Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A072606.20ON1204120458290.0
TDEL0G044906.20ON1093121010781e-127
Sklu_YGOB_Anc_6.20b6.20ON1088120710511e-123
Suva_13.1606.20ON1090122110411e-122
Smik_13.1576.20ON1090122610151e-118
Skud_13.1526.20ON109012149881e-114
ZYRO0C07810g6.20ON109911809871e-114
Sklu_YGOB_Anc_6.20singletonOFF8498738731e-100
YML002W6.20ON7377917553e-85
NCAS0H008206.20ON114611947693e-84
TPHA0J003306.20ON11077647665e-84
Kpol_1037.256.20ON11057927232e-78
NDAI0D008006.20ON119312437253e-78
Ecym_30246.20ON10797957186e-78
KLLA0D01133g6.20ON10677637062e-76
ACR006C6.20ON10717947053e-76
KLTH0C11242g6.20ON10977516912e-74
Kwal_56.224246.20ON10897526806e-73
KNAG0M011606.20ON11317776782e-72
CAGL0L07634g6.20ON11307926283e-66
KAFR0L004006.20ON9424204204e-41
YML003WsingletonOFF2903421846e-14
CAGL0C01309g2.257ON111055781.8
KNAG0A015605.96ON1159144782.0
TPHA0J017706.112ON64628745.6
KLLA0E02201g5.435ON83557737.1
SAKL0D13002g1.523ON38663727.5
NCAS0A095201.266ON59171729.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07260
         (1204 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...  2249   0.0  
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   419   e-127
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   409   e-123
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...   405   e-122
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...   395   e-118
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...   385   e-114
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   384   e-114
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   340   e-100
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...   295   3e-85
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   300   3e-84
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   299   5e-84
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   283   2e-78
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   283   3e-78
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   281   6e-78
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   276   2e-76
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   276   3e-76
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   270   2e-74
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   266   6e-73
KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...   265   2e-72
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   246   3e-66
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   166   4e-41
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...    75   6e-14
CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} simil...    35   1.8  
KNAG0A01560 Chr1 (74485..77964) [3480 bp, 1159 aa] {ON} Anc_5.96...    35   2.0  
TPHA0J01770 Chr10 complement(407330..409270) [1941 bp, 646 aa] {...    33   5.6  
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...    33   7.1  
SAKL0D13002g Chr4 complement(1088057..1089217) [1161 bp, 386 aa]...    32   7.5  
NCAS0A09520 Chr1 complement(1895860..1897635) [1776 bp, 591 aa] ...    32   9.1  

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_6.20
            YML002W
          Length = 1204

 Score = 2249 bits (5829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1126/1204 (93%), Positives = 1126/1204 (93%)

Query: 1    MDADILNPLIEVLFHSEGTDTLNGPXXXXXXXXXXXXXXXXAPPTDILLNYLDSSNITPR 60
            MDADILNPLIEVLFHSEGTDTLNGP                APPTDILLNYLDSSNITPR
Sbjct: 1    MDADILNPLIEVLFHSEGTDTLNGPLKKLFEKLKLLKFVLLAPPTDILLNYLDSSNITPR 60

Query: 61   NPYNGSNAKPLEDLCMNSYDFIASHILLYDSKVIKNDQCVMESINGKTITIKRVTGNGAL 120
            NPYNGSNAKPLEDLCMNSYDFIASHILLYDSKVIKNDQCVMESINGKTITIKRVTGNGAL
Sbjct: 61   NPYNGSNAKPLEDLCMNSYDFIASHILLYDSKVIKNDQCVMESINGKTITIKRVTGNGAL 120

Query: 121  NNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEF 180
            NNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEF
Sbjct: 121  NNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEF 180

Query: 181  LTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKDD 240
            LTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKDD
Sbjct: 181  LTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKDD 240

Query: 241  RVIWQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRYNFL 300
            RVIWQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRYNFL
Sbjct: 241  RVIWQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRYNFL 300

Query: 301  SHDNLMELIYEFIEIKLHDDIWGRISFKFTESDFDFSKLSNISVNKLLLNFYSTNNFKNF 360
            SHDNLMELIYEFIEIKLHDDIWGRISFKFTESDFDFSKLSNISVNKLLLNFYSTNNFKNF
Sbjct: 301  SHDNLMELIYEFIEIKLHDDIWGRISFKFTESDFDFSKLSNISVNKLLLNFYSTNNFKNF 360

Query: 361  KLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILTINKLTDADTLIGLLSIV 420
            KLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILTINKLTDADTLIGLLSIV
Sbjct: 361  KLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILTINKLTDADTLIGLLSIV 420

Query: 421  ICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHISHSHKADLIAFC 480
            ICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHISHSHKADLIAFC
Sbjct: 421  ICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHISHSHKADLIAFC 480

Query: 481  DKLHNLYDTILNNIKSLDNDILSYRSQNGESLLSLCIINNKMDIFLELLTTYEHSFPIEX 540
            DKLHNLYDTILNNIKSLDNDILSYRSQNGESLLSLCIINNKMDIFLELLTTYEHSFPIE 
Sbjct: 481  DKLHNLYDTILNNIKSLDNDILSYRSQNGESLLSLCIINNKMDIFLELLTTYEHSFPIED 540

Query: 541  XXXXXXXXXXXXXMQACKYNNYVASEILVTILKNSCNEEELRIFLNKTDKFNRSVAHYFN 600
                         MQACKYNNYVASEILVTILKNSCNEEELRIFLNKTDKFNRSVAHYFN
Sbjct: 541  ILDDSDLNGSSLLMQACKYNNYVASEILVTILKNSCNEEELRIFLNKTDKFNRSVAHYFN 600

Query: 601  MKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVHKVNYNESFIKILFRVVLTWYKIHNK 660
            MKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVHKVNYNESFIKILFRVVLTWYKIHNK
Sbjct: 601  MKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVHKVNYNESFIKILFRVVLTWYKIHNK 660

Query: 661  PFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETININANNNKGLSPFMVYFKTNRYDN 720
            PFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETININANNNKGLSPFMVYFKTNRYDN
Sbjct: 661  PFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETININANNNKGLSPFMVYFKTNRYDN 720

Query: 721  IRIILKNPTLITSEGQLPFLITSTNLYNSKVNHLLATHFLRTLDFAYICLHSLRFNDPSS 780
            IRIILKNPTLITSEGQLPFLITSTNLYNSKVNHLLATHFLRTLDFAYICLHSLRFNDPSS
Sbjct: 721  IRIILKNPTLITSEGQLPFLITSTNLYNSKVNHLLATHFLRTLDFAYICLHSLRFNDPSS 780

Query: 781  STSGTSLAWLVDISILEKESEFPTSHPSICRXXXXXXXXXXXXXHHFIRKYKYSSLPLKS 840
            STSGTSLAWLVDISILEKESEFPTSHPSICR             HHFIRKYKYSSLPLKS
Sbjct: 781  STSGTSLAWLVDISILEKESEFPTSHPSICRTKTLKLKTIKSLLHHFIRKYKYSSLPLKS 840

Query: 841  ALEFCNDLIKSNNSISWTSNRHFLPLSLLIDKLEIQYNLKLISNCLNXXXXXXXXXXXXX 900
            ALEFCNDLIKSNNSISWTSNRHFLPLSLLIDKLEIQYNLKLISNCLN             
Sbjct: 841  ALEFCNDLIKSNNSISWTSNRHFLPLSLLIDKLEIQYNLKLISNCLNFLFITTDFDFTLL 900

Query: 901  XXELKLQAFLKIXXXXXXXXXXXXXXXXXXXXDQTTELSKAYQPEDINAIQTFIKFNLGE 960
              ELKLQAFLKI                    DQTTELSKAYQPEDINAIQTFIKFNLGE
Sbjct: 901  FDELKLQAFLKINNKKLKESNSSNKFSHKNNSDQTTELSKAYQPEDINAIQTFIKFNLGE 960

Query: 961  LENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKIGINNLSEILKYYSTQKPLITN 1020
            LENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKIGINNLSEILKYYSTQKPLITN
Sbjct: 961  LENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKIGINNLSEILKYYSTQKPLITN 1020

Query: 1021 AYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLL 1080
            AYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLL
Sbjct: 1021 AYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLL 1080

Query: 1081 DYEAQYNKHYPNRKIDINNNFESFNTMFDKRVNFDSITHFERNIILNIKNTSTLLRRFNN 1140
            DYEAQYNKHYPNRKIDINNNFESFNTMFDKRVNFDSITHFERNIILNIKNTSTLLRRFNN
Sbjct: 1081 DYEAQYNKHYPNRKIDINNNFESFNTMFDKRVNFDSITHFERNIILNIKNTSTLLRRFNN 1140

Query: 1141 KIKFLHENLAIELNNFMNFKNKFIREYIIKFSTIEVIKILKDNIIYMDSIIARFQIATDY 1200
            KIKFLHENLAIELNNFMNFKNKFIREYIIKFSTIEVIKILKDNIIYMDSIIARFQIATDY
Sbjct: 1141 KIKFLHENLAIELNNFMNFKNKFIREYIIKFSTIEVIKILKDNIIYMDSIIARFQIATDY 1200

Query: 1201 MKKN 1204
            MKKN
Sbjct: 1201 MKKN 1204

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  419 bits (1078), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 349/1210 (28%), Positives = 559/1210 (46%), Gaps = 165/1210 (13%)

Query: 5    ILNPLIEVLFHSEGTDTLNGPXXXXXXXXXXXXXXXXAPPTDILLNYLDSSNITPRNPYN 64
            +LNPL+  +F+     T N                   PP D LL+  D          +
Sbjct: 8    LLNPLVNAVFNCPNPSTSN--LKKLFSNLKDRKFILLVPPCDRLLDCNDK--------LS 57

Query: 65   GSNAKPLEDLCMNSYDFIASHILLYDSK------VIKNDQCVMESINGKTITIKRVTGNG 118
            GS   PL++LC  SY+F+ASH+LL D +           Q   +++NGK + ++      
Sbjct: 58   GS---PLQELCY-SYEFVASHVLLIDEQNAEYMTTAPPSQVKFDTLNGKKVIVR------ 107

Query: 119  ALNNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKN 178
                 +  +I  S  +   KK   I K DL+ NFN YL     +PI  ID P+    ++ 
Sbjct: 108  ----SQNRIILTSDGFQV-KKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPICAESVRT 162

Query: 179  EFLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIK 238
                          Q   I+Q +   +  TKD        S    D SQ  +  F  +++
Sbjct: 163  --------------QRVQISQTLGSGKRETKDG-------SSPTLDSSQGSKSSFDNILR 201

Query: 239  ---DDRVIWQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEK 295
               D  + +  L   YR+T       EG          D +IE+  DI    +  ++ + 
Sbjct: 202  IHPDWALKFNELFAEYRST------PEG---------DDPHIELFHDIIRRAYSAMRSDA 246

Query: 296  RYNFLSHDNLMELIYEFIEIKLHDDIWGRISFKFTESDFDFSKLSNISVNKLLLNFYSTN 355
               F S  +L +LIY+++E+ L+DDIW RI+  F +S+ + + L  +S+++L    Y  +
Sbjct: 247  L--FASMPDLSDLIYDYVELNLYDDIWVRITHHFKDSEVESNGLRYLSLHQLETGLYP-D 303

Query: 356  NFKNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILT-----INKLT-- 408
             F+ F L  +V ME  I  A+  F +        +K+  LI TL+ L+     I +++  
Sbjct: 304  KFEEFNLKSVVSMENNIELAMNSFSRLPLAHAHADKAMYLIDTLRNLSRVDKSIQEVSPV 363

Query: 409  --DADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFD 466
               ADTL+ L  +VICR ++RNLK  LFYLQNFA +  +I FG+LGY+ISTLEA   YFD
Sbjct: 364  AIGADTLLSLFVLVICRTQLRNLKGQLFYLQNFAKNETSITFGVLGYAISTLEAAVCYFD 423

Query: 467  HISHSHK-ADLIAFCDKLHNLYDTILNNIKSLD----NDILSYRSQNGESLLSLCIINNK 521
             +  S K + L + C+   +L D + +   S++       LSYR++ GESLLS+CI N K
Sbjct: 424  ELKGSKKMSRLESECENARSLVDKLSSESSSVNLIHYQKTLSYRTEQGESLLSICIANGK 483

Query: 522  MDIFLELLTTYEHSFPIEXXXXXXXXXXXXXXMQACKYNNYVASEILVTILKNSCNEEEL 581
             DI  ELL+  E SFP+E              MQ+ K  N  A+ ++V ++K+SC +EE+
Sbjct: 484  NDILQELLSD-ERSFPLEDILEDQTTEGCTLLMQSLKCGNGDAASLIVDLIKSSCTQEEM 542

Query: 582  RIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVH-KVNYN 640
              + N++DK  R+ AHY  + + I IL + GN  DW++KD    T L TIF+ + + NY+
Sbjct: 543  FAYFNRSDKDKRTAAHY--LTHEINILEQIGNFFDWDVKDSSGHTALFTIFRSYDQPNYD 600

Query: 641  ESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETININA 700
            +  I+  FR    WY    +PF    H D+  N LLH++K  I+ L+E     E++++NA
Sbjct: 601  D-MIRASFRCAAEWYACRMRPFCFTVHEDRKENTLLHILKRSISILLEY----ESVDVNA 655

Query: 701  NNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFLITSTNLY-NSKVNHLLATHF 759
             N KGL+P MVY K NR DN + IL +  +I  + Q P L+ S +   N  + H +A   
Sbjct: 656  RNRKGLTPLMVYAKYNRLDNTKSILTDKRVILGKIQHPLLLCSIDYAKNPLILHEIAKQS 715

Query: 760  LRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISI-LEKESEFPTSHPSICRXXXXXXX 818
                 F    +H+L++   S         WLV+I++  +++  F T    +         
Sbjct: 716  AMDTAFGKCFVHTLKYESSS---------WLVNITVQADRKGNFETVEFHL--------K 758

Query: 819  XXXXXXHHFIRKYKYSSLPLKSALEFCNDLIKSNNSISWTSNRHFLPLSLLIDKLEIQYN 878
                     +R    + LPL S L     L K+  S               I KLE    
Sbjct: 759  TVQNFFRTVLRTCPMTFLPLDSTLNQLASLGKARLSS--------------IGKLETVCY 804

Query: 879  LKLISNCLNXXXXXXXXXXXXXXXELKLQAFLKIXXXXXXXXXXXXXXXXXXXXDQTTEL 938
            L+ ++NC N               E KL +++K+                    + TT +
Sbjct: 805  LRSLTNCFNVLINSQELPKDILANESKLLSWIKV--------------QYKAFRNGTTHI 850

Query: 939  -SKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTL 997
             SK  +PE+++ IQ F++FN  EL   ++ +  +K ++I ++ K  D+  S        L
Sbjct: 851  FSKKVEPEEMSIIQGFLRFNQAELSTLRSKLHVMKKLAIFLRLKSSDVEQSVELL----L 906

Query: 998  KIGINNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKL 1057
             +G   + ++        PL  + ++    Y  +S    VE ++ +L       K   +L
Sbjct: 907  PLGSEGMGDLY-------PLTDHKFSCTTVYGNDSMILLVEDIDLML-------KCTIRL 952

Query: 1058 YYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPNRKIDINNNFESFNTMFDKRVNFDSI 1117
            Y    +L    I  WW  YG LL++  QY +++P+    + N   S +     ++     
Sbjct: 953  YDHINNLLQVKIPEWWKLYGELLNFRKQYAQNFPHL---VKNGETSTDAGIIGKILEGKK 1009

Query: 1118 THFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIKFSTIEVI 1177
               E+ +  +I  T   + +    I   HE+LA +L+ FM FK  +I   +IK    E I
Sbjct: 1010 EKLEKRLSFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWVRENI 1069

Query: 1178 KILKDNIIYM 1187
            K LK+ +I++
Sbjct: 1070 KELKERLIHI 1079

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  409 bits (1051), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 340/1207 (28%), Positives = 555/1207 (45%), Gaps = 169/1207 (14%)

Query: 5    ILNPLIEVLFHSEGTDTLNGPXXXXXXXXXXXXXXXXAPPTDILLNYLDSSNITPRNPYN 64
            +LNPL+  +F+     T   P                 P  +ILL+Y D           
Sbjct: 8    LLNPLVNSVFNCPTPST--SPLKKIFASLRDQRFILVVPNVNILLHYQDLDT-------- 57

Query: 65   GSNAKPLEDLCMNSYDFIASHILLYDSKVIKNDQCVMESINGKTITIKRVTGNGALNNGE 124
            GS+   L+DLC  +Y+F+A+HI++       +DQ   +++NGKT+ I+  + NG +  G+
Sbjct: 58   GSS---LQDLCY-TYEFVANHIIILKKDSKYSDQ-EFKTLNGKTVLIR--SQNGIVLTGD 110

Query: 125  MLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEFLTAF 184
                 PSK      +  KI   +L+ NFN YL+G + +P+ +ID PL  + +KN+ L  F
Sbjct: 111  GF---PSK------RRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVF 161

