY K I+C+  A++  P D + ++    +    N  E A+   +  +++  +F
Sbjct: 501 LLFYTTADYDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLKPSF 560

Query: 205 SKAYIRLA 212
            +A   LA
Sbjct: 561 VRARYNLA 568

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 4/65 (6%)

Query: 140 FKDEGNRLMFSEDYKKAIECYTNAI----SKYPCDPIYYSNRSVAYLKVNDYESAINDAN 195
           F+  G       DY  A+  Y  ++     K+P   I YSN   A LKV +Y  ++ D +
Sbjct: 549 FRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCD 608

Query: 196 FCISI 200
             + +
Sbjct: 609 VALEL 613

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 43/118 (36%), Gaps = 25/118 (21%)

Query: 140 FKDEGNRLMFSEDYKKAIECYTNAI----SKYPCDPIYYSNRSVAYLKVNDYESAINDAN 195
           F+ +G  L    DY  A+  Y  ++     K+P   I  SN  + YLK+ +Y   +  A 
Sbjct: 293 FRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMMLPYLKIGEYTKCLKLAP 352

Query: 196 FCISIDAN---------------------FSKAYIRLANIKVQQHQYIDALDYYKKFI 232
             + +                        +SK  +RLA  +     Y  A D Y+  +
Sbjct: 353 LALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEHAENYTGAFDNYQLLV 410

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 52/118 (44%), Gaps = 9/118 (7%)

Query: 129 FSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAIS-----KYPCDPIYYSNRSVAYLK 183
           +  +  +IA+ FK++GN L  ++ +K A + Y   I              ++N++   L+
Sbjct: 68  YEGEPHEIAENFKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELE 127

Query: 184 VNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPE 241
           + ++   IND    + ++    K Y R+     +    +D L+  K+ +E      PE
Sbjct: 128 LKNFRRCINDCKNALQLNPKNVKCYFRM----TRAFFALDKLEEAKESVEFGLKFDPE 181

>NCAS0C00530 Chr3 (85814..85843,85918..86766) [879 bp, 292 aa] {ON}
           Anc_7.493 YBL050W
          Length = 292

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 40/93 (43%), Gaps = 31/93 (33%)

Query: 152 DYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIRL 211
           DY KAIE Y  A   Y  D      +SVA             AN C          YI+ 
Sbjct: 133 DYVKAIEAYETAGEWYSQD------QSVAL------------ANKC----------YIKS 164

Query: 212 ANIKVQQHQYIDALDYYKKFIELNKDSVPEKIT 244
           A++K    QYI+A D Y K I   K+S+  +++
Sbjct: 165 ADLKALNGQYIEASDLYSKLI---KNSIGNRLS 194

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 28/62 (45%)

Query: 151 EDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIR 210
           ED+ K I+C+  A++  P D   ++    +    N  E AI   +  I +   F +A   
Sbjct: 431 EDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVRARYN 490

Query: 211 LA 212
           LA
Sbjct: 491 LA 492

>Kpol_534.15 s534 (35957..37135) [1179 bp, 392 aa] {ON}
           (35957..37135) [1179 nt, 393 aa]
          Length = 392

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%)

Query: 211 LANIKVQQHQYIDALDYYKKFIELNKDSV 239
           + ++ ++QH  ++A  YYKKF+EL  D+V
Sbjct: 163 IGDLSLRQHNDVEAEKYYKKFLELEDDTV 191

>TPHA0B03970 Chr2 (938053..939243) [1191 bp, 396 aa] {ON} Anc_1.456
           YJR032W
          Length = 396

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 46/91 (50%), Gaps = 10/91 (10%)

Query: 174 YSNRSVAYLKVNDYESAINDANFCISID----ANFSKAYIRLANIKVQQHQYIDALDYYK 229
           Y N S+ Y  +  Y+  +  AN+ + +D     + +KAY R  N  + + +Y DAL  YK
Sbjct: 295 YLNMSLNYYNLKMYDECMTYANYLLDLDNIPDIDQAKAYYRRGNSYLMKKRYEDALASYK 354

Query: 230 KFIELNKDSVPEK--ITREFEDLKLKVQTDI 258
               L K+  PE   I ++ E +K  ++ +I
Sbjct: 355 ----LCKEKNPEDKVIDQKIESVKSLIEANI 381

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 4/56 (7%)