Query: 185  DRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKDDRVIW 244
              +   T      + P++   + T+ +      + +L P +   DR  F+ L K+ R   
Sbjct: 162  GVRSTNTS-----SLPLST--DLTQREVSSFEQLFRLHPQLG--DR--FSGLFKEQR--- 207

Query: 245  QPLINSYRATTKHIEQAEGLPQAIDEN--QTDVNIEMVRDINCDLFEQLKDEKRYNFLSH 302
                                 Q I+ N    D  ++     N + FE ++ E+R  F +H
Sbjct: 208  ---------------------QEINANFKGLDSLVDFFDKFNYEAFELIRHERR--FENH 244

Query: 303  DNLMELIYEFIEIKLHDDIWGRISFKFT----ESDFDFSKLSNISVNKLLLNFYSTNNFK 358
              L + ++ ++E+ L+DDIW +I+  +     E+ +D++ L  I+++++   FY     K
Sbjct: 245  SKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPFYPEKQSK 304

Query: 359  NFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILT---------INKLT- 408
             F L  +   EK + +A   F++     +  EK+  ++ TLQ LT         I  +T 
Sbjct: 305  -FSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDADIEDVTI 363

Query: 409  DADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHI 468
            DADTLIGL+ +V+CR +V+NLKSHLFYLQNF+ D NTIKFG++ Y++STLEA+  YF+  
Sbjct: 364  DADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDA 423

Query: 469  SHSHKADLIAF-CDKLHNLYDTILNNIKSLDN-----DILSYRSQNGESLLSLCIINNKM 522
             +S K   + F C +    +D +     S D+     DIL  R+  GES LS+CI     
Sbjct: 424  ENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAGGESCLSVCIQKGNF 483

Query: 523  DIFLELLTTYEHSFPIEXXXXXXXXXXXXXXMQACKYNNYVASEILVTILKNSCNEEELR 582
                 LL  +EH  P+E              MQ  +  N   +++L+ IL  SC   ELR
Sbjct: 484  SGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTINELR 543

Query: 583  IFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVHKVNYNES 642
             +LN+ +++ R+ AHY  +   + +  + G   DWE KDI   TPL  IF+ +       
Sbjct: 544  EYLNRRNRWKRTAAHY--LTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYAQ 601

Query: 643  FIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETININANN 702
             +   FR    WY+I  + FN  AH D  GN LLHVMK  I  L+E     E I++N  N
Sbjct: 602  MVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQ----ENIDVNEVN 657

Query: 703  NKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFLITSTN-LYNSKVNHLLATHFLR 761
             KGL+P MVY K NR DN++ IL++  LI  + Q    +   + + N  +   L  H   
Sbjct: 658  KKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAE 717

Query: 762  TLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISI--LEKESEFPTSHPSICRXXXXXXXX 819
               F  +  H+ RF +           W + I++   ++E++F T   +I          
Sbjct: 718  KTKFGEVVAHTFRFENNR---------WFLWITLKGKDRETDFQTVKHNI--------RA 760

Query: 820  XXXXXHHFIRKYKYSSLPLKSALEFCNDLIKSN-NSISWTSNRHFLPLSLLIDKLEIQYN 878
                   ++R+   S LP+ + LE  +++ K+   S+       FL         E+   
Sbjct: 761  IQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLVSVGKLEVHRFL--------CELTLV 812

Query: 879  LKLISNCLNXXXXXXXXXXXXXXXELKLQAFLKIXXXXXXXXXXXXXXXXXXXXDQTTEL 938
            LKLI                    E K   +L                       + T +
Sbjct: 813  LKLICQ----------------KEEFKKALYLPASDLVNWIRESGR---------KRTNV 847

Query: 939  SKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLK 998
            S+  +PE+IN+IQ+F++FNL EL   ++ I+ ++ +SI  + K  D+N ++      +++
Sbjct: 848  SRRIEPEEINSIQSFLRFNLSELSLIRDKISILQKLSIFSELKAQDINQARCMLFSQSVR 907

Query: 999  IGINNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLY 1058
            +              +   I+ A+      + +S D     L     N+ F ++   KL 
Sbjct: 908  L--------------EDTAISQAFGISGLSEKDSEDLSATILT---SNIDFLKECTNKLV 950

Query: 1059 YDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPNR-KIDINNNFESFNTMFDKRVNFDSI 1117
               + L  G +  WW  Y  LLD   QYNK++PN  K  +++N   F T  + +      
Sbjct: 951  GKIDQLLQGKLTRWWKLYAELLDARNQYNKNFPNSVKPHLDDNKGLFGTYVEGKR----- 1005

Query: 1118 THFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIKFSTIEVI 1177
            +  E  +   IK+    L+    ++K  HE LA EL+ ++ FK  ++R  II+  T+  I
Sbjct: 1006 SKLEEKLSAQIKSCLERLQTLTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDFTVGKI 1065

Query: 1178 KILKDNI 1184
              LKD +
Sbjct: 1066 NTLKDTM 1072

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  405 bits (1041), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 346/1221 (28%), Positives = 570/1221 (46%), Gaps = 180/1221 (14%)

Query: 5    ILNPLIEVLFHSEGTDTLNGPXXXXXXXXXXXXXXXXAPPTDILLNYLDSSNITPRNPYN 64
            +LNPLI  +F+    +    P                APP+ +LLNY D           
Sbjct: 9    LLNPLINAIFNCPEPE--KSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKT-------- 58

Query: 65   GSNAKPLEDLCMNSYDFIASHILL-----YDSKVIKNDQCVMESINGKTITIKRVTGNGA 119
                 PL +LC N+ DFI SHILL     Y +  +++D    E+++GKT+ ++       
Sbjct: 59   ---KLPLHELCYNA-DFINSHILLTTENSYINTTLRDDH--YETLDGKTVVVQWKNNVIH 112

Query: 120  LNNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNE 179
              NG  L           ++ LKI+   +  NFN Y +G E + I YID PL    + N+
Sbjct: 113  TLNGFPL-----------RRRLKILDTKILPNFNDYFKGAEYFAILYIDQPLGCEFVPND 161

Query: 180  FLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKD 239
            +L  F                 N  E T+K      RN   L  D SQ +R  F  ++  
Sbjct: 162  YLHCF-----------------NSYEETSKTA----RNAPNLLMDTSQLERSSFENILHI 200

Query: 240  DRVIW----QPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEK 295
                W      L ++YR              A+++   D + +M  ++    F+ +K + 
Sbjct: 201  HPA-WLTQLGQLFSNYRRA------------ALND---DPSKKMFEELVEQAFDGMKSDS 244

Query: 296  RYNFLSHDNLMELIYEFIEIKLHDDIWGRISFKFTESDFDFSKLSNISVNKLLLNFYSTN 355
             +   S  NL +LI+++ E+ L++DIW R++  F   + +       SVN+LL ++YS  
Sbjct: 245  LFKNFS--NLYDLIHDYFELNLYEDIWSRLTIHFKGYEVNTENCEYFSVNQLLTDYYS-K 301

Query: 356  NFKNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILT------------ 403
            +F++FKL DI  +E+++S A  +FQK     ++ EKS  L++TLQ L+            
Sbjct: 302  DFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVETLQHLSGTTDMGSHKPDL 361

Query: 404  ---INKLT-DADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLE 459
                N LT DADTLI L  +V+CR + ++++SHL+YLQNF+ + ++ KFGILGY+ISTLE
Sbjct: 362  SNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFSNNSSSSKFGILGYAISTLE 421

Query: 460  AITYYFDHISHSHKADLIA--FCDKLHNLYDTI-----LNNIKSLDN--DILSYRSQNGE 510
            A+  YF++ + ++     A   C K  +L D +      N +  L    DIL+YR++ G+
Sbjct: 422  AVVCYFENFNKNNNNVAKANLLCIKTRDLLDKLSCENPTNEVNDLATYKDILAYRNEQGQ 481

Query: 511  SLLSLCIINNKMDIFLELLTTYEHSFPIEXXXXXXXXXXXXXXMQACKYNNYVASEILVT 570
            S+LSLCI NNK DI L++L+ YE  FPIE              +++ K  N  A++IL+ 
Sbjct: 482  SILSLCITNNKNDILLDVLSEYEALFPIEDILEDETIDGSTLLIESIKVGNLEATKILIR 541

Query: 571  ILKNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLT 630
            I+  +C +EEL  ++NKTDK+ RSVAHY  + + + IL   G+ I+W+ K+    TPL +
Sbjct: 542  IMLFNCTDEELVTYVNKTDKYARSVAHY--LTHEMDILKSIGSYINWKQKNSSGQTPLFS 599

Query: 631  IFKVHKVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENP 690
            IF+ +     E  +K+ F +  +WY+ HN  F    H D  GN+LLHV+K  ++ L++  
Sbjct: 600  IFRSYDQPNYEEMVKVAFNIASSWYQRHNTSFGYSDHTDNKGNSLLHVLKTDVSILLQLT 659

Query: 691  ELCETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQ-----LPFLITSTN 745
            +L    NIN  N KGL+P MVY K  R  NI  I K+  LI  + Q       F      
Sbjct: 660  KL----NINGENYKGLTPLMVYVKYKRLSNIDAITKDHRLILEKVQNSTFFTCFDYAKDR 715

Query: 746  LYNSKVNHLLATHFLRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISILEKESEFPTS 805
            L  SK+    A   +    F  I LHSLR+++ +++ + TS++        + E  F T+
Sbjct: 716  LVLSKIGERGANDSI----FGLIYLHSLRYHNLNATVNVTSVS--------KTEEPFVTA 763

Query: 806  HPSICRXXXXXXXXXXXXXHHFIRKYKYSSLPLKSALEFCNDLIKSNNSISWTSNRHFLP 865
                                  ++   ++ LP+ + ++  + L +S+ +I          
Sbjct: 764  --------VINMKTIQGLLRSIVKDNPFTFLPIDNYIDGISHLNRSDLTI---------- 805

Query: 866  LSLLIDKLEIQYNLKLISNCLNXXXXXXXXXXXXXXXELKLQAFLKIXXXXXXXXXXXXX 925
                I K +++  L  ++NC N               E  +  +++I             
Sbjct: 806  ----IGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEASVLYWMRI------------N 849

Query: 926  XXXXXXXDQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDL 985
                     + +  K  +PE+IN IQ+F++FN  E+ +FK ++  ++ + I +  K  D 
Sbjct: 850  TSRRNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEILSFKASLNILRKILIFLSLKSSDF 909

Query: 986  NSSQFFFQKNTLKIGINNLSEILKYYSTQKPLITNAYTSRKFYDY--NSYDYKVEFLNKL 1043
              +      + LK+G                 +TN   +  F     N   +    L++L
Sbjct: 910  EDA----YASLLKMGTK---------------VTNGKAADAFTTIIKNHKMFSDLSLDEL 950

Query: 1044 LENLIFFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPNRKIDINNNFES 1103
            LE++ F E+   +L+   + +    I  WW HYG  L     Y K +P+     +    S
Sbjct: 951  LEHVQFLEECTIQLFNSIQTILFDRIPNWWKHYGEFLTLHKNYRKAFPSAVKPKSTAGTS 1010

Query: 1104 FNTMFDKRVNFDSITHFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKF 1163
             +      +        E+ + + IK +S +L+   ++I   HENLA EL+N+M F+   
Sbjct: 1011 SHIPLGGFIETKR-EQSEQRLSVQIKASSKILKELGSEIFSAHENLAEELSNYMEFRKAC 1069

Query: 1164 IREYIIKFSTIEVIKILKDNI 1184
            + +  I    I+ I +L++ I
Sbjct: 1070 LDQRTIVAFAIKNISVLQECI 1090

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  395 bits (1015), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 349/1226 (28%), Positives = 566/1226 (46%), Gaps = 190/1226 (15%)

Query: 5    ILNPLIEVLFHSEGTDTLNGPXXXXXXXXXXXXXXXXAPPTDILLNYLDSSNITPRNPYN 64
            +LNPLI  +F+    +    P                APP++ LLNY D           
Sbjct: 9    LLNPLINAIFNCPEPE--KSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKT-------- 58

Query: 65   GSNAKPLEDLCMNSYDFIASHILLYDSKVIKNDQCV---MESINGKTITIK-RVTGNGAL 120
                 PL +LC N+ +FI SHILL       N        E+++GKT+ I+ +     AL
Sbjct: 59   ---KLPLHELCYNA-EFINSHILLMTENSFINTNSRDSHYETLDGKTVVIQWKNNVIHAL 114

Query: 121  NNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEF 180
            N  ++            ++ LKI+   +  NFN Y +G  ++ I YI+ PL    + N++
Sbjct: 115  NGFQV------------RRRLKILGTKILPNFNDYFEGATDFVIIYIEQPLSCESVPNDY 162

Query: 181  LTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKL--IK 238
            L  F         Y  I + V  + N              L  D SQ +R  F  +  I 
Sbjct: 163  LQCF-------HSYKKIPKSVYSVHN--------------LSLDSSQQERSSFENILHIH 201

Query: 239  DDRVIW-QPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRY 297
              R+     + ++YR      + +E + + I +                 FE +K +   
Sbjct: 202  PTRLTQLGEMFSNYRTLAPSDDPSEKIFECIVQQA---------------FEGMKSDSL- 245

Query: 298  NFLSHDNLMELIYEFIEIKLHDDIWGRISFKFTESDFDFSKLSNISVNKLLLNFYSTNNF 357
             F    NL +LI+E+ E+ L+DDIW R++  F   +    +    S+N LL +FYS  +F
Sbjct: 246  -FKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEEYKYFSINHLLADFYS-KDF 303

Query: 358  KNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILT-------------- 403
            + FKL D+  +EK++  A  +FQK     ++ EKS  L++TLQ L+              
Sbjct: 304  REFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSKILVETLQELSGTTDMGSHQLDVPG 363

Query: 404  -INKLT-DADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAI 461
             +N L  DADTLI L  +VICR + ++LKSHL+YLQNF+ + ++ KFGILGY++STLEA+
Sbjct: 364  RLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYLQNFSNNSSSSKFGILGYAVSTLEAV 423

Query: 462  TYYFDHISHSH----KAD-LIAFCDKLHNLY--DTILNNIKSLDN--DILSYRSQNGESL 512
              YF+    +     KA+ L+    +L N+   + + N +++L    DIL YR+  G+S+
Sbjct: 424  VCYFEDFKKNSDNMAKANVLLQKTKRLVNMLSCENVTNKVENLATYKDILPYRNGQGQSI 483

Query: 513  LSLCIINNKMDIFLELLTTYEHSFPIEXXXXXXXXXXXXXXMQACKYNNYVASEILVTIL 572
            LS+CI NNK  I L++L+ Y+  FP+E              +++ K  N  A++IL+ I+
Sbjct: 484  LSICISNNKNHILLDILSEYDSIFPLEDLLEDETIDGSTLLIESIKSGNLEAAKILIRIM 543

Query: 573  KNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIF 632
              +C EEEL  ++N+TDK++R+VAHY  + + I IL   GN +DW+ K+    TPL +IF
Sbjct: 544  MLNCTEEELISYINRTDKYSRTVAHY--LTHEIDILKSIGNYVDWKRKNSGGQTPLFSIF 601

Query: 633  KVHKVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPEL 692
            + +     E+ +KI F +  TWY+  N+ F+ + H D  GN+LLHV+K   + L++  +L
Sbjct: 602  RSYDQPNYEAMVKIAFNIANTWYRKQNRSFDYRDHTDNKGNDLLHVLKTDASILLQLTKL 661

Query: 693  CETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFLITSTNLYN---- 748
                +IN  N KGL+P MVY K  R +NI  I+K+  L+  + Q     T  +       
Sbjct: 662  ----DINGENYKGLTPLMVYVKYKRLNNIEAIIKDQRLVLEKIQKSTFFTCFDYAKDHTV 717

Query: 749  -SKVNHLLATHFLRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISILEKESEFPTSHP 807
             SKV    A   L    F  I  HSLR+++ +++ + T             ++E P S+ 
Sbjct: 718  LSKVGERGAKDSL----FGLIYFHSLRYHNLNAAVNIT----------FASDTEKPFSNT 763

Query: 808  SICRXXXXXXXXXXXXXHHFIRKYKYSSLPLKSALEFCNDLIKSNNSISWTSNRHFLPLS 867
             I                  ++   ++ LPL   ++  + L +S+ +I            
Sbjct: 764  VI------NMKTIQGLLRSILKDNPFTFLPLNIYIDEISQLSRSDVTI------------ 805

Query: 868  LLIDKLEIQYNLKLISNCLNXXXXXXXXXXXXXXXELKLQAFLKIXXXXXXXXXXXXXXX 927
              I K ++   L  +SNC N               E  +  +++I               
Sbjct: 806  --IGKADVMSLLHKLSNCFNVLLFLKKVPKSLFTDEASILYWMRI------------NTS 851

Query: 928  XXXXXDQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNS 987
                   + E  K  +PE+IN IQ+F++FN  E+ +FK +++ ++ + I I  K      
Sbjct: 852  KRNQKQPSKENYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILIFISLK------ 905

Query: 988  SQFFFQKNTLKIGINNLSEILKYYSTQK---PLITNAYTSRKFYDYNSYDYKVEFLNKLL 1044
                   N  K   +NL+E+ K     K       N      F DY+        L KLL
Sbjct: 906  ------SNDFKDVNDNLNEMGKSIYNAKAADAFAGNLTNHNMFNDYS--------LAKLL 951

Query: 1045 ENLIFFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPN-----RKIDINN 1099
            E++ F E+   +L    + +    I  WW HYG L+     Y K +P+        D + 
Sbjct: 952  EHVRFLEECTIQLSNLVQLILLEKIPNWWKHYGELITLHKNYRKAFPSVVKPKSTTDTSG 1011

Query: 1100 NFESFNTMFDKRVNFDSITHFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNF 1159
            + +    +  KR         E+ + + IK +S  L+   ++I   HE LA EL+N+M F
Sbjct: 1012 HIQLGGFIETKR------EQSEQRLAVQIKVSSKSLKELGSEIFVAHEKLAEELSNYMEF 1065

Query: 1160 KNKFIREY-IIKFSTIEVIKILKDNI 1184
            +   + +  I+ F+    I +L++NI
Sbjct: 1066 RKACLNQRNIVAFAATN-ISVLQENI 1090

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  385 bits (988), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 337/1214 (27%), Positives = 568/1214 (46%), Gaps = 181/1214 (14%)

Query: 5    ILNPLIEVLFHSEGTDTLNGPXXXXXXXXXXXXXXXXAPPTDILLNYLDSSNITPRNPYN 64
            +LNPLI  +F+    +    P                APP   LLNY D           
Sbjct: 9    LLNPLINAIFNCPEPE--KSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKT-------- 58

Query: 65   GSNAKPLEDLCMNSYDFIASHILL-----YDSKVIKNDQCVMESINGKTITIKRVTGNGA 119
                 PL +LC N  DFI SHILL     Y +  +++     E+++GK + I+       
Sbjct: 59   ---KLPLHELCYN-VDFINSHILLTTENSYLNTTLRDSH--YETLDGKAVVIQWK----- 107

Query: 120  LNNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNE 179
             NN     I  + N    ++ LKI++  +  NFN Y +G  ++ I +ID PL   +  N+
Sbjct: 108  -NN-----IIHALNGFPIRQRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPND 161

Query: 180  FLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKD 239
            +L  FD      E+    AQ V++L   + +Q                            
Sbjct: 162  YLKCFD----SYEEVPKNAQSVSNLPVNSYEQ---------------------------- 189

Query: 240  DRVIWQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRYNF 299
            +R  +  +++ + A    + Q     + +  N  D + +M  DI    F+ +K +  +  
Sbjct: 190  ERSSFDNILHIHSARLAQLGQLFSNYRRLAPND-DPSKKMFEDIVQQSFDGMKSDSLFKN 248

Query: 300  LSHDNLMELIYEFIEIKLHDDIWGRISFKFTESDFDFSKLSNISVNKLLLNFYSTNNFKN 359
             S  NL +LI+++ E+ L+DDIW R+   F   + D  K    SVN+LL +F+S  +FK 
Sbjct: 249  FS--NLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEKYKYFSVNQLLADFFS-KDFKE 305

Query: 360  FKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILT---------------I 404
            FKL DI  +E++++ A  +FQK     ++ EKS  L++TLQ L+               +
Sbjct: 306  FKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILVETLQQLSGPTEISSHQQELPNGL 365

Query: 405  NKLT-DADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITY 463
            N LT DADTL+ L  +V+CR + ++LKSHL+YLQNF+ +P++ KFGILGY+ISTLEA+  
Sbjct: 366  NSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFSNNPSSTKFGILGYAISTLEAVVC 425

Query: 464  YFD------------HISHSHKADLIAFCDKLHNLYDTILNNIKSLDN--DILSYRSQNG 509
            YF+            ++S+    +L+   DKL +   T  N I++L    D L YR++ G
Sbjct: 426  YFEDFDKNNENLAKANVSYQKTRELL---DKLSSENPT--NEIENLATYEDNLQYRNEQG 480

Query: 510  ESLLSLCIINNKMDIFLELLTTYEHSFPIEXXXXXXXXXXXXXXMQACKYNNYVASEILV 569
            +S+LS+CI N K  I L++LT YE  FP+E              +++ K  N  A++IL+
Sbjct: 481  QSILSICITNTKNCILLDVLTEYEDLFPMEDILEDETLDGSTLLIESIKTGNIEAAKILI 540

Query: 570  TILKNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLL 629
             I+  +C+E EL  ++NK DK+ R+VAHY  + + + IL   G+ +DW+ K+    TPL 
Sbjct: 541  GIMLLNCSEGELVSYVNKADKYARTVAHY--LTHEMDILKSIGSYVDWKRKNSSGQTPLF 598

Query: 630  TIFKVHKVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIEN 689
            +IF+ +     E  +KI F +  +WY+ HN  F+   H D  GN+LLH++K  ++ L++ 
Sbjct: 599  SIFRTYDQPNYEEMVKIAFNIANSWYQKHNSSFDYLDHTDSKGNSLLHILKSDVSILLQL 658

Query: 690  PELCETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFLITSTNLY-N 748
             +L    +IN  N KGL+P M+Y K  R  NI  I K+  LI  + Q     T  +   +
Sbjct: 659  SKL----DINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEKVQNSTFFTCFDYAKD 714

Query: 749  SKVNHLLATHFLRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISILEKESEFPTSHPS 808
              V   +     R   F  + LHSLR+++ +++T+ T+ +               T  P 
Sbjct: 715  HSVLSKIGERGARDSLFGLVYLHSLRYHNLNATTNITTAS--------------NTDKPF 760

Query: 809  ICRXXXXXXXXXXXXXHHFIRKYKYSSLPLKSALEFCNDLIKSNNSISWTSNRHFLPLSL 868
            +                  ++  +++ LPL S ++  + L +S+ +I             
Sbjct: 761  LT--TVINMKTIQGLLRSILKDNQFTFLPLNSYIDEISHLNRSDLTI------------- 805

Query: 869  LIDKLEIQYNLKLISNCLNXXXXXXXXXXXXXXXELKLQAFLKIXXXXXXXXXXXXXXXX 928
             I K +++  L  ++NC N               E  +  +++I                
Sbjct: 806  -IGKADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEASVLYWMRI------------NTSK 852

Query: 929  XXXXDQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSS 988
                  + +  K  +PE+IN IQ+F++FN  E+ +FK ++  ++ + I +  K  D   +
Sbjct: 853  RNQKPPSKDNPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKILIFLSLKSNDFEDT 912

Query: 989  QFFFQKNTLKIGINNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLI 1048
                ++   KI IN  +              +A+ +R F ++N +      L +LLE++ 
Sbjct: 913  YDSLREMGRKI-INGEA-------------ADAF-ARIFTNHNMFSDLA--LAELLEHVS 955

Query: 1049 FFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPN-----RKIDINNNFES 1103
            F E+   +L    + +    I  WW HYG  L  +  Y K +P+        D  ++   
Sbjct: 956  FLEQCTIQLSTFVQTILFDKITKWWKHYGEFLALQKNYRKAFPSVVKPKSATDTPSHIPL 1015

Query: 1104 FNTMFDKRVNFDSITHFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKF 1163
             + +  KR         E+ + + IK +S +L+   ++I   HE LA EL+N+M F+   
Sbjct: 1016 GSFIETKR------EQSEQRLAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFRKAC 1069

Query: 1164 I-REYIIKFSTIEV 1176
            + +  I+ F+T  +
Sbjct: 1070 LDQRTIVAFATTNI 1083

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  384 bits (987), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 333/1180 (28%), Positives = 535/1180 (45%), Gaps = 172/1180 (14%)

Query: 42   APPTDILLNYLDSSNITPRNPYNGSNAKPLEDLCMNSYDFIASHILLYDSKV-------I 94
             PPT+ LL ++D+ + +  N           DLC N YDF+ASHILL            +
Sbjct: 43   VPPTEKLLYHVDAESGSSMN-----------DLCQN-YDFVASHILLLQQDTYSDGGFNL 90

Query: 95   KNDQCVMESINGKTITIKRVTGNGALNNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNS 154
               Q   +++N K + ++  +G      G  L           ++  +I  ++L  NFN 
Sbjct: 91   SASQTEYKTLNDKRVAVRSSSGEILTTEGFPL-----------RRRARIQNVELITNFND 139

Query: 155  YLQGMENYPIWYIDYPLYPNIIKNEFLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHK 214
            YL G E + + +ID+PL   +I+        R L +   ++ +    + + + T+     
Sbjct: 140  YLNGSEKFALVHIDHPLIGTLIRK---IDIPRGLAQG-NFNGVDAKGSLVRDLTQKSWSS 195

Query: 215  IRNISKLEPDISQSDRGGFTKLIKDDRVIWQPLINSYRATTKHIEQAEGLPQAIDENQTD 274
              NI +L PD S    G F               N YR+T       E L + I +    
Sbjct: 196  FENILRLHPDWSNILNGYF---------------NRYRSTPLTEGPYEELFRMIVKQ--- 237

Query: 275  VNIEMVRDINCDLFEQLKDEKRYNFLSHDNLMELIYEFIEIKLHDDIWGRISFKFTESDF 334
            V+ +MV D   +LF ++            +L +LI++++E+ L DD+W RI   + + + 
Sbjct: 238  VHAKMVND---ELFRKIP-----------HLYDLIFDYVELNLFDDVWIRIVNSYRKDEI 283

Query: 335  DFSKLSNISVNKLLLNFYSTNNFKNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTA 394
            D   L  +S+N+L    Y    ++ F+L D+  MEK I  A+  F       T  EK+  
Sbjct: 284  DTEPLKFLSINELETELYQ-KKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADC 342

Query: 395  LIKTLQ-----------ILTINKLTDADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADP 443
            LI TLQ           I T+    DADTLI    +V+CR +V+N+KSHLFYL+ F+ D 
Sbjct: 343  LINTLQSLSNTREQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDE 402

Query: 444  NTIKFGILGYSISTLEAITYYFDHISHSHK-ADLIAFCDKLHNLYDTILNNIKSLDNDIL 502
            N+IKFGILGY+ISTLEA+ +YFD +  + K   L    +K   LY  IL + KS    +L
Sbjct: 403  NSIKFGILGYAISTLEAVVFYFDGLKGTKKLQKLQDDSNKAKELY--ILISDKSTGQAVL 460

Query: 503  ---------SYRSQNGESLLSLCIINNKMDIFLELLTTYEHSFPIEXXXXXXXXXXXXXX 553
                      +R+  GES+LS CIIN+K  +  ELL  YE  FP+E              
Sbjct: 461  DISQFRSNLEFRTPQGESVLSQCIINDKNGLLYELLKNYEDIFPLEDILDDETVDGSTLL 520

Query: 554  MQACKYNNYVASEILVTILKNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGN 613
            +QA K +N  A++++V +L+NSC E+ELR ++N+ DK  R+VAHY  + + + IL   G 
Sbjct: 521  IQALKCDNSEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHY--LTHEMNILESIGK 578

Query: 614  LIDWELKDIKKLTPLLTIFKVHKVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGN 673
             I+W+ +D    TPL TIF+ +     E+ I   FR  + WY+ + + F    H D  GN
Sbjct: 579  YINWKSQDSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQANGEDFQFSDHEDNKGN 638

Query: 674  NLLHVMKDYINCLIENPELCETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITS 733
             LLH++K+ ++ L++     + ++IN  N KGL+P M+Y + NR+DN++ I+++  +I  
Sbjct: 639  TLLHIIKNNVSILLD----YDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILD 694

Query: 734  EGQLPFLITSTN-LYNSKVNHLLATHFLRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVD 792
            + Q P  + S +   N  V   L +  ++T  F    +H L++  PS         W   
Sbjct: 695  KLQHPSFLNSFDYARNPLVLKELVSQAIKTTAFELAFVHHLKYEAPS---------WFFH 745

Query: 793  ISI---LEKESEFPTSHPSICRXXXXXXXXXXXXXHHFIRKYKYSSLPLKSALEFCNDLI 849
            I++      + E+ T    I                  ++ +  S LPL+ ALE  ++L 
Sbjct: 746  ITVKIGAGADEEYKTVKLHI--------KTLQNLFQVLLKMHFASFLPLEKALEDLSNLY 797

Query: 850  KSNNSISWTSNRHFLPLSLLIDKLEIQYNLKLISNCLNXXXXXXXXXXXXXXXELKLQAF 909
            KS            +P    I KLE  Y   ++++C +                L+    
Sbjct: 798  KSR-----------MP---SIAKLETLYFFYMLTDCFDVL--------------LRHDNL 829

Query: 910  LKIXXXXXXXXXXXXXXXXXXXXDQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTIT 969
             K+                     +  +  K  +PE+I  + +F++FN GEL   K  + 
Sbjct: 830  NKLVLRESRLVSWIRSQDKKCNNSKKLQKQKNVEPEEIGIMASFLRFNRGELSAVKLKLM 889

Query: 970  TIKDVSILIKYKIMDLNSSQFFFQKNTLKIGINNLSEILKYYSTQKPLITNAYTSRKFYD 1029
            T+K + I +K K  DL  S  F                L  + T+  L  +    +   +
Sbjct: 890  TMKKLLIFLKLKNTDLTHSYQF----------------LSLFGTEYNLAQDRLLFKDL-E 932

Query: 1030 YNSYDYKVEFLNKLLENLIFFEKLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKH 1089
             N   +  E     +  + F E    KL    E L +  I  WW  YG +L+    Y + 
Sbjct: 933  INCCAFGEEATMTFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKVYKQK 992

Query: 1090 YPNRKIDINNNFESFNTMF--DKRVNFDSITHFERNIILNIKNTSTLLRRFNNKIKFLHE 1147
            +PN  I  N++       F   KR   +S       +  ++ +    +RR  ++I   HE
Sbjct: 993  FPN--ISRNDSGTGIIASFFEGKREKMES------KLSSDLADCKKRMRRVGDRISSTHE 1044

Query: 1148 NLAIELNNFMNFKNKFIREYIIKFSTIEVIKILKDNIIYM 1187
             LA EL+ +M FK+ F    I++ +  E I ILK  ++ M
Sbjct: 1045 ILAEELSKYMEFKSNFFINGILRRAVRENINILKGRLVEM 1084

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  340 bits (873), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 261/873 (29%), Positives = 419/873 (47%), Gaps = 112/873 (12%)

Query: 5   ILNPLIEVLFHSEGTDTLNGPXXXXXXXXXXXXXXXXAPPTDILLNYLDSSNITPRNPYN 64
           +LNPL+  +F+     T   P                 P  +ILL+Y D           
Sbjct: 8   LLNPLVNSVFNCPTPST--SPLKKIFASLRDQRFILVVPNVNILLHYQDLDT-------- 57

Query: 65  GSNAKPLEDLCMNSYDFIASHILLYDSKVIKNDQCVMESINGKTITIKRVTGNGALNNGE 124
           GS+   L+DLC  +Y+F+A+HI++       +DQ   +++NGKT+ I+  + NG +  G+
Sbjct: 58  GSS---LQDLCY-TYEFVANHIIILKKDSKYSDQ-EFKTLNGKTVLIR--SQNGIVLTGD 110

Query: 125 MLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEFLTAF 184
                PSK      +  KI   +L+ NFN YL+G + +P+ +ID PL  + +KN+ L  F
Sbjct: 111 GF---PSK------RRCKITNTELFINFNDYLKGSKYFPLIHIDKPLMSDAVKNDELQVF 161

Query: 185 DRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKDDRVIW 244
             +   T      + P++   + T+ +      + +L P +   DR  F+ L K+ R   
Sbjct: 162 GVRSTNTS-----SLPLS--TDLTQREVSSFEQLFRLHPQLG--DR--FSGLFKEQR--- 207

Query: 245 QPLINSYRATTKHIEQAEGLPQAIDEN--QTDVNIEMVRDINCDLFEQLKDEKRYNFLSH 302
                                Q I+ N    D  ++     N + FE ++ E+R  F +H
Sbjct: 208 ---------------------QEINANFKGLDSLVDFFDKFNYEAFELIRHERR--FENH 244

Query: 303 DNLMELIYEFIEIKLHDDIWGRISFKFT----ESDFDFSKLSNISVNKLLLNFYSTNNFK 358
             L + ++ ++E+ L+DDIW +I+  +     E+ +D++ L  I+++++   FY     K
Sbjct: 245 SKLHQTVHNYVELNLYDDIWKQITQLYRDDEIEATYDYNLLKYIAISQVPTPFYPEKQSK 304

Query: 359 NFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILT---------INKLT- 408
            F L  +   EK + +A   F++     +  EK+  ++ TLQ LT         I  +T 
Sbjct: 305 -FSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKIIMDTLQTLTDYSEFPDADIEDVTI 363