Query: 140 FKDEGNRLMFSEDYKKAIECYT---NAISK-YPCDPIYYSNRSVAYLKVNDYESAI 191
           FKD G       DY  A E Y    N++SK +P   I  SN   + LK  DY S I
Sbjct: 400 FKDRGTEYFKKGDYVSATEQYEKSLNSLSKLHPLRIIASSNLLASLLKTGDYTSMI 455

>Suva_2.68 Chr2 (123103..123918) [816 bp, 271 aa] {ON} YBL050W
           (REAL)
          Length = 271

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 42/95 (44%), Gaps = 31/95 (32%)

Query: 151 EDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIR 210
            DY KAI+CY  A   Y  D      +SVA             +N C          +I+
Sbjct: 111 HDYPKAIDCYELAGEWYGQD------QSVAL------------SNKC----------FIK 142

Query: 211 LANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245
            A++K    QYI+A D Y K I   K+SV  ++++
Sbjct: 143 CADLKALDGQYIEASDIYSKLI---KNSVGNRLSQ 174

>ZYRO0F16544g Chr6 (1360946..1364032) [3087 bp, 1028 aa] {ON}
           similar to uniprot|P33339 Saccharomyces cerevisiae
           YGR047C
          Length = 1028

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 40/78 (51%), Gaps = 7/78 (8%)

Query: 128 NFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTN--AISKYPCDPIYYSNRSVAYLKVN 185
           NFSD    IAD + +    L   E +K+AI+ +T   AI +Y C    Y   +  Y +V 
Sbjct: 460 NFSD----IADLYFEVAIALSKGEKHKEAIDFFTPLLAIEEY-CTLDLYRPLARCYKEVE 514

Query: 186 DYESAINDANFCISIDAN 203
           DYESA +     +S+D N
Sbjct: 515 DYESAKSFYEKVVSLDPN 532

>ZYRO0G18106g Chr7 complement(1487959..1488807,1488878..1488907)
           [879 bp, 292 aa] {ON} highly similar to uniprot|P32602
           Saccharomyces cerevisiae YBL050W SEC17
          Length = 292

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 32/81 (39%), Gaps = 28/81 (34%)

Query: 152 DYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIRL 211
           DY KAIECY  A   Y  D                   A+  AN C+          +R 
Sbjct: 133 DYPKAIECYETAGEWYSQDQ------------------ALALANKCL----------VRC 164

Query: 212 ANIKVQQHQYIDALDYYKKFI 232
           A++K    QY++A + Y + I
Sbjct: 165 ADLKALNSQYLEASEVYAQLI 185

>YNL313C Chr14 complement(45308..48022) [2715 bp, 904 aa] {ON}
           EMW1Essential conserved protein with a role in
           maintaining cell wall integrity; contains six TPR
           (tetratricopeptide repeat) domains clustered in the
           C-terminal region; conditional mutant is suppressed by
           overexpression of GFA1
          Length = 904

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 3/88 (3%)

Query: 156 AIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDA--NFSKAYIRLAN 213
           A E +T  +S  P   + +SN S AY K++  + A +     IS DA  N+ K +     
Sbjct: 656 AAEAFTRCVSLDPYHALSWSNLSAAYTKMDKLKEAYSCLKRAISCDAQKNW-KIWENYML 714

Query: 214 IKVQQHQYIDALDYYKKFIELNKDSVPE 241
           + V+ +++ D L   K+ + + +D   E
Sbjct: 715 VAVKLNEWEDVLTACKQLVSIRRDKSGE 742

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 34/77 (44%)

Query: 151 EDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIR 210
           +DY K ++C+  A++  P D + ++    +    N  E AI      + +   F +A   
Sbjct: 440 DDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRARCN 499

Query: 211 LANIKVQQHQYIDALDY 227
           LA   +    Y +A +Y
Sbjct: 500 LAVSCMNMGCYKEAAEY 516

>Kpol_463.11 s463 complement(29915..32269) [2355 bp, 784 aa] {ON}
           complement(29915..32269) [2355 nt, 785 aa]
          Length = 784

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 51/104 (49%), Gaps = 16/104 (15%)

Query: 96  SSLNESVKKNQSNISNDNNEKISINLNDTSKNNFSDKDKQIADTFKD----EGNRLMFSE 151
           SSLNE +K++ +N+S  N            K N SD + Q+ ++  D    + N L+  +
Sbjct: 326 SSLNEVLKESLANLSFSN------------KKNSSDSNFQLINSIIDLLNLQSNFLLGKQ 373