Query: 409 DADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHI 468
           DADTLIGL+ +V+CR +V+NLKSHLFYLQNF+ D NTIKFG++ Y++STLEA+  YF+  
Sbjct: 364 DADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENTIKFGVVAYALSTLEAVLCYFEDA 423

Query: 469 SHSHKADLIAF-CDKLHNLYDTILNNIKSLDN-----DILSYRSQNGESLLSLCIINNKM 522
            +S K   + F C +    +D +     S D+     DIL  R+  GES LS+CI     
Sbjct: 424 ENSGKIRSLEFNCRRNKQFWDHLSCKAVSFDSLKSYRDILRIRTAGGESCLSVCIQKGNF 483

Query: 523 DIFLELLTTYEHSFPIEXXXXXXXXXXXXXXMQACKYNNYVASEILVTILKNSCNEEELR 582
                LL  +EH  P+E              MQ  +  N   +++L+ IL  SC   ELR
Sbjct: 484 SGIECLLQNFEHELPLEDILDDQTINGSTLLMQTLETGNTRMADVLLEILCQSCTINELR 543

Query: 583 IFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVHKVNYNES 642
            +LN+ +++ R+ AHY  +   + +  + G   DWE KDI   TPL  IF+ +       
Sbjct: 544 EYLNRRNRWKRTAAHY--LTQDLQMADKIGIFFDWEAKDISGHTPLFAIFRSYDHPDYAQ 601

Query: 643 FIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETININANN 702
            +   FR    WY+I  + FN  AH D  GN LLHVMK  I  L+E     E I++N  N
Sbjct: 602 MVTNAFRTASKWYEIRGENFNFSAHKDTKGNTLLHVMKTNIEILLEQ----ENIDVNEVN 657

Query: 703 NKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFLITSTN-LYNSKVNHLLATHFLR 761
            KGL+P MVY K NR DN++ IL++  LI  + Q    +   + + N  +   L  H   
Sbjct: 658 KKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQKSLFLNCFDYVKNPVIQAELGFHAAE 717

Query: 762 TLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISI--LEKESEFPTSHPSICRXXXXXXXX 819
              F  +  H+ RF +           W + I++   ++E++F T   +I          
Sbjct: 718 KTKFGEVVAHTFRFENNR---------WFLWITLKGKDRETDFQTVKHNI--------RA 760

Query: 820 XXXXXHHFIRKYKYSSLPLKSALEFCNDLIKSN 852
                  ++R+   S LP+ + LE  +++ K+ 
Sbjct: 761 IQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTG 793

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score =  295 bits (755), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 232/791 (29%), Positives = 376/791 (47%), Gaps = 93/791 (11%)

Query: 405  NKLTDADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYY 464
            N   DADTLI L  +V+CR + ++LKSHL+YLQNF+ + ++ KFGILGY++STLEA+  Y
Sbjct: 14   NMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAVVCY 73

Query: 465  FDHISH--SHKADLIAFCDKLHNLYDTI-----LNNIKSLDN--DILSYRSQNGESLLSL 515
            F+  +    + A     C+K  NL D +      N ++ L    DIL+YR++ G+S+LS+
Sbjct: 74   FEDFNKNTGNVAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQGQSILSI 133

Query: 516  CIINNKMDIFLELLTTYEHSFPIEXXXXXXXXXXXXXXMQACKYNNYVASEILVTILKNS 575
            CI N+K  I L++L+ YE+ FP+E              +++ K  N  A+++L+ I+  +
Sbjct: 134  CITNHKNYILLDILSEYENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVLIKIMLFN 193

Query: 576  CNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVH 635
            C EEEL  ++NKTDK+ R+VAHY  + + + IL   GN IDW+ K+    TPL +IF+ +
Sbjct: 194  CTEEELVSYINKTDKYARTVAHY--LTHEMDILKSIGNYIDWKRKNSSGQTPLFSIFRSY 251

Query: 636  KVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCET 695
                 E  +K  F +  TWY+ HN  F+   H D  GN+LLHV+K  I  L++  +L   
Sbjct: 252  DQPNYEEMVKTAFDIANTWYRKHNSLFDYLDHTDNKGNSLLHVLKTNIPILLQLTKL--- 308

Query: 696  ININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFLITSTNLY-NSKVNHL 754
             +IN  N KGL+P MVY K  R  NI  I K+  LI  + Q     T  +   +  V   
Sbjct: 309  -DINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHSVLSK 367

Query: 755  LATHFLRTLDFAYICLHSLRFNDPSSSTSGTSLAWLVDISILEKESEFPTSHPSICRXXX 814
            +    ++   F  I  HSLR+++ +++T+ TS++          E  F T+         
Sbjct: 368  IGERGVKDSLFGLIYFHSLRYHNLNATTNITSVS--------NAEKPFATT--------V 411

Query: 815  XXXXXXXXXXHHFIRKYKYSSLPLKSALEFCNDLIKSNNSISWTSNRHFLPLSLLIDKLE 874
                         ++   ++ LPL + ++  + L +S+ +I              I K +
Sbjct: 412  INMKTIQGLLRSILKDNPFTFLPLNTYIDEISHLNRSDLTI--------------IGKTD 457

Query: 875  IQYNLKLISNCLNXXXXXXXXXXXXXXXELKLQAFLKIXXXXXXXXXXXXXXXXXXXXDQ 934
            +   L  ++NC N               E  +  +++I                      
Sbjct: 458  VTSLLHQLTNCFNVLLFLKKIPENLFTDEASILYWMRI------------NTSKRNQKPS 505

Query: 935  TTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQK 994
              E  K  +PE+IN IQ+F++FN  E+ +FK ++  ++ V I I  K  D   +      
Sbjct: 506  GKENPKTMEPEEINMIQSFLRFNFDEISSFKASLNILRKVLIFINLKSDDFEDAY----- 560

Query: 995  NTLKIGINNLSEIL---KYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFE 1051
                 G+N +   L   +  S  K +ITN      F + +        L  LLEN+ F E
Sbjct: 561  ----KGLNEMGRKLINSEASSAFKGIITN---HNMFSELS--------LAALLENVRFLE 605

Query: 1052 KLVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPN-----RKIDINNNFESFNT 1106
            +   +L    + +    I  WW HYG  L     Y K +PN        D ++       
Sbjct: 606  QCTIQLSSFVQIILFEKIPNWWKHYGEFLALHKSYRKAFPNMVKPKSASDTSSRAPLGGF 665

Query: 1107 MFDKRVNFDSITHFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFI-R 1165
            +  KR         E+ + + IK +S +L+   ++I   HE LA EL+N+M F+   + +
Sbjct: 666  IETKR------EQSEQRLAVQIKASSKMLKELGSEIFVAHERLAEELSNYMEFRKACLDQ 719

Query: 1166 EYIIKFSTIEV 1176
              ++ F+T  +
Sbjct: 720  RSLVAFATTNI 730

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  300 bits (769), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 326/1194 (27%), Positives = 536/1194 (44%), Gaps = 188/1194 (15%)

Query: 42   APPTDILLNYLDSSNITPRNPYNGSNAKPLEDLCMNSYDFIASHILLYD----------- 90
             PPT+ LLNY D+                LEDLC ++ DFI +HILL             
Sbjct: 44   VPPTETLLNYTDTKT-----------KIQLEDLCYHNVDFIGAHILLPPKDSISSSSSTI 92

Query: 91   ----SKVIKNDQCVMESINGKTITIKRVTGNGALNNGEMLVITPSKNYNTPKKMLKIIKM 146
                +++   +Q   +++NG  I +K         N  +++++ S N    ++ +KI ++
Sbjct: 93   DDGYTRLASIEQ--FDTLNGDNILVK-------WRNNFLVLLSGSPN----RQKIKIERI 139

Query: 147  DLWHNFNSYLQGMENYPIWYIDYPLYPNIIK-NEFLTAFDRKLIETEQYSDIAQPVNDLE 205
             +  NFN YLQG   + + +ID PL  ++I+ N+ L  FD                  L 
Sbjct: 140  QVLPNFNDYLQGSTYFILVHIDKPLMKDVIRLNDELECFD---------------TLTLH 184

Query: 206  NTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKDDRVIW----QPLINSYRATTKHIEQA 261
            +   D +   R    L  D+SQ +R  F  +I  +   W    +  +N Y+ +T   E  
Sbjct: 185  DNDGDSSPDAR---PLIQDMSQHERSQFENIINTNDT-WNKRFKDWMNEYKDSTTAEEPN 240

Query: 262  EGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRYNFLSHDNLMELIYEFIEIKLHDDI 321
            E L                + I    + +LK  K +    H  L  LI+E++EI L+D +
Sbjct: 241  ETL---------------FKQIVAVAYNELKSNKIFKGFGH--LRRLIHEYLEINLYDHL 283

Query: 322  WGRIS-FKFTESDFDFSKLSNISVNKLLLNFYSTNNFKNFKLHDIVMMEKKISRAVTYFQ 380
            W +I+     + +   +++ NIS+ ++   FY       F L  I  +EK + R+     
Sbjct: 284  WLQITTLCALDDETKGTRIKNISIEEIDDKFYEM-----FPLDFITKLEKNMVRSTNSIN 338

Query: 381  KFINGITFQEKSTALIKTLQILT----------------INKLTDADTLIGLLSIVICR- 423
            K     +F EKS  LI TLQILT                 N L DADTLI LL ++ICR 
Sbjct: 339  KLNGKNSFNEKSENLIATLQILTNMDNPIGELNQENEKGANNLIDADTLINLLILIICRS 398

Query: 424  -LKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHISHSHKADLIAFCDK 482
             + + +LK ++FYL+ F  D N I FGIL Y+IST E + Y F++I    K  L ++ + 
Sbjct: 399  EINIVDLKRNIFYLKKFNYDENLINFGILSYTISTFEIVIYSFENIVEYDK--LKSYSEI 456

Query: 483  LHNLYDTILNNIKSLDNDI-----LSYRSQNGESLLSLCIINNKMDIFLELLTTYEHSFP 537
            +  L    ++++K +   I     L++RS  GES+L  CI NN+ + FL+LL  YE  F 
Sbjct: 457  IEKLIK--VDDLKKVPKTIKWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVDYEEIFS 514

Query: 538  IEXXXXXXXXXXXXXXMQACKYNNYVASEILVTILKNSCNEEELRIFLNKTDKFNRSVAH 597
            ++              MQA  Y N+  S +L+ +L  +C+ +++  ++NK DKFNR+V H
Sbjct: 515  MDNILDDANVEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGH 574

Query: 598  YFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVH-KVNYNESFIKILFRVVLTWYK 656
            Y  + N + IL   G  ++W+ +D+   TPL TIF+ + + NY+E  I  +F + L WY 
Sbjct: 575  Y--LINELEILKIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDE-VISTVFDITLNWYA 631

Query: 657  IHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCE-TININANNNKGLSPFMVYFKT 715
             +   F +  H D   N++LH+++  I+ L    +     I+IN  N KG +P M+Y K 
Sbjct: 632  ENGLKFQMSDHYDLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKY 691

Query: 716  NRYDNIRIILKNPTLITSEGQLPFLITSTN-LYNSKVNHLLATHFLR-TLDFAYICLHSL 773
            +R  N+++IL +  L+ +  Q     T  +   +S +++ L  H L+    F  I +HSL
Sbjct: 692  HRLSNVKLILGDDRLLFNRYQRELYTTCFDYATDSTISNELGKHALQNNTVFGRIYIHSL 751

Query: 774  RFNDPSSSTSGTSLAWLVDISILEKESEFPTSHPSICRXXXXXXXXXXXXXHHFIRKYKY 833
            +    SS+ +  SL +     + +KE+E  T +  +                   +K + 
Sbjct: 752  KVR--SSTNATFSLTF----PLPDKENETGTVNIKVKAIISLLKVIR--------KKSQI 797

Query: 834  SSLPLKSALEFCNDLI-KSNNSISWTSNRHFLPLSLLIDKLEIQYN---LKLISNCLNXX 889
            S LPL   ++    L  K NN I             ++ K+E+  N   L+ +++CL+  
Sbjct: 798  SLLPLDRIIKVLVKLTSKENNKI-------------IVRKIEMLRNQSLLRRLTDCLDTL 844

Query: 890  X--XXXXXXXXXXXXELKLQAFLKIXXXXXXXXXXXXXXXXXXXXDQTTELSKAYQPEDI 947
                           E KL  ++                      ++T    K+ +PEDI
Sbjct: 845  LFFDIGIDYLSLITDETKLLGWV-----------TNENTKLKHNVNKTHGEKKSLKPEDI 893

Query: 948  NAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKIGINNLSEI 1007
            N IQ+F+KFN+ EL N    + T++ +   I  K +D+  S+  F      I  + +++ 
Sbjct: 894  NIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKESRLAFVHLVKSIKNDQIAQA 953

Query: 1008 LKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLEN-LIFFEKLVCKLYYDFEDLSN 1066
                 + +P+I       ++Y+           N L+ + L F +     L  + ED+  
Sbjct: 954  TN--RSLEPIIEMQSLENQYYN-----------NTLIRDELDFLKACTLILTGNIEDILR 1000

Query: 1067 GTIKTWWYHYGRLLDYEAQYNK-----HYPNRKIDINNNFESFNTMFDKRVNFDSITHFE 1121
              I  WW  YG LL+    YNK     HY N     N +    +   +    F  +   +
Sbjct: 1001 TQIPNWWKLYGELLELNKHYNKLFPPNHYNNTLATDNQHSAEVSNDVNNGGVFGGLIENQ 1060

Query: 1122 RNIIL-----NIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIK 1170
            RN  +     +I      L    N+I   HE LA ELN +M FK  F ++ II+
Sbjct: 1061 RNKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGVFFKKAIIR 1114

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
           YML002W
          Length = 1107

 Score =  299 bits (766), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 242/764 (31%), Positives = 375/764 (49%), Gaps = 103/764 (13%)

Query: 7   NPLIEVLFHSEGTDTLNGPXXXXXXXXXXXXXXXXAPPTDILLNYLDS-SNITPRNPYNG 65
           NPLI  +F+    D    P                 P   ILL Y DS SNI+ R     
Sbjct: 10  NPLINAVFNC--PDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISFR----- 62

Query: 66  SNAKPLEDLCMNSYDFIASHILLYD---------SKVIKNDQCVMESINGKTITIKRVTG 116
                  +LC  +YDF+A+HIL+ D         S   KN    ++S+NGK + +++   
Sbjct: 63  -------ELCY-TYDFVAAHILILDKNSSTDKISSSNQKNGDVYLKSLNGKEVLLRQS-- 112

Query: 117 NGALNNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNII 176
                     +  P K Y + +K  ++    L  NFN YL G  ++ I +IDYPL     
Sbjct: 113 ----------LCIPIKGYFSKRKS-QMRDATLLTNFNDYLHGSGHFGIMHIDYPL----- 156

Query: 177 KNEFLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKL 236
                   D  LI+            +L+   + +     +  K +P + Q      T+ 
Sbjct: 157 -----GVSDWTLID------------ELKGFEESRELPFHSQDKDKPGLLQR-----TEE 194

Query: 237 IKDDRVIWQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKR 296
            K DRV +  L    +  T  +E+     QA++  Q ++  E+  DI   ++  LK+E+R
Sbjct: 195 NKADRVKFIQLFQERKDWTIELEKYLKKYQAMEPLQ-NIGSELFHDIVNMIYNTLKEEQR 253

Query: 297 YNFLSHDNLMELIYEFIEIKLHDDIWGRISFKFTESDFDFSKLSNISVNKLLLNFYSTNN 356
           +   +  NL ++ YE+IE  L+ DIW ++   + +   DF  +S +S++ L   FY+   
Sbjct: 254 FQRFT--NLYDIAYEYIESLLYQDIWNKLQEHYRDKILDFRLVSQLSLDMLDTTFYN-RT 310

Query: 357 FKNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILTIN----------- 405
           FKNF+L DIV ME  + +AV+ F+   +  ++ +K   + KTL I+T             
Sbjct: 311 FKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKKVDVIFKTLNIITGKNSDDTIRDNTL 370

Query: 406 ---KLTDADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAIT 462
               L DADTL+ L ++++CR  V ++  H+ YLQ+F  D NT+KFG LGY++ST+EA  
Sbjct: 371 PKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQSFYKDENTVKFGALGYTLSTIEATL 430

Query: 463 YYFDHISHSHKAD--------LIAFCDKLHNLYDTIL--NNIKSLDNDILSYRSQNGESL 512
            YF  +S+S ++         L  F  K+ + +D ++  N  K    D   YR+Q GES+
Sbjct: 431 SYFYELSNSDESRIQLQKLSLLEDFLIKIRSQHDDLIPINQFK----DYFRYRTQYGESI 486

Query: 513 LSLCIINNKMDIFLELLTTYEHSFPIEXXXXXXXXXXXXXXMQACKYNNYVASEILVTIL 572
           LSL I N K +   E L  +E  FP++              ++  K  N  A+EIL+ I 
Sbjct: 487 LSLLIANKKNEALCEALLNFEDIFPLDDLLYDTDVSGSTLLIKCLKERNLEAAEILIEIF 546

Query: 573 KNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIF 632
           +NSC   EL  + NKTDK  R++AHY  + + I IL + G  I+W LKD+K  T L TIF
Sbjct: 547 QNSCTNSELLNYYNKTDKTKRTLAHY--ITDEIEILEKIGKYINWTLKDLKGRTALFTIF 604

Query: 633 KVHKVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPEL 692
           + +      S IKI     L WYK ++  F +  H D  G++LLH++K  ++ L++    
Sbjct: 605 RSYDQTTYSSTIKIALDQALLWYKNNDIIFKVSDHTDLFGDSLLHILKSQVSLLLK---- 660

Query: 693 CETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQ 736
            E ++IN  N KG++P M Y K NR DNI+ IL++  LI  + Q
Sbjct: 661 FEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDGRLIIKKLQ 704

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 91/224 (40%), Gaps = 17/224 (7%)

Query: 940  KAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKI 999
            K    EDIN I+ F  F+  E+    N I +   +SI  + K  DLN+S    ++     
Sbjct: 867  KPLSAEDINNIKAFCDFSFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYF 926

Query: 1000 GINNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYY 1059
              N +S  L    +  P   + ++S  +Y+             L ++++F +K    L  
Sbjct: 927  SNNEISRTLGDLQSISP---HVHSSMVYYE-------------LSQDILFMKKCTLILTS 970

Query: 1060 DFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPNRKIDINNNFESFNTMFDKRVNFDSITH 1119
                     +  W     +LL++  +Y+  +     +  N  E+  ++F    N      
Sbjct: 971  KLASFIKDKLSIWLKKNTKLLEHRKEYSIKFLQSNEETGNLSEN-TSVFRYAWNVTYRKE 1029

Query: 1120 FERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKF 1163
             ER +   +      L++   +I+  HE LA E ++++  K+KF
Sbjct: 1030 EERRLKFAMLELERDLKKLGTEIRVKHEELAEEFSDYVRMKSKF 1073

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
           (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  283 bits (723), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 249/792 (31%), Positives = 384/792 (48%), Gaps = 77/792 (9%)

Query: 5   ILNPLIEVLFHSEGTDTLNGPXXXXXXXXXXXXXXXXAPPTDILLNYLDSSNITPRNPYN 64
           +LNPLI  +F+    D +N P                 PP +ILL+Y        R+P  
Sbjct: 11  LLNPLINAVFNC--PDPINSPLRKLFERIKYKNFMLIVPPNEILLHY--------RDPEK 60

Query: 65  GSNAKPLEDLCMNSYDFIASHILLYDSKVIKNDQCVMESINGKTITIKRVTGNGALNNGE 124
           G     L++LC   ++F+ASHI+L       N Q     + GK           +LNN +
Sbjct: 61  GL---TLKELCY-EFEFVASHIILDTDNSSNNLQ-----VKGKNSNETLDNRYKSLNNNQ 111

Query: 125 MLV----ITPSK-NYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNE 179
           +L+    I P   N +T KK  KII + +  NFN YL G E Y I Y DYP       N 
Sbjct: 112 LLIKNNNIIPLDFNNSTQKKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPF-----SNS 166

Query: 180 FLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKD 239
           +L       IE E +    +  N+++   +  NHK    S L  D++Q  +  F  +I  
Sbjct: 167 WLPK-----IEIESFYISKKESNNIK-AAQITNHK----SPLSQDLAQKTKSSFRHIINI 216

Query: 240 DRVIWQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRYNF 299
            +  W  + +SY    K+ +           N T + I   R+I    ++++K E+   F
Sbjct: 217 HKE-WNNIFDSYIIDFKNKQL----------NLTSLPI-YFREIVDKAYQKMKFEEI--F 262

Query: 300 LS-HDNLMELIYEFIEIKLHDDIWGRISFKFTESDFDFSKLSN-ISVNKLLLNFYSTNNF 357
           LS H++L  LI+E++E   ++ IW  I     ++ F  +++ + +S+++L L  Y+ N F
Sbjct: 263 LSFHNDLYNLIFEYLESSFYNSIWDHIDRNMIDNQFLHTEMMDFLSIDQLELELYNQN-F 321

Query: 358 KNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILTINK-------LTDA 410
           + F L +++ +E+ +  A   F+K I+  +  EK   LI  LQ LT          + DA
Sbjct: 322 QKFNLVNVIKVERCVKDATDQFKKIIDSKSHSEKCQILIDALQKLTSYDDVHYEPLMVDA 381

Query: 411 DTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHISH 470
           DTL+ L  +VICR KV  L++HL+YLQNF+ D N +KFG+LGY IST EA   Y      
Sbjct: 382 DTLMNLFLLVICRSKVPFLRNHLYYLQNFSTDENNVKFGLLGYGISTFEATLCYLKDFQA 441

Query: 471 SHKAD-LIAFCDKLHNLYDTILNNIK------SLDNDILSYRSQNGESLLSLCIINNKMD 523
             K +  +  C +   L   I +          L  D   +R++ GES+L+LCI + K +
Sbjct: 442 GEKFNKQVLNCIRNKELISKISSEADHSTFQVKLYKDCFKFRNEMGESILALCIKHKKNE 501

Query: 524 IFLELLTTYEHSFPIEXXXXXXXXXXXXXXMQACKYNNYVASEILVTILKNSCNEEELRI 583
              E+L  +E  FP+E              M+A K  N V ++++V +L++SC+E+EL  
Sbjct: 502 TLFEILLNFEDMFPLEDILDDEDIEGTTLLMKALKVENEVGAKLIVDVLQSSCSEDELIK 561

Query: 584 FLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVHKVNYNESF 643
           + N+TD   R  AHY  + N I +L   G   +W++KD K  TPL TI + +     E  
Sbjct: 562 YFNRTDNNQRIAAHY--ITNQIDVLKRIGLFFNWKIKDDKGYTPLTTICRTYDQECYEQM 619

Query: 644 IKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETININANNN 703
           I+  F     WY+  N+  N K H D   N LLH++K  I  L++     + ININA+N 
Sbjct: 620 IETAFFEAQKWYENRNQKLNFKDHNDSKENTLLHILKCDIQVLLK----YDNININAHNL 675

Query: 704 KGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQL-PFLITSTNLYNSKVNHLLATHFLRT 762
           K ++P M Y K NR  NI+ I+++  LI  + Q   FL     + N+ +   L    +R 
Sbjct: 676 KYITPLMTYVKYNRVSNIQEIIRDERLILGKYQKHTFLDCYDFVKNTIIFEDLGVRSVRN 735

Query: 763 LDFAYICLHSLR 774
             F     +SLR
Sbjct: 736 SMFNLFSAYSLR 747

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 62/249 (24%), Positives = 108/249 (43%), Gaps = 27/249 (10%)

Query: 945  EDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKIGINNL 1004
            +DIN I++F++FN+ EL     T+  +K +   +  KI D+N S   F+     +   ++
Sbjct: 873  DDINMIKSFVQFNINELGKLNRTLAILKKLCTFLALKINDVNESYKLFRNFGALLQQKDI 932

Query: 1005 SEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYYDFEDL 1064
            S  +K       LI   Y    F               LL+ + F E     +  +F DL
Sbjct: 933  SNQMKKIDG---LIKPKYFQSIFL-------------ILLDQISFLEICTIHMSDNFNDL 976

Query: 1065 SNGTIKTWWYHYGRLLDYEAQYNKHYPNRKIDINNNFESFNTMFD---KRVNFDSITHFE 1121
                I  W   +  L + + QY + +        ++F+S N + +    R   +     E
Sbjct: 977  IKNDIPEWHSVHFILSNLKKQYKRDF--------SDFDSRNGLNENILSRYTKNKREAAE 1028

Query: 1122 RNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIKFSTIEVIKILK 1181
            + I   I   +TL  +    I + HENLA E N F+ FK++F ++ I+       I  LK
Sbjct: 1029 KRISEEIIENTTLFDKVTAHIWYAHENLAEEFNKFLTFKSRFFKDVILNMIIPSAIATLK 1088

Query: 1182 DNIIYMDSI 1190
            D ++ +++I
Sbjct: 1089 DQVLNIENI 1097

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  283 bits (725), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 341/1243 (27%), Positives = 564/1243 (45%), Gaps = 204/1243 (16%)

Query: 42   APPTDILLNYLDSSNITPRNPYNGSNAKPLEDLCMNSYDFIASHILLYDSKV-------I 94
             PPT  LLNY DS        Y  S    L +LC ++ DF+ SHIL + + +        
Sbjct: 44   VPPTSTLLNYTDSY-------YKLS----LNELCYHNSDFLGSHILTWSNAIDSNKDSTT 92

Query: 95   KNDQCVMESINGKTITIKRVTGNGALNNGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNS 154
             ND    +++NG    IK              +I    N++  ++  KI+K+    NFN 
Sbjct: 93   TNDDEEFDNLNGNKFIIKWKHN----------IIFTRGNFSNDQR-FKILKIHPLTNFND 141

Query: 155  YLQGMENYPIWYIDYPL-YPNIIKNEFLTAF---DRKLIETEQYSDIAQPVNDLENTTKD 210
            Y  G + + + +ID P+   ++I N+ L       R L   E+ + + Q   DL   +K 
Sbjct: 142  YFHGSKEFFLIFIDKPITVSSLIANDSLKCLLPNTRDLKSQEKETPLVQ---DLSQQSK- 197

Query: 211  QNHKIRNISKLEPDISQSDRGGFTKLIKDDRVIWQPLINSYRATTKHIEQAEGLPQAIDE 270
                    S  E D+++++              +  L N+Y+     IE +E  P     
Sbjct: 198  --------SSFENDLNKNEAWNLK---------FGILSNNYK-----IESSELEP----- 230

Query: 271  NQTDVNIEMVRDINCDLFEQLKDEKRYNFL---SHDNLMELIYEFIEIKLHDDIWGRISF 327
                 N ++ R++  + F ++  +K +      + D L +L ++++E  L+D+IW RI  
Sbjct: 231  -----NHKLFRELVNEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWK 285

Query: 328  KFTESDFDFSK-------LSNISVNKLLLNFYSTNNFKNFKLHDIVMMEKKISRAVTYFQ 380
                S  +++        + + S+ ++  NFY       F L  + M+EK +  +VT   
Sbjct: 286  MMMNSVKNYADDQKAQHLIKHFSIVEIDPNFYDI-----FPLKFVPMLEKNLKHSVTCIN 340

Query: 381  KFINGITFQEKSTALIKTLQILTINK--------------LTDADTLIGLLSIVICR--L 424
            K  +  ++ EKST LI++LQI+T +               L DAD L+ LL++VI +  +
Sbjct: 341  KLKSTKSYTEKSTILIESLQIITDSNTGGEESKDKNKSGYLIDADNLLNLLTLVILQSNI 400

Query: 425  KVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHI----SHSHKADLIA-- 478
             + +LK++L+YL+ F+ D ++  FGIL Y+I+T   +++  +++        K+DLI   
Sbjct: 401  TLHDLKANLYYLKYFSTDESSSSFGILNYTIATFHMVSHVLENVIDWDRLKEKSDLIEEL 460

Query: 479  -FCDKLHNLYDTILNNIKSLDNDILSYRSQNGESLLSLCIINNKMDIFLELLTTYEHSFP 537
               D L  L  T  N+ K+L    L YR+ NGESLL+L IIN +   F + L  YE    
Sbjct: 461  IMTDDLSTLSSTFENDKKTL----LMYRNSNGESLLALSIINKQNKKFTQYLIEYEDILN 516

Query: 538  IEXXXXXXXXXXXXXXMQACKYNNYVASEILVTILKNSC-NEEELRIFLNKTDKFNRSVA 596
            ++              +QA + NN+ A+ ILV +L  +C N++EL  ++N+ D  NR++ 
Sbjct: 517  MDIISNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIG 576

Query: 597  HYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVH-KVNYNESFIKILFRVVLTWY 655
            HY  +  ++ IL   G  I+W+ KD+   TPL TIF+ + + NY+E   ++ F++ + WY
Sbjct: 577  HYLVI--NLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQV-FQIAIKWY 633

Query: 656  KIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIE-NPELCETININANNNKGLSPFMVYFK 714
              +N  F +  H D NGN+LLH++++ I+ L++   +    IN+N  N KG +P M+YFK
Sbjct: 634  AANNLKFQMNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFK 693

Query: 715  TNRYDNIRIILKNPTLITSEGQLPFLI------TSTNLYNSKVNHLLATHFLRTLDFAYI 768
              RYDNIR+I+K   LI ++ Q P  I        +++ N     LL+   L    F  I
Sbjct: 694  YKRYDNIRMIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQL----FGKI 749

Query: 769  CLHSLRFNDPSSSTSGTSLAWLVDISILEKESEFPTSHPSICRXXXXXXXXXXXXXHHFI 828
             + SL+     S+         ++ +IL  E++  T   ++                   
Sbjct: 750  IVLSLK--KQMSTVPSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMK------ 801

Query: 829  RKYKYSSLPLKSAL----EFCNDLIKSNNSISWTSNRHFLPLSLLIDKLEIQYNLKLISN 884
            RKY  S LPL + L     F +   K+NN      N   +PL   I+KL I+  LK ++ 
Sbjct: 802  RKYAISFLPLDTLLNESQSFLDKKSKNNN------NLRTIPLR-YIEKLRIRRFLKRLNT 854

Query: 885  CLNXXXX--XXXXXXXXXXXELKLQAFLKIXXXXXXXXXXXXXXXXXXXXDQTTELSKAY 942
            CL+                 E +L  ++ I                        +  K  
Sbjct: 855  CLDVLLHFDDSTIATPLLLSETELLEWISIEESKLRRSSTTPSAKSKLENAMGEKKKKEL 914

Query: 943  QPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKIGIN 1002
            +PE+IN IQ F+KFNL EL      +  +  + I +  K +D++ +Q  F  N L  G+N
Sbjct: 915  KPENINIIQNFLKFNLNELNTISMNLKVLSKLVIFMNLKTLDIHDAQIRF--NGLVKGLN 972

Query: 1003 NLSEILKYYSTQKPLITNAYTSRKFYDYNSY-DYKVEFLNKLLENLIFFEKLVCKLYYDF 1061
            N          + P I     S    D + Y D K   L  L E++ FF +   KL +D 
Sbjct: 973  N---------KEVPSIIEK--SFNVIDSSRYDDDKGVLLESLHEDISFFNECTLKLIHDV 1021

Query: 1062 EDLSNGTIKTWWYHYGRLLDYEAQYNKHYPN-----RKIDI------------------- 1097
            E++    I  WW  YG LL+    Y+K++PN     R+ D+                   
Sbjct: 1022 ENIIKIKIPNWWKLYGELLELNKYYHKNFPNCVVHARRTDLLSGNNANTNTNTNTNTNTN 1081

Query: 1098 -------------NNNFESFNTMFDKRVNFDSITHFERNIILNIKNTSTLLRRFNNKIKF 1144
                         N+N   F  + + + N       ER    +I  T +LL    + +  
Sbjct: 1082 SPQRLHHHSEHQNNSNNGVFANLIENQKN-----KLERKTSHHIDETISLLESLGSGLLN 1136

Query: 1145 LHENLAIELNNFMNFKNKFIREYIIKFSTIEVIKILKDNIIYM 1187
             HE+LA ELN +M FKN+F    I+K    E IK+L+++++ +
Sbjct: 1137 KHEHLAEELNRYMEFKNRFFGRNIMKNFVGEDIKLLEEHVLVL 1179

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
           Ashbya gossypii ACR006C
          Length = 1079

 Score =  281 bits (718), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 223/795 (28%), Positives = 384/795 (48%), Gaps = 99/795 (12%)

Query: 5   ILNPLIEVLFHSEGTDTLNGPXXXXXXXXXXXXXXXXAPPTDILLNYLDSSNITPRNPYN 64
           +LNPL+  +F+     T   P                 P TD+LL Y D  +        
Sbjct: 8   LLNPLVNAVFNCPTPTT--SPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDS-------- 57

Query: 65  GSNAKPLEDLCMNSYDFIASHIL--LYDSKVIKNDQCVMESINGKTITIKRVTGNGALNN 122
                PL +LC N YDF+ASHIL  L +SKV + +     ++NG ++ I+   G      
Sbjct: 58  ---GLPLSELCYN-YDFVASHILIQLQESKVTEQE---YRTLNGNSVIIRSQAG------ 104

Query: 123 GEMLVITPSKNYNTPK-KMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEFL 181
                I  SK    P+ +  ++   ++  NFN YL  +  +P+ +ID PL   +++N+ L
Sbjct: 105 -----IVMSK----PELRKCRVKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGALVRNDEL 155

Query: 182 TAFDRKLIETEQYSDIAQPVNDLENTTKDQNH-KIRNISKLEPDISQSDRGGFTKLIKDD 240
             F           ++  P       T  +NH       +L P +     G F +    D
Sbjct: 156 QVFGS--------YEMHNPSKSKTINTISENHIPFEKFIRLYPQLGAQLDGYFQR----D 203