Query: 152 DYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDAN 195
           DY+ A+     A S  P     + N +++Y  +ND++ ++   N
Sbjct: 374 DYELALNVSKLATSLSPDSFESWYNLAISYAFLNDFKRSLFSIN 417

>TDEL0A00510 Chr1 complement(86493..89204) [2712 bp, 903 aa] {ON}
           Anc_3.32 YNL313C
          Length = 903

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/84 (20%), Positives = 40/84 (47%)

Query: 149 FSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAY 208
            + DY  A+    +++ +YP     +       L+   +E A    + C+++D+  + A+
Sbjct: 613 LTRDYAAALTHLNDSLRQYPLSFETWYFYGCVGLECGKFELAAEAFSRCVALDSTHAMAW 672

Query: 209 IRLANIKVQQHQYIDALDYYKKFI 232
             L+   V+Q++  +AL   K+ +
Sbjct: 673 SNLSAAFVEQNKLKEALSCLKRAV 696

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 3/78 (3%)

Query: 176 NRSVAYLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIE-- 233
           NR+  + K+ + E A+ DA     I+    K +IR   I  + H+  DA + YK  +   
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDAYNTYKTALRNA 158

Query: 234 -LNKDSVPEKITREFEDL 250
               DS+   +++ F D+
Sbjct: 159 NFATDSLKINVSKTFIDI 176

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 55/132 (41%), Gaps = 16/132 (12%)

Query: 144 GNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDAN 203
           GN     +D+K+AI+ +       P     Y+ ++  YL  + ++ A N     +S D+ 
Sbjct: 572 GNLFSLQKDHKEAIKAFEKVTKLDPTFTYGYTLQAHEYLSDDSFDLAKNYFRKAVSTDSQ 631

Query: 204 FSKAYIRLANIKVQQHQYIDALDYYKKFIELN---------------KDSVPEKITREFE 248
              AY  +    ++  ++  AL Y++K   +N               K S PEK    +E
Sbjct: 632 HYNAYYGIGMCSMKLGEFEHALLYFEKARSINPSNVILICCCGVAFEKLSYPEKALSYYE 691

Query: 249 DLKLKVQTDISL 260
            L  +VQ   SL
Sbjct: 692 -LACQVQPSSSL 702

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 30/62 (48%)

Query: 151 EDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIR 210
           +D+ K I+C+ +A+   P D + ++    +    N  E AI   +  + +  +F +A   
Sbjct: 471 DDFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYN 530

Query: 211 LA 212
           LA
Sbjct: 531 LA 532

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 60/139 (43%), Gaps = 7/139 (5%)

Query: 112 DNNEKISINLNDTSKNNFSDK---DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYP 168
           + +E+ SI+  DT+KN +      D    + +   G   M    Y +A+  +  A    P
Sbjct: 658 EGHEQASIDAFDTAKNCYRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEKAKMINP 717

Query: 169 CDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYY 228
            + I       A  K+N  E A+N      ++  N S A  +LA +     +Y  AL+  
Sbjct: 718 SNAILLCCCGSALEKLNFNEKALNYYELACNLQPNSSFAKFKLAKLLYSMSRYNLALEIL 777

Query: 229 KKFIELNKDSVPEKITREF 247
           ++ IE+     PE++T  F
Sbjct: 778 EQVIEM----APEEVTPHF 792

>CAGL0F04653g Chr6 complement(470517..471395) [879 bp, 292 aa] {ON}
           highly similar to uniprot|P32602 Saccharomyces
           cerevisiae YBL050w SEC17 transport vesicle fusion
           protein
          Length = 292

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 3/40 (7%)

Query: 206 KAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245
           K Y+R A++K    QYI+A D Y K I   K+S+  ++++
Sbjct: 159 KCYVRCADLKALDGQYIEASDLYTKLI---KNSLGNRLSQ 195

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 51/121 (42%), Gaps = 25/121 (20%)

Query: 140 FKDEGNRLMFSEDYKKAIECYTNAISKYPCDP----IYYSNRSVAYLKVNDYESAINDAN 195
           +KD G     + DY  A + Y  +++  P +     + YSN + A  KV +Y+  ++D  
Sbjct: 276 YKDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIE 335

Query: 196 FCISI---DAN--------------FSKAYIRLANIKVQQHQYID----ALDYYKKFIEL 234
             + +   D N              F + + ++   + +  ++I+    AL  Y+  IE 
Sbjct: 336 SALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEK 395