Query: 241 RVIWQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRYNFL 300
           R   Q + N                   + +Q D  I++ +D+  D++  +K++K  NF 
Sbjct: 204 R---QRIRN-------------------EVDQLDKLIKIFKDLVIDVYGVIKEDK--NFR 239

Query: 301 SHDNLMELIYEFIEIKLHDDIWGRI----SFKFTESDFDFSKLSNISVNKLLLNFYSTNN 356
           ++  L+ +  E++E+ +++DIW ++      K  +    +S    IS+N +    Y    
Sbjct: 240 NYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSSTKYISLNNVATILYPEGT 299

Query: 357 FKNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILT-------INKLTD 409
             +F L  +  +EK++ +A   F K     +  EK+  ++ T QILT       I+   D
Sbjct: 300 -NSFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEKAKIVVSTFQILTTKMEYTSIDPTID 358

Query: 410 ADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHIS 469
           ADTLIGL+ +V+CR +V+NLKSHL YL+ FA  P+ +KFG+ GYS+ST+EA+  YF+   
Sbjct: 359 ADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGYSLSTIEAVLAYFEAGD 418

Query: 470 HSHK-ADLIAFCDKLHNLYDTILNNI----KSLDNDILSYRSQNGESLLSLCIINNKMDI 524
            + K   LI+  +     +D I + +     S  N ++S RS N ES LS+CI   ++D+
Sbjct: 419 GTEKLKKLISLSEANRVFWDLIRSGVAVSLSSYKNSLIS-RSSNCESSLSICIHAGRLDL 477

Query: 525 FLELLTTYEHSFPIEXXXXXXXXXXXXXXMQACKYNNYVASEILVTILKNSCNEEELRIF 584
             E+L  Y+    +E              +QA +  +   +E+L+ ++ ++C   E   +
Sbjct: 478 IKEILLNYQEQIKLEDLLFDVNQANSTLLIQALETGHDEIAELLIDVMISNCTNNEFYEY 537

Query: 585 LNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVH-KVNYNESF 643
           +N+++   R+VAHY  +  +  I+ + G  +DW  KD+   TPL  I + + +++Y+E  
Sbjct: 538 VNRSNSAGRTVAHY--LPQAFSIIEKIGLYLDWRKKDVNMHTPLFIICRAYDQLHYSEML 595

Query: 644 IKILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETININANNN 703
            +  F  V  + +   + F+   H D  GN+LLH+MK  I  ++  P     IN+N +N 
Sbjct: 596 SRS-FEYVFEYCRRRGEDFSFTDHEDPMGNSLLHIMKGGIQSILSQP----NINVNKSNI 650

Query: 704 KGLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFLITSTN-LYNSKVNHLLATHFLRT 762
           KG++P M+Y K NR +NIR IL++  LI S+ Q P  + + + + N  + +L+ TH  + 
Sbjct: 651 KGMTPLMLYAKYNRIENIRDILEDKRLIVSKIQNPQTLKAIDYVKNPMILNLIGTHIAKN 710

Query: 763 LDFAYICLHSLRFND 777
             +  +    ++F D
Sbjct: 711 SLYGLLSADGIKFED 725

 Score = 65.1 bits (157), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 106/229 (46%), Gaps = 23/229 (10%)

Query: 943  QPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQ-FFFQKNTLKIGI 1001
            +PE++++IQ+F+KFNL E    K   T ++ + +    K  D+  +Q   +Q+  ++I  
Sbjct: 843  EPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSLKAQDIECAQRIIYQQ--MEIVS 900

Query: 1002 NNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYYDF 1061
            N++       S +K  I     S + Y  +S+   +EF+   LE       L  K+ Y  
Sbjct: 901  NSVGP-----SVEKTFI----GSNENYSLDSFQQAIEFIAMCLET------LSSKIQY-- 943

Query: 1062 EDLSNGTIKTWWYHYGRLLDYEAQYNKHYPNRKIDINNNFESFNTMFDKRVNFDSITHFE 1121
              + +  +  WW  YG L     +Y +++P+     + + E     F+  +        E
Sbjct: 944  --VLDSKVTLWWRLYGELSSLRREYQRNFPSDFKSSDVSGEESKGFFESYIEGKR-QKTE 1000

Query: 1122 RNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIK 1170
              +   ++   T L+  + ++K  HENLA E++ F+ FKN     +++K
Sbjct: 1001 DKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKNFAYESFVMK 1049

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
           similarities with uniprot|Q04257 Saccharomyces
           cerevisiae YML002W and some similarities with
           uniprot|Q04257 Saccharomyces cerevisiae YML003W
           Hypothetical ORF
          Length = 1067

 Score =  276 bits (706), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 233/763 (30%), Positives = 376/763 (49%), Gaps = 105/763 (13%)

Query: 42  APPTDILLNYLDSSNITPRNPYNGSNAKPLEDLCMNSYDFIASHILLYD--SKVIKNDQC 99
            P T+ LL + D  +              L +LC + YDF+ASHI++    +K + + + 
Sbjct: 43  VPSTETLLQFQDLES-----------GLELAELCYH-YDFVASHIVVIKDPTKDVPDQRS 90

Query: 100 V----MESINGKTITIKR-----VTGNGALNNGEMLVITPSKNYNTPKKMLKIIKMDLWH 150
           +      ++NG+ ++I+      VTG+G                 T ++ + I +++L  
Sbjct: 91  IYNTDFTTLNGRKLSIRYRNSTIVTGDGF----------------TERRKITIKEINLLP 134

Query: 151 NFNSYLQGMENYPIWYIDYPLYPNIIKNEFLTAFDRKLIETEQYSDIAQ---PVNDLENT 207
            FN YL+G    PI +I  PL  +++  + L  F +  +   +YS   Q   P ++ +  
Sbjct: 135 TFNDYLKGSNYTPILHISMPLCGDLVPLDELQVFSK--VAGNKYSKQEQAPLPFDEEQKK 192

Query: 208 TKDQNHKIRNISKLEPDISQSDRGGFTKLIKDDRVIWQPLINSYRATTKHIEQAEGLPQA 267
                 +I++IS    D+++             RV          A T H+ +A  + +A
Sbjct: 193 VLYFEQRIQSIS----DVAE-------------RV----------ALTFHLTKAR-IKKA 224

Query: 268 IDENQTDVNIEMVRDINCDLFEQLKDEKRYNFLSHDNLMELIYEFIEIKLHDDIWGRISF 327
           I            RD    + + +  +KR N L  ++L  +IY+++E+KL  DI  ++S 
Sbjct: 225 ISVIGIRTEWLNTRD---SIRQIISLDKRLNHL--EDLDAMIYDYVELKLFTDIQQQLSE 279

Query: 328 ----KFTESDFDFSKLSNISVNKLLLNFYSTNNFKNFKLHDIVMMEKKISRAVTYFQKFI 383
               +  E  FDF  L +IS+N++  NFY  +  K+F L  +V +EK ++ A+ Y +   
Sbjct: 280 IVEDQELEHRFDFKALRSISLNQVPTNFYPKDE-KSFSLASVVELEKSVNDALEYLKSID 338

Query: 384 NGITFQEKSTALIKTLQILT--INKL-TDADTLIGLLSIVICRLKVRNLKSHLFYLQNFA 440
              T   K   L  T+++L+  IN + TDADTL+ L  ++ICR +V  L   L YL NF 
Sbjct: 339 LKTTHSGKLEVLSTTMRLLSREINGISTDADTLLSLFVLLICRSQVTGLVRTLTYLTNFE 398

Query: 441 ADPNTIKFGILGYSISTLEAITYYFDHISHSHKAD-LIAFCDKLHNLYDTILNNIKSLDN 499
               +IKFG+ GY +ST EA   +F    H    D L   C     ++ +I  + K ++ 
Sbjct: 399 ISETSIKFGLQGYVLSTFEAALSFF----HQDTVDSLTKKCASNKKIWASIQKHSK-VEA 453

Query: 500 DILS----YRSQNGESLLSLCIINNKMDIFLELLTTYEHSFPIEXXXXXXXXXXXXXXMQ 555
           ++LS     R+ +GESLLS+CI ++  ++   LL  +E  FP+E              +Q
Sbjct: 454 ELLSSNLRIRTDSGESLLSICIQSHNNEVLTTLLANFESEFPLEDILDDRDFALSTLLIQ 513

Query: 556 ACKYNNYVASEILVTILKNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLI 615
           A +  N  A+ IL  I+  SC E E+R +LN  +  NR  AHY  +   I +L   G   
Sbjct: 514 ALQVQNSQAAAILSEIILKSCTESEVRSYLNSPNLHNRITAHY--IMQDISLLESVGRYF 571

Query: 616 DWELKDIKKLTPLLTIFKVH-KVNYNESFIKILFRVVLTWYKIHNKPFNLKAHVDQNGNN 674
           +WE KDI   TPL  +F+ +  VNY+E   K+L +VV  WY  +NKPFN K H D  GN 
Sbjct: 572 NWEHKDINGHTPLFAVFRSYDAVNYDEIVTKVLDQVV-KWYANNNKPFNFKIHEDPKGNT 630

Query: 675 LLHVMKDYINCLIENPELCETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITSE 734
           LLHVMK  I  L++ P+    +N+N  ++KGL+P M+Y + NR  NI  I+K+  L+   
Sbjct: 631 LLHVMKSGIESLLKLPD----VNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDL 686

Query: 735 GQLPFLITSTNLYNSKVNHLLATHFLRTLDFAYICLHSLRFND 777
            Q P ++TS +   +K   +  T    T +   + +HSLRF +
Sbjct: 687 VQQPLVMTSLDF--TKNPKVTKTILDATFNREPVVIHSLRFEE 727

 Score = 85.9 bits (211), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 72/235 (30%), Positives = 122/235 (51%), Gaps = 38/235 (16%)

Query: 943  QPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKIGIN 1002
            +PE+IN IQTF+K+NL E +  +N +  +K ++I+ + K  D+ + +  F    L +G N
Sbjct: 839  EPEEINGIQTFLKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSF----LSLG-N 893

Query: 1003 NLSE--ILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYYD 1060
             +S+  + K +       TN   S   YD + Y++          NL + E  V  L  +
Sbjct: 894  QMSQKGVAKSFEN-----TNCAWS---YDLSYYEFT--------RNLEYLEHSVVTLLNN 937

Query: 1061 FEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPNRKI---DINNNFESFNTMFD-KRVNFDS 1116
            FE L   T   WW H+G L++ + ++ K++PN K      N NF   +T  + KR  F  
Sbjct: 938  FESLLAKTT-LWWKHFGELMELKKEWKKNFPNDKAPPSSANRNF--IDTYIEGKRSKF-- 992

Query: 1117 ITHFERNIILN-IKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIK 1170
                 RN + N +K +S  L++   +IK  HE++A+ +N F+ FK +F  ++I+K
Sbjct: 993  -----RNKLSNQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVK 1042

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML002W and
           YML003W; YML002W and YML003W represent one ORF in this
           genome
          Length = 1071

 Score =  276 bits (705), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 217/794 (27%), Positives = 378/794 (47%), Gaps = 99/794 (12%)

Query: 5   ILNPLIEVLFHSEGTDTLNGPXXXXXXXXXXXXXXXXAPPTDILLNYLDSSNITPRNPYN 64
           +LNPL+  +F+         P                 P T++LL Y D++   P     
Sbjct: 8   LLNPLVNAVFNCPAPGA--SPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVP----- 60

Query: 65  GSNAKPLEDLCMNSYDFIASHIL--LYDSKVIKNDQCVMESINGKTITIKRVTGNGALNN 122
                 L +LC N Y+F+ASH L  L +++V + +    ++INGK++ I+  +G      
Sbjct: 61  ------LTELCYN-YEFVASHTLVQLQEARVTELE---FQTINGKSVVIRPQSG------ 104

Query: 123 GEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEFLT 182
             ++   PS       K  +I + +L  +FN YL G   + + YID PL   I     L 
Sbjct: 105 --IITAQPSA------KKCRIQRCELLRSFNDYLLGRTAFALLYIDRPLVGEIELITPLR 156

Query: 183 AFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKDDRV 242
            F  +  +  QY  I Q        T D    +    +L P +         ++ KD + 
Sbjct: 157 VFGPQE-QPLQYQRITQ--------TADAPLPLEQFLRLHPQLGNQ----LDEVFKDAKE 203

Query: 243 IWQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRYNFLSH 302
             + +  S +   +                     E+V  + C     +K +K  NF ++
Sbjct: 204 RMRYIALSLKELVRLFH------------------ELVEKVYC----LIKLDK--NFRNY 239

Query: 303 DNLMELIYEFIEIKLHDDIWGRISFKFTESDFD----FSKLSNISVNKLLLNFYSTNNFK 358
            NL+E++  ++E+ +++D+W ++     +++ D    +    +IS+N+L  + Y      
Sbjct: 240 LNLLEMVQGYVELNMYEDVWRKLVQLNGKNEPDRVPGYYITRSISLNQLSTSIYP-EELD 298

Query: 359 NFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILT-------INKLTDAD 411
            F L  +  +EK++ +A   F K     +  EK+  LI T Q LT       ++ + DAD
Sbjct: 299 KFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILISTFQKLTTKTSQATLDPMIDAD 358

Query: 412 TLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHISHS 471
           TL+GL+ +V+CR +V+NLKSHL YL+ FA + + +KFG+LGYS+STLEA+  YFD    S
Sbjct: 359 TLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKFGLLGYSLSTLEAVVGYFDIGGSS 418

Query: 472 HKAD-LIAFCDKLHNLYDTILNNIK---SLDNDILSYRSQNGESLLSLCIINNKMDIFLE 527
            K + LI  C +    ++ I   I        ++L  R+ + ES+LSLCI   + D+F +
Sbjct: 419 IKLERLITQCQRNKIFWNLIEQGIPINLKEHEEVLISRTPSCESVLSLCIQYGRQDVFYD 478

Query: 528 LLTTYEHSFPIEXXXXXXXXXXXXXXMQACKYNNYVASEILVTILKNSCNEEELRIFLNK 587
           ++  Y+  F +E              +QA +  N   +E ++ +L  +C   E+  ++NK
Sbjct: 479 IIANYQSHFTLEDILQDVNQSNCSLLIQALQAGNKDITEAVIDLLIANCTNTEMYAYINK 538

Query: 588 TDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVHKVNYNESFIKIL 647
            D   R+V HY  +  +  I+   G  +DW+ KD+   TPL T+ + +    + S++++L
Sbjct: 539 CDIAGRTVGHY--LPQNYEIVDRLGKFVDWKRKDLNMHTPLFTVCRAYD---HPSYLELL 593

Query: 648 ---FRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETININANNNK 704
              F+    +Y    K F+   H D  GN LLH++KD I   +  P      N+N  N +
Sbjct: 594 SKCFQHCFDFYSTRGKRFSFADHEDPLGNTLLHIIKDGIQLALSTP----GANVNKCNTR 649

Query: 705 GLSPFMVYFKTNRYDNIRIILKNPTLITSEGQLPFLITSTN-LYNSKVNHLLATHFLRTL 763
           G++P MVY K NR +NIR IL +  LI S+ Q P  + + + + N  + +L+ T   +  
Sbjct: 650 GMTPLMVYAKYNRIENIREILNDKRLILSKLQDPQSLKAIDYVKNPIILNLIGTAMAKNS 709

Query: 764 DFAYICLHSLRFND 777
            +  + +H++++ +
Sbjct: 710 LYGCLSVHNIKYEE 723

 Score = 62.8 bits (151), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 58/255 (22%), Positives = 114/255 (44%), Gaps = 30/255 (11%)

Query: 943  QPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKIGIN 1002
            +PE+I++IQ F+KF+L E    +   T +K + I   YK  D+  SQ             
Sbjct: 841  EPEEIHSIQNFLKFSLTEFNYLREKFTVLKKLIIFEHYKSHDIECSQRILYSQ------- 893

Query: 1003 NLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYYDFE 1062
               EI+      K L T+ + +      + ++  V+F+   L++L    K+V        
Sbjct: 894  --GEIIASVVPSKRLRTSPFDNEFNDGIDPFEQAVDFMCMCLDSLT--SKIV-------- 941

Query: 1063 DLSNGTIKTWWYHYGRLLDYEAQYNKHYPNRKIDINNNFESFNTMF-----DKRVNFDSI 1117
            ++ +  + TWW  YG + + + +Y +++P +    + + E     F     DKR   +S 
Sbjct: 942  EVLDSKVSTWWTLYGEITNLQKEYQRNFPEKGKPNSASSEDSKGFFVSYMEDKRQKLESK 1001

Query: 1118 THFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIKFSTIEVI 1177
                 ++       S  L+  + ++K  HE LA E++ F++ KN     +++K      I
Sbjct: 1002 LQSRLSV------CSENLQHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKAYVNRRI 1055

Query: 1178 KILKDNIIYMDSIIA 1192
            K  K+ ++ ++  I+
Sbjct: 1056 KQHKNMLLAIEEFIS 1070

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa]
           {ON} similar to uniprot|Q04263 Saccharomyces cerevisiae
           YML002W Hypothetical ORF
          Length = 1097

 Score =  270 bits (691), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 213/751 (28%), Positives = 356/751 (47%), Gaps = 87/751 (11%)

Query: 5   ILNPLIEVLFHSEGTDTLNGPXXXXXXXXXXXXXXXXAPPTDILLNYLDSSNITPRNPYN 64
           +LNPLI  +F+       N P                 P  +ILL Y D  +        
Sbjct: 8   LLNPLINAVFNCPTPQ--NSPLRKVFTRIEKQRFALVTPTPEILLEYEDLES-------- 57

Query: 65  GSNAKPLEDLCMNSYDFIASHILLYDSKVIKNDQCVMESINGKTITIKRVTGNGALNNGE 124
           GS+   L+DLC  S  F++ HILL       +++   ++++GKTIT++      AL  GE
Sbjct: 58  GSS---LQDLCY-SASFVSDHILLLGGGGCSHEE-EYKTLSGKTITLR--NQQKALFTGE 110

Query: 125 MLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEFLTAF 184
                        ++  ++++ +L  NFN Y QG   YPI ++D+PL   + + +    F
Sbjct: 111 GF---------DARRRCQVLETELLSNFNEYFQGSSTYPIIHVDFPLTGRLARRDEWPGF 161

Query: 185 DRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKDDRV-I 243
                 +   +D     + L  +T+ +   +  + +  P  S  D+   + +I+  R  +
Sbjct: 162 KAYRFAS---TDTTSANSSLAASTEPKA-SLEQMLRAHP--SYGDK--LSAIIRTQRAAL 213

Query: 244 WQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRYNFLSHD 303
                N+       ++  E    AI E+Q+                         F +  
Sbjct: 214 SSSTYNADNLAAHFMQTCEKALAAIQEDQS-------------------------FRAFP 248

Query: 304 NLMELIYEFIEIKLHDDIWGRISFKFTESDF----DFSKLSNISVNKLLLNFYSTNNFKN 359
           NL   I+E++E+ L+DD W +++    +S+     DFS L NIS++++    Y T+  K 
Sbjct: 249 NLRLQIHEYVEMNLYDDFWAQLTNSLKDSEIENQSDFSILRNISISQVPSFLYPTDRQK- 307

Query: 360 FKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQI----LTINK---LTDADT 412
           F +  +  +EK +  AV   ++     +   K+  +++TLQ     L IN      DADT
Sbjct: 308 FDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIVETLQTVSRSLEINDKVISVDADT 367

Query: 413 LIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHISHSH 472
           L+ LL +V+C+ +V++LKSHLFYLQ FA D N+I FGIL Y +STLEA+  YF+  S   
Sbjct: 368 LVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITFGILAYGMSTLEAVLSYFE--SREK 425

Query: 473 KADLIAFCDKLHNLYDTILNN---IKSLD----NDILSYRSQNGESLLSLCIINNKMDIF 525
              L   C    + ++ + +    + SL+     DIL  R+  G S LS+C+ N + ++F
Sbjct: 426 LKLLEKHCSSNASYWEALADGKLPLGSLNPSEVKDILRTRTPAGLSCLSICLQNRQPNLF 485

Query: 526 LELLTTYEHSFPIEXXXXXXXXXXXXXXMQACKYNNYVASEILVTILKNSCNEEELRIFL 585
           L L T +EH FP+E              +Q         S   + +L  SC + EL  FL
Sbjct: 486 LHLATKFEHCFPLEDLLNDETVEGSNLLIQMLDNGCSSLSGNFIEMLFRSCTKTELESFL 545

Query: 586 NKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVHKVNYNESFIK 645
           N  +++ RS  HY  + +++ ++ + G  I+WE +D    TPL  I + +     ++ + 
Sbjct: 546 NHVNRYQRSSGHY--LMHALDLIVKVGKFINWEQRDCNGHTPLFAIIRTYDHTDYDAMVL 603

Query: 646 ILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETININANNNKG 705
             ++    W  +  K F L  H D  GN LLHV+K  ++ ++++P     +N+N+ N KG
Sbjct: 604 EAYKSARLWCTLKGKQFRLSKHQDNKGNTLLHVIKSNVSVVLDDP----LVNVNSFNKKG 659

Query: 706 LSPFMVYFKTNRYDNIRIILKNPTLITSEGQ 736
           L+P MVY + NR DNI+ IL++  LI  + Q
Sbjct: 660 LTPIMVYARYNRLDNIKSILRDKRLIIQKCQ 690

 Score = 75.9 bits (185), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 71/252 (28%), Positives = 118/252 (46%), Gaps = 28/252 (11%)

Query: 943  QPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKIGIN 1002
            +PE++ +IQ  +KFN  E+   K+    +K ++I    K  DL  S   FQ +      N
Sbjct: 852  EPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHG-----N 906

Query: 1003 NLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYYDFE 1062
            N ++I+          TN + S K    +S   + EF   L  N    E     L    +
Sbjct: 907  NFTKIIGRS-------TNVFGSLK----HSLP-QCEF-GYLANNTALLELSSRLLVQKID 953

Query: 1063 DLSNGTIKTWWYHYGRLLDYEAQYNKHYPN---RKIDINNNFESFNTMFDKRVNFDSITH 1119
             + N  I  WW  YG L+    +YNK++P+    ++  N  F S + +  KRV       
Sbjct: 954  KILNHDIPHWWKTYGELVSLRHEYNKNFPDDVRPRVAENTGFIS-SYIETKRV------R 1006

Query: 1120 FERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIKFSTIEVIKI 1179
             E+ ++  I  +S  L RF+  ++  +E+LA+ELNNF+NFK +F     IK      IK 
Sbjct: 1007 LEQGLVGRINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKW 1066

Query: 1180 LKDNIIYMDSII 1191
            L++ ++ ++  +
Sbjct: 1067 LQEQLVCLEEAL 1078

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W
           - Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  266 bits (680), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 209/752 (27%), Positives = 362/752 (48%), Gaps = 89/752 (11%)

Query: 5   ILNPLIEVLFHSEGTDTLNGPXXXXXXXXXXXXXXXXAPPTDILLNYLDSSNITPRNPYN 64
           +LNPLI  +F+      LN                  APPT++LL Y D  +        
Sbjct: 8   LLNPLINAVFNC--PTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLES-------- 57

Query: 65  GSNAKPLEDLCMNSYDFIASHILLYDSKVIKNDQCVMESINGKTITIKRVTGNGALNNGE 124
                PL+DLC  +  F++ HI+L D +    ++   ++++GKTI ++   G        
Sbjct: 58  ---GLPLQDLCYAT-GFVSDHIVLLDGREGLQEE-EYKTLSGKTILLRSQQG-------- 104

Query: 125 MLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEFLTAF 184
             +I  +  ++T ++  +I + +L  NFN YL+G   +PI ++D+PL   + + +    F
Sbjct: 105 --IIFTAAAFDT-RRRCRIQRAELLTNFNEYLKGDTTFPIIHVDFPLTGRLARRDEWQCF 161

Query: 185 DRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLIKDDRVIW 244
             ++ + +++++   P N  + +  D N  +  + ++ P+  +S       ++K  R+  
Sbjct: 162 --RVTKNQEHTN--GPKNSGKLSHGDNNISLEQLLRINPEYGES----LNDIVKAQRIS- 212

Query: 245 QPLINSYRATTKHIEQ--AEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRYNFLSH 302
              +NS    T H+     +   +A+D         +VR      F+ L           
Sbjct: 213 ---LNSSVTGTTHLASHFVQTCKKALD---------VVRAYPA--FQVLP---------- 248

Query: 303 DNLMELIYEFIEIKLHDDIWGRISFKFTESDF----DFSKLSNISVNKLLLNFYSTNNFK 358
            NL   ++E+IE+ L+DD W +++    +S+     D+S L +ISV+++    Y +N  K
Sbjct: 249 -NLPICVHEYIELNLYDDYWAQLTNSLRDSEIESSSDYSLLKHISVSQVPSFLYPSNPEK 307

Query: 359 NFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALIKTLQILTINKLTD-------AD 411
            F L  I   EK +  AV  F+K         K+  +I+TLQ L+ + L D       AD
Sbjct: 308 -FDLRLITQAEKNVKGAVESFRKIAVTNCHSAKAKVIIETLQTLSRSLLVDDRAVTIDAD 366

Query: 412 TLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHISHS 471
           TL+ L  +V+C  +V++L+SHLFYLQ F  D N + FGIL Y +STLEA+  YF+  S  
Sbjct: 367 TLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDTNLVTFGILAYGMSTLEAVLCYFE--SPE 424

Query: 472 HKADLIAFCDKLHNLYDTILNNIKSLD-------NDILSYRSQNGESLLSLCIINNKMDI 524
             A L  +C    + + +I      L+       +D+L  R+ +G+S L++C+ + + + 
Sbjct: 425 KVASLEKYCRANLSHWKSISEGSIDLNADTTVPLDDLLKIRTSDGQSCLAVCLQHRRTEE 484

Query: 525 FLELLTTYEHSFPIEXXXXXXXXXXXXXXMQACKYNNYVASEILVTILKNSCNEEELRIF 584
           F  +  T E  FP+E              +   +      + +L+  L ++C ++EL  F
Sbjct: 485 FELIKNTREAWFPLEDLLHDETTDGSNLLIHMLESGCDRLAVMLINTLISNCTKDELIAF 544

Query: 585 LNKTDKFNRSVAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVHKVNYNESFI 644
           LN T+K+ RS  HY      ++ L   G++++WE +D    TPL  I + +        +
Sbjct: 545 LNHTNKYQRSCGHYLMHAPQLIDLV--GDILNWEQRDCNGHTPLFAIVRAYDRPDYFDMV 602

Query: 645 KILFRVVLTWYKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETININANNNK 704
              +R  +   K+ N  F +  H D  GN LLHV+K  ++ L+ +P     I++NA N K
Sbjct: 603 SAAYRAAVGQSKVRNSRFRVSNHTDDKGNTLLHVIKSDVSILLADP----FIDVNATNAK 658

Query: 705 GLSPFMVYFKTNRYDNIRIILKNPTLITSEGQ 736
           GL+P MVY + NR  N+R IL++  LI  + Q
Sbjct: 659 GLTPLMVYVRYNRIGNVRTILQDQRLIIGKHQ 690

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 115/251 (45%), Gaps = 26/251 (10%)

Query: 936  TELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKN 995
            T+  K  +PE++ +IQ+ +KFNL E+   K  +  +K +++    K  DL+ +   F   
Sbjct: 845  TQNMKMMEPEEVRSIQSILKFNLSEISALKTAMLLMKKLAVFEGLKGKDLSEACMTFGAK 904

Query: 996  TLKIGINNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVC 1055
               +    +     + + Q P              N +D++    N  L  L     L+C
Sbjct: 905  CKYVTQGKIQSFDHFLNVQAP--------------NLFDFEGIANNIALCELC--SSLLC 948

Query: 1056 KLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPNR-KIDINNNFESFNTMFDKRVNF 1114
            K       + N  I  WW+ YG LL    +Y K +P+  +  ++ N   F +  + +   
Sbjct: 949  K---HIGQVLNDDIPKWWHTYGELLSLRREYKKSFPDANRPHVSENSGLFGSYIETKR-- 1003

Query: 1115 DSITHFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIKFSTI 1174
               T  E++    I +TS  L   + KI   +E LA+ELNNF+NFKN+F++  I + +  
Sbjct: 1004 ---TKLEQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFLKSAIKEHADT 1060

Query: 1175 EVIKILKDNII 1185
              IK L++ ++
Sbjct: 1061 N-IKRLREQLV 1070

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
           YML002W
          Length = 1131

 Score =  265 bits (678), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 230/777 (29%), Positives = 366/777 (47%), Gaps = 122/777 (15%)

Query: 4   DILNPLIEVLFHSEGTDTLNGPXXXXXXXXXXXXXXXXAPPTDILLNYLDSSNITPRNPY 63
           ++LNPL++ +F+ +  D    P                 PPT  L  Y D          
Sbjct: 3   ELLNPLVDAVFNCQ--DVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDR--------- 51

Query: 64  NGSNAK-PLEDLCMNSYDFIASHILLY----DSKVIKNDQCVMESINGKTITIKRVTGNG 118
              N K PL +LC +S +F++SHIL      D+K I  D   + ++       K  T NG
Sbjct: 52  ---NTKFPLHELC-HSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVR----EAKFCTFNG 103

Query: 119 ALNNG----EMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPN 174
            + NG    + L  T   ++ + +++LK   +D   +F +YLQG   + + YID PL   
Sbjct: 104 KIINGLFSKQSLYTTDGFSFRSTRRILKYETLD---HFQNYLQGSSTFILIYIDQPL--- 157

Query: 175 IIKNEFLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFT 234
           I  N  L   D               ++   N T +     R+++ L        R    
Sbjct: 158 IDTNRLLKCED---------------LDCFPNLTINTTPSTRSLANLSSAEVPPQRNPLL 202

Query: 235 KLIKDDRVIW--QPLINSYRATTKHIEQAE-----GLPQAIDENQTDVNIEMVRDINCDL 287
             +   +  W  + +  +YR   K I Q+E     G  + ID+                +
Sbjct: 203 NSMIHAQYNWKFRAVFQNYR---KEITQSESMLIPGFRKTIDK----------------I 243

Query: 288 FEQLKDEKRYNFLSHDNLMELIYEFIEIKLHDDIW----------GRISFKFTESD-FDF 336
           ++ L +    +F +   + +LI E++E  ++DD+W          G    +   SD F F
Sbjct: 244 YDGLDN----SFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESSDIFRF 299

Query: 337 SKLSNISVNKLLLNFYSTNNFKNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALI 396
                IS+++L  +FY    F  F L DIV +EK IS+A   F+      T+ EK   L+
Sbjct: 300 -----ISLDQLDTDFYKA-KFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLV 353

Query: 397 KTLQILT--INKLTD------ADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKF 448
           +TLQIL+  + ++        ADTL+ L  ++I R K++N++ HL+YLQNF  D N+IKF
Sbjct: 354 ETLQILSKPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKF 413

Query: 449 GILGYSISTLEAITYYFDHI-SHSHKADLIAFCDKLHNLYDTILNNIKSLDNDILS---- 503
           G+LGY+ISTLEA+  Y + I +   + D I   D     + T+L   K + N+ L     
Sbjct: 414 GLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSNEGLDLSKY 473

Query: 504 -----YRSQNGESLLSLCIINNKMDIFLELLTT-YEHSFPIEXXXXXXXXXXXXXXMQAC 557
                YR+ +G S LSLCIIN K DIF ELL+  YE  F  E              MQ+ 
Sbjct: 474 SHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQSL 533

Query: 558 KYNNYVASEILVTILKNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDW 617
           +++N+  +E L  I+  +  EEEL  +  K DK+ R++ HY   + +  +L + G  I W
Sbjct: 534 QHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQT--LLQKIGKYIKW 591

Query: 618 ELKDIKKLTPLLTIFKVHKVNYNESFIKILFRVVLTWYK-IHNKPFNLKAHVDQNGNNLL 676
           + KD    TPL  IF+ +   + +  ++  F + + WY  + N  F  + H D  GN LL
Sbjct: 592 DSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLL 651

Query: 677 HVMKDYINCLIENPELCETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITS 733
           H++K  I+ L+++P+    ++IN  N++GLSP       +R +N+  +LK+P LI S
Sbjct: 652 HIIKCNISFLLQSPD----VDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLIFS 704

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/248 (25%), Positives = 100/248 (40%), Gaps = 39/248 (15%)

Query: 940  KAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKI 999
            K  QPE I  I TF+K+ L  L   K TI  ++  SIL K K  D++ S+        ++
Sbjct: 871  KKMQPESIGTITTFLKYILESLLKLKGTIIELRKFSILSKLKSKDISESKNIVCTLGAEV 930

Query: 1000 GINNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYY 1059
                +   +  YST    I N     KF    S+D        L+  + FFE  +  +  
Sbjct: 931  SSKKIGRAMVRYST----IDN-----KFLGEQSFDL-------LVFQIHFFESCLSSIIN 974

Query: 1060 DFEDLSNGTIKTWWYHYGRLLDYEAQ---------YNKHYPNRKIDINNNFESFNTMFDK 1110
              + L +  I  WW  YG+LL+   +          +K  PN     +NN  +  T  D 
Sbjct: 975  SIDHLLHLKIPEWWKCYGQLLELSKEDPSVLARESDHKQTPN----ASNNVGTSTT--DH 1028

Query: 1111 RVNFDSITHF-ERNIILNIKNTSTLLRRFNNKIKFLHENL-------AIELNNFMNFKNK 1162
                  +  F E   I N + T   +     ++K L   +        IE   F+NF++K
Sbjct: 1029 TSGMGVLGTFIEGKRIKNQERTRAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSK 1088