Query: 235 N 235
           N
Sbjct: 396 N 396

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 30/62 (48%)

Query: 151 EDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIR 210
           +D+ K I+C+ +A+   P D + ++    +    N  E AI   +  + +  +F +A   
Sbjct: 471 DDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYN 530

Query: 211 LA 212
           LA
Sbjct: 531 LA 532

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 30/62 (48%)

Query: 151 EDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIR 210
           +D+ K I+C+ +A+   P D + ++    +    N  E AI   +  + +  +F +A   
Sbjct: 471 DDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYN 530

Query: 211 LA 212
           LA
Sbjct: 531 LA 532

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 30/62 (48%)

Query: 151 EDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIR 210
           +D+ K I+C+ +A+   P D + ++    +    N  E AI   +  + +  +F +A   
Sbjct: 472 DDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYN 531

Query: 211 LA 212
           LA
Sbjct: 532 LA 533

>TDEL0C03560 Chr3 complement(622010..622858,622921..622950) [879 bp,
           292 aa] {ON} Anc_7.493 YBL050W
          Length = 292

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 39/94 (41%), Gaps = 31/94 (32%)

Query: 152 DYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIRL 211
           DY KAI+ Y  A   Y  D                   A+  AN C+          +R 
Sbjct: 133 DYGKAIDAYETAGEWYSQDQ------------------ALALANKCL----------VRC 164

Query: 212 ANIKVQQHQYIDALDYYKKFIELNKDSVPEKITR 245
           A++K    QY++A D Y K I   K+S+  ++++
Sbjct: 165 ADLKALNGQYLEACDVYAKLI---KNSIGNRLSQ 195

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 30/65 (46%), Gaps = 4/65 (6%)

Query: 140 FKDEGNRLMFSEDYKKAIECYTNAI----SKYPCDPIYYSNRSVAYLKVNDYESAINDAN 195
           FKD    L  + DY  A++ Y  +       +P   I YSN   + LK   Y+ +++ A+
Sbjct: 348 FKDRAGELFKTGDYVAALQEYEKSANTLPHGHPLRIISYSNLMASQLKTGQYKESLHVAS 407

Query: 196 FCISI 200
             + +
Sbjct: 408 MALKL 412

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 29/62 (46%)

Query: 151 EDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCISIDANFSKAYIR 210
           +D+ K I+C+  A+   P D + ++    A    N  E +I   +  + +  +F +A   
Sbjct: 460 DDFNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLKPSFVRARYN 519

Query: 211 LA 212
           LA
Sbjct: 520 LA 521

>NCAS0C02770 Chr3 complement(522391..524694) [2304 bp, 767 aa] {ON}
           Anc_8.415 YDR206W
          Length = 767

 Score = 30.4 bits (67), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 11/69 (15%)

Query: 151 EDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDA-----------NFCIS 199
           +D+KK+      AI+  P   + Y+N+++  L+ ND+ S I +A           N+C  
Sbjct: 208 DDFKKSERYIDLAITLLPSMGVSYANKAMVSLRYNDFTSTIFEAIRGSLIRLPDLNYCTK 267

Query: 200 IDANFSKAY 208
           I A+   +Y
Sbjct: 268 IYADLILSY 276

>NDAI0G01500 Chr7 (331856..334879) [3024 bp, 1007 aa] {ON} Anc_3.19
           YNL321W
          Length = 1007

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 78  NYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSKNNFSDKDKQIA 137
           NY ++T+   TT +T  PS+  +  KKN S +S  N+ KI  N N    + F++K   I 
Sbjct: 88  NYNHLTAHSPTT-ITTRPSNFLK--KKNSSRLSTLNSPKIRSN-NTVGADYFTNKHNHIH 143

Query: 138 D 138
           D
Sbjct: 144 D 144

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 6/62 (9%)

Query: 133 DKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYS---NRSVAYLKVNDYES 189
           D + A  +  +G+    S+ +  A  CY  AI+   CDP +Y+      +  +K+  YE 
Sbjct: 558 DPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIA---CDPGHYNAYYGLGMVSMKLGQYEE 614

Query: 190 AI 191
           A+
Sbjct: 615 AL 616

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,041,379
Number of extensions: 1762680
Number of successful extensions: 17110
Number of sequences better than 10.0: 713
Number of HSP's gapped: 16284
Number of HSP's successfully gapped: 840
Length of query: 373
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 262
Effective length of database: 40,753,473
Effective search space: 10677409926
Effective search space used: 10677409926
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)