Query: 1163 FIREYIIK 1170
            FI   +++
Sbjct: 1089 FIHSAMLE 1096

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]
           {ON} some similarities with uniprot|Q04257 Saccharomyces
           cerevisiae YML002w and some similarities with
           uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  246 bits (628), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 222/792 (28%), Positives = 365/792 (46%), Gaps = 103/792 (13%)

Query: 42  APPTDILLNYLDSSNITPRNPYNGSNAKPLEDLCMNSYDFIASHILLYDS---KVIKNDQ 98
            PPT++LL Y D            SN++ L DLC    +F ++HILL D+   +V   D+
Sbjct: 48  VPPTELLLYYSDKE----------SNSE-LHDLCYTP-NFASAHILLLDATDTEVNNGDE 95

Query: 99  CVM-ESINGKTIT--IKRVTGNGALNNGEMLVITP-SKNYNTPKKMLKIIKMDLWHNFNS 154
            V+ ++I  +     IK +  +    N +  VI   +K  +  K   KI+ ++    FN+
Sbjct: 96  AVLIKNIEKRYDVHFIKAMDQSWKFINWKNRVIYEFNKLGDQIKNRAKILDIESIPIFNN 155

Query: 155 YLQGMEN-YPIWYIDYPLYPNIIKNEFLTAFD-------RKLIETEQYSDIAQPVNDLEN 206
           Y++  +N   I YID       ++    +  D       R +   ++ S I +   D EN
Sbjct: 156 YMKTTDNTITIMYIDDVFLNGTLECNLRSDIDLLRSPSMRSIPTAKRPSLINKKSTDYEN 215

Query: 207 TTKDQNHKIRNISKLEPDISQSDRGGFTKLIKDDRVIWQPLINSYRATTKHIEQAEGLPQ 266
           +                      +  F  +++ ++  W      +    + +   + LP 
Sbjct: 216 S--------------------KSKATFDSILRVNKH-WSSKFEQHFQKFRLLANQDDLPI 254

Query: 267 AIDENQ-TDVNIEMVRDINCDLFEQLKDEKRYNFLSHDNLMELIYEFIEIKLHDDIWGRI 325
            +  N   +++ EMV D   +LF+ + D           L  +IYE++E+ L DDIW  I
Sbjct: 255 DVFHNIIEEMHEEMVSD---NLFKNIVD-----------LRNIIYEYVELNLFDDIWKMI 300

Query: 326 SFKFTESDFDFSKLSNISVNKLLLNFYSTNNFKNFKLHDIVMMEKKISRAVTYFQKFING 385
                E + D +   NIS+ ++   F ST  +  F L +++  E+ I  A    QK  + 
Sbjct: 301 LRMNKEVEIDLNPFGNISIYQVDSEFLSTE-YSKFFLENVITAERNIKEASKSLQKIESA 359

Query: 386 ITFQEKSTALIKTLQILTINK-------------------LTDADTLIGLLSIVICRLKV 426
             ++ K+  LI TL+ LT NK                     DAD L+ L  +V CR ++
Sbjct: 360 SNYKSKANILILTLRTLTGNKENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQI 419

Query: 427 RNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHISHSHK-ADLIAFCDKLHN 485
           +NLK HL YLQNF  + +  KFGILGY++STLEA+  YF+ +        LI FC+    
Sbjct: 420 KNLKCHLSYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNER 479

Query: 486 LYDTILNNIKSLDNDI-----------LSYRSQNGESLLSLCIINNKMDIFLELLTTYEH 534
           L   +L++ K  + +            L YR   G+SLL+LCII+ + D    +L  YE 
Sbjct: 480 LV-KVLSSTKKYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNEYET 538

Query: 535 SFPIEXXXXXXXXXXXXXXMQACKYNNYVASEILVTILKNSCNEEELRIFLNKTDKFNRS 594
            FPIE              +QA K++N  ++ +L+ ILK++C E EL  ++N+ D   R+
Sbjct: 539 LFPIEDLLADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRT 598

Query: 595 VAHYFNMKNSILILTEFGNLIDWELKDIKKLTPLLTIFKVHKVNYNESFIKILFRVVLTW 654
             H+  + N + +L   G  I+W  KD    TPL TIF+ +  +  +  +         W
Sbjct: 599 AGHF--LTNELEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNW 656

Query: 655 YKIHNKPFNLKAHVDQNGNNLLHVMKDYINCLIENPELCETININANNNKGLSPFMVYFK 714
           Y ++ K FN   HVD+ GN LLH++K  +  L+ +      IN+NA N  G +P M   +
Sbjct: 657 YGLNGKNFNYLDHVDKKGNTLLHILKCNLPILLADKH----INVNATNRSGQTPLMTSIR 712

Query: 715 TNRYDNIRIILKNPTLITSEGQLPFLITSTNLY-NSKVNHLLATHFLRTLDFAYICLHSL 773
             R +NIR +L +P L     Q    +T+ +   + ++ HLL  H L    +  +  H+L
Sbjct: 713 YKRTENIRDLLCDPRLRVDITQKNNALTAFDFSKDDEITHLLGEHELLNSPWLAVYAHTL 772

Query: 774 RFNDPSSSTSGT 785
           ++ +   + S T
Sbjct: 773 KYTNSRWNLSLT 784

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 101/238 (42%), Gaps = 20/238 (8%)

Query: 933  DQTTELSKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFF 992
            D+ T  +    PEDI+ IQ F+KFN+ E+E  KN +   + +S+  + K  DL +S   +
Sbjct: 884  DKKTNQTSDITPEDISMIQNFLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENY 943

Query: 993  QKNTLKIGINNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEK 1052
                 ++        LKY +    L++                 V     LL  + + + 
Sbjct: 944  VTIVSQLSSKRFRSTLKYSAEDTKLLS-----------------VRAEKALLSKITYLKI 986

Query: 1053 LVCKLYYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPNRKIDINNNFESFNTMFDKRV 1112
               KL+     ++   I  WW+ YG LL+    Y + +P      N   E+ +    + +
Sbjct: 987  CAQKLHNHILSITTTMISNWWHIYGELLNAHKHYTRAFPELA---NVTTENRDLALHRMI 1043

Query: 1113 NFDSITHFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIK 1170
            +       E  +   IK+ +  L    + IK +HE  A E++ F++ K KF  EY ++
Sbjct: 1044 SNPKRIKLEERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSRFIDLKTKFTLEYALQ 1101

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
           YML002W
          Length = 942

 Score =  166 bits (420), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 139/420 (33%), Positives = 215/420 (51%), Gaps = 32/420 (7%)

Query: 314 EIKLHDDIWGRISFKFTE-SDFDFSKLSNISVNKLLLNFYSTNNFKNFKLHDIVMMEKKI 372
           E +L+  IW ++  + +E  + D      IS ++L +N Y +  F  F L D+V +E  +
Sbjct: 179 EARLYSSIWNKLVHQTSEPQNIDKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVV 238

Query: 373 SRAVTYFQKFINGITFQEKSTALIKTLQILTINKL----TDADTLIGLLSIVICRLKVRN 428
             A   F K    ++F EK   L+ T  ILT +KL     DAD L+  + I+I R+K+ N
Sbjct: 239 DLACKEFVKLRESLSFDEKIDILLSTFNILT-SKLPQLEIDADNLLNFMLIIINRVKLNN 297

Query: 429 LKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHISHSHKADLIAFCDKLHNLYD 488
           L  H  YLQNF    N   FGIL Y+ISTL A+ YY D+             DK     D
Sbjct: 298 LNEHFHYLQNFNFKQNK-DFGILNYAISTLGAVLYYIDN-----------NLDKFKRYTD 345

Query: 489 TILNNIKSLDNDILSYRSQNGESLLSLCIINNKMDIFLELLTTYEH--SFPIEXXXXXXX 546
            I ++   +  + L YR++NGES L  CII    D   ELL + E+  +FP+E       
Sbjct: 346 AIQDS--KISEEKLKYRNENGESYLCHCIITKDNDTLRELLFSSEYIKNFPMEDILDDQT 403

Query: 547 XXXXXXXMQACKYNNYVASEILVTILKNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSIL 606
                  M A K  N  A+ IL+ I+ N+   +E+R ++N  D+ NR+V H+  + N   
Sbjct: 404 IDGSTLLMVAVKCLNTTAASILINIIINNGTPDEIRTYVNSVDENNRNVGHF--ITNQYY 461

Query: 607 ILTEFGNLIDWELKDIK-KLTPLLTIFKVHKVNYNESFIKILFRVVLTWYKIHNKPFNLK 665
           +L + G  ++W  KD +   TPL  IF+ +  +  +S+ K+  R     + + +  F LK
Sbjct: 462 LLCKIGPYLNWNCKDKRTGQTPLFNIFRSYDQSI-KSYKKMSRRSFR--FAMDSGDFQLK 518

Query: 666 AHVDQNGNNLLHVMKDYINCLIENPELCETININANNNKGLSPFMVYFKTNRYDNIRIIL 725
            H+D + N LLH++K  I  ++ +  L     IN+ N+ G++P MV+ K  R  NI+I+L
Sbjct: 519 KHIDNSNNTLLHILKTNIQMILPHASLF----INSPNSLGMTPLMVFCKYRRLYNIQILL 574

 Score = 39.7 bits (91), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 90/235 (38%), Gaps = 51/235 (21%)

Query: 939  SKAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQF-FFQKNTL 997
            SK  Q EDIN I  F+KFNL EL  FKN +  I      I  K+ D   S         +
Sbjct: 753  SKKLQIEDINMISNFLKFNLNELNAFKNGVKKILRQMNSINLKLFDQRISYMDLLHCPDV 812

Query: 998  KIGINNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKL 1057
             + +NN            PL           +YN      + L   ++N + F K+    
Sbjct: 813  VVHLNN------------PLWN--------LNYNILISNFQILENSIDNTLHFLKV---- 848

Query: 1058 YYDFEDLSNGTIKTWWYHYGRLLDYEAQYNKHYPNRKIDINNNFESFNTMFDKRVNFDSI 1117
                    N  I+ WW     L++            K+  N++ +   + F+++      
Sbjct: 849  ------FQNEKIRKWWKLNNELINLT----------KLASNSDDDLLRSFFNRK------ 886

Query: 1118 THFERNIILNIKNTSTLLRRFNNKIKFLHENLAIELNNFMNFKNKFIREYIIKFS 1172
                  + + I +    +   N  I   HE LA+E+NNFM FK  FI   ++ ++
Sbjct: 887  ----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKFKPLFITRTLVVWA 937

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score = 75.5 bits (184), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 82/342 (23%), Positives = 140/342 (40%), Gaps = 71/342 (20%)

Query: 5   ILNPLIEVLFHSEGTDTLNGPXXXXXXXXXXXXXXXXAPPTDILLNYLDSSNITPRNPYN 64
           +LNPL+  +F+    +    P                APP++ LLNY D  +        
Sbjct: 9   LLNPLVNAIFNCPEPE--RSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKS-------- 58

Query: 65  GSNAKPLEDLCMNSYDFIASHILLYDSKVIKNDQCV---MESINGKTITIKRVTGNGALN 121
                PL DLC N+ +FI S+ILL       N        E+++GKT+ I+         
Sbjct: 59  ---KLPLHDLCYNA-EFINSYILLMTENSYINTNSRDSHYETLDGKTVVIQWKNNVIHAL 114

Query: 122 NGEMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEFL 181
           NG  +           ++ LKI++  +  NFN Y +G  ++ I +ID PL    + N++L
Sbjct: 115 NGFHI-----------RRRLKILETKILPNFNDYFEGAADFIILFIDQPLNCEFVPNDYL 163

Query: 182 TAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIR----NISKLEPDISQSDRGGFTKLI 237
             F         Y  I +  + + N + D   + R    NI  + P          T+L 
Sbjct: 164 QCF-------HNYEKIPKNAHAMPNLSIDSFQQERSSFENILHIHP-------ARLTQLG 209

Query: 238 KDDRVIWQPLINSYRATTKHIEQAEGLPQAIDENQTDVNIEMVRDINCDLFEQLKDEKRY 297
           +        L +SYR      + +  + ++I +                 F+ +K +  +
Sbjct: 210 Q--------LFSSYRTLAPGDDPSRSIFESIVQQA---------------FDGMKSDSLF 246

Query: 298 NFLSHDNLMELIYEFIEIKLHDDIWGRISFKFTESDFDFSKL 339
              S  NL +LI+++ E+ L+DDIW R++  F   + D  K+
Sbjct: 247 KNFS--NLYDLIHDYFELNLYDDIWSRLTTHFKGHEVDTEKI 286

>CAGL0C01309g Chr3 (136270..139602) [3333 bp, 1110 aa] {ON} similar
           to uniprot|P40480 Saccharomyces cerevisiae YIL112w
          Length = 1110

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 698 INANNNKGLSPFMVYFKTNRYDNIRIILK---NPTLITSEGQLPFLITSTNLYNS 749
           IN  N +G++P M+    N    ++++L+   NPTL  ++GQ     +  N++NS
Sbjct: 598 INKFNKEGMTPLMIAVGRNHLGTVKLLLEAGANPTLKDNKGQTAIYHSKHNIFNS 652

>KNAG0A01560 Chr1 (74485..77964) [3480 bp, 1159 aa] {ON} Anc_5.96
           YGR233C
          Length = 1159

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 63/144 (43%), Gaps = 22/144 (15%)

Query: 494 IKSLDNDILSYRSQNGESLLSLCIINNKMDIFLELLTTYEHSFPIEXXXXXXXXXXXXXX 553
           I +LDND          + L L IINN  DI +E L    H+   E              
Sbjct: 423 IDALDND--------SRTPLVLAIINNHNDI-VEALLMQGHA---ELWPNMNGNLQFSPL 470

Query: 554 MQACKYNNYVASEILVTILKNSCNEEELRIFLNKTDKFNRS----VAHYFNMKNSILILT 609
           + AC+YNNY A++I++ +    CNE  ++ F +  D         VA Y    + I +L 
Sbjct: 471 LTACRYNNYGATKIILRL----CNERGIQ-FNSVQDSHGLGALHLVAKYGGDPSLIDLLI 525

Query: 610 EFGNLIDWELKDIKKLTPLLTIFK 633
           E+G   + EL  +  L P++   K
Sbjct: 526 EYGADPN-ELDSLDNLPPIVYAIK 548

>TPHA0J01770 Chr10 complement(407330..409270) [1941 bp, 646 aa] {ON}
           Anc_6.112 YGL060W
          Length = 646

 Score = 33.1 bits (74), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 483 LHNLYDTILNNIKSLDNDILSYRSQNGE 510
           LHN ++TI NN K L NDI ++ S NGE
Sbjct: 311 LHNQFETIKNNSKELYNDITNFESPNGE 338

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score = 32.7 bits (73), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 32/57 (56%)

Query: 139 KMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPNIIKNEFLTAFDRKLIETEQYS 195
           +M K+++   + +F S  QG+ N    +  Y   PN++ N  L  F++K+ +T +Y+
Sbjct: 171 QMGKLLQQGNYLDFQSMYQGLLNRHKLFPSYRYVPNVLSNMTLIVFEQKMYDTLRYT 227

>SAKL0D13002g Chr4 complement(1088057..1089217) [1161 bp, 386 aa]
           {ON} highly similar to uniprot|P47122 Saccharomyces
           cerevisiae YJR072C NPA3 Cytoplasmic protein required for
           cell viability identified by association with pre-
           ribosomal particles
          Length = 386

 Score = 32.3 bits (72), Expect = 7.5,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 31/63 (49%)

Query: 178 NEFLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFTKLI 237
           +EFL A D+K+ E E+Y  + +     E   K++  K  ++  L  D+   D+ G     
Sbjct: 246 DEFLVAVDKKVDEYEKYYKVERERILKEKEQKEKARKDESLEHLIKDLGIKDKSGTENES 305

Query: 238 KDD 240
           KDD
Sbjct: 306 KDD 308

>NCAS0A09520 Chr1 complement(1895860..1897635) [1776 bp, 591 aa]
           {ON} Anc_1.266 YJL100W
          Length = 591

 Score = 32.3 bits (72), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 31/71 (43%)

Query: 427 RNLKSHLFYLQNFAADPNTIKFGILGYSISTLEAITYYFDHISHSHKADLIAFCDKLHNL 486
           R L SH   L  F  D NTIK  +    +S    +T Y      + K++   F   + + 
Sbjct: 46  RTLSSHSLPLSIFTEDANTIKTEVYDIQLSVFRPVTGYPSRPLKNPKSEEAEFLAIVQHC 105

Query: 487 YDTILNNIKSL 497
            ++I  N+K L
Sbjct: 106 RNSINRNVKEL 116

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 134,912,615
Number of extensions: 6559809
Number of successful extensions: 23595
Number of sequences better than 10.0: 113
Number of HSP's gapped: 24285
Number of HSP's successfully gapped: 139
Length of query: 1204
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1083
Effective length of database: 39,606,813
Effective search space: 42894178479
Effective search space used: 42894178479
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 72 (32.3 bits)