Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A072506.19ON30430415150.0
Kpol_1037.246.19ON3663338351e-110
TPHA0J003206.19ON3422818321e-110
Skud_15.1676.19ON3123148131e-108
NCAS0H008106.19ON3232767941e-105
Suva_15.1816.19ON3363277911e-104
KLLA0D01111g6.19ON3142537851e-103
KNAG0M011506.19ON3072607851e-103
ACR007W6.19ON3132787811e-103
YOR006C (TSR3)6.19ON3133277801e-103
Smik_15.1756.19ON3123147791e-103
KAFR0L003906.19ON3292837691e-101
CAGL0E02717g6.19ON3252447631e-100
KLTH0C11264g6.19ON3462727611e-99
NDAI0D007906.19ON4012947601e-98
ZYRO0C07832g6.19ON2812427402e-97
Kwal_56.224216.19ON3372817437e-97
TDEL0G045006.19ON3012487381e-96
SAKL0E01144g6.19ON4302067456e-96
Ecym_30236.19ON3492417333e-95
KLTH0H10736g1.317ON810114721.8
TBLA0D056501.224ON97552694.1
KNAG0C058301.317ON830122676.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07250
         (304 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   588   0.0  
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   326   e-110
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   325   e-110
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   317   e-108
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   310   e-105
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   309   e-104
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   306   e-103
KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   306   e-103
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   305   e-103
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   305   e-103
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   304   e-103
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   300   e-101
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   298   e-100
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   297   1e-99
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   297   1e-98
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   289   2e-97
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   290   7e-97
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   288   1e-96
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   291   6e-96
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   286   3e-95
KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {...    32   1.8  
TBLA0D05650 Chr4 (1384163..1387090) [2928 bp, 975 aa] {ON} Anc_1...    31   4.1  
KNAG0C05830 Chr3 (1132645..1135137) [2493 bp, 830 aa] {ON} Anc_1...    30   6.5  

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/304 (94%), Positives = 287/304 (94%)

Query: 1   MAKGKNKGHXXXXXXXXXXXXXXXXXHSLSIKSTKTNFPVKLAMWDFDHCDPKRCSGKKL 60
           MAKGKNKGH                 HSLSIKSTKTNFPVKLAMWDFDHCDPKRCSGKKL
Sbjct: 1   MAKGKNKGHEERSNRKSNNSRRNESKHSLSIKSTKTNFPVKLAMWDFDHCDPKRCSGKKL 60

Query: 61  ERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEVPFNKLG 120
           ERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEVPFNKLG
Sbjct: 61  ERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEVPFNKLG 120

Query: 121 GKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSWGHAFLE 180
           GKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSWGHAFLE
Sbjct: 121 GKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSWGHAFLE 180

Query: 181 LNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNRKNLNDFD 240
           LNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNRKNLNDFD
Sbjct: 181 LNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNRKNLNDFD 240

Query: 241 NSSESTEDNISTVSSADERYDALGNLISNDSHSLKYDSLGNVIESEGDALPPKYDKLGNI 300
           NSSESTEDNISTVSSADERYDALGNLISNDSHSLKYDSLGNVIESEGDALPPKYDKLGNI
Sbjct: 241 NSSESTEDNISTVSSADERYDALGNLISNDSHSLKYDSLGNVIESEGDALPPKYDKLGNI 300

Query: 301 IEDN 304
           IEDN
Sbjct: 301 IEDN 304

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  326 bits (835), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 176/333 (52%), Positives = 218/333 (65%), Gaps = 35/333 (10%)

Query: 1   MAKGKNKGHXXXX---XXXXXXXXXXXXXHSLSIKSTKTN------FPVKLAMWDFDHCD 51
           MAKGKNK H                      + +K    N      FPVKLAMWDFDHCD
Sbjct: 1   MAKGKNKQHEARTGKPSRGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60

Query: 52  PKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARL 111
           PKRCSGK+LER GL +SLRVGQ+F G+VVSPNGK V+ P DRE +E++G +VVECSWARL
Sbjct: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120

Query: 112 DEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEG 171
           DEVPFNK+GGK  +E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  ++A+++L  
Sbjct: 121 DEVPFNKIGGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSN 178

Query: 172 FSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNT 231
           FSWG  FLE+N+ELL IY  CTDS SV+KA++EWL KIE E +ERK +   +D W++GNT
Sbjct: 179 FSWGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNT 238

Query: 232 NRKNLNDFDNSSE-------STEDNISTVSSADERYDALGNLISNDSH-----------S 273
           NR N+N  D+  E       S +D     ++   RYD LGN+I ++              
Sbjct: 239 NR-NMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNIIESEEDYDDYDDEEDRVE 297

Query: 274 LKYDSLGNVIESEG-----DALPPKYDKLGNII 301
           +KYDSLGN+IE+       +    +YD LGN+I
Sbjct: 298 VKYDSLGNIIENSDYEQYEEEKELRYDSLGNLI 330

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  325 bits (832), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 171/281 (60%), Positives = 211/281 (75%), Gaps = 18/281 (6%)

Query: 33  STKTNFPVKLAMWDFDHCDPKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPAD 92
           S +  FPVKLAMWDFDHCDPKRCSGKKLER GL +SLRVGQ+F G+VVSPNGK VV P D
Sbjct: 45  SKEAGFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDD 104

Query: 93  RETIEQYGIAVVECSWARLDEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAF 152
           +ET+E++G +VVECSWARLDEVPFNK+GGK  +E LLPYLVAAN VNYGRPWRLNCVEA 
Sbjct: 105 KETVEEFGASVVECSWARLDEVPFNKIGGK--HERLLPYLVAANQVNYGRPWRLNCVEAL 162

Query: 153 AACLAIVGFKEYASKVLEGFSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELE 212
           AAC AIVG  + A+++LE FSWG  FLELN ELL++Y  CTDS SV+K ++EWLEKI+ E
Sbjct: 163 AACFAIVGRVDLAAELLEHFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKE 222

Query: 213 NKERKEKMNSADAWLIGNTNR--KNLND---FDNSSESTEDNISTVSSADERYDALGNLI 267
            +ERK +    D WL GNTNR  ++++D   FD+    +E+N    +    RYD LGN++
Sbjct: 223 VQERKSQSREGDIWLQGNTNRDLQDMSDDEEFDSEQYYSEEN----TERKIRYDNLGNVL 278

Query: 268 -------SNDSHSLKYDSLGNVIESEGDALPPKYDKLGNII 301
                  S +   ++YD+LGN+IESE +A   KYD LGN+I
Sbjct: 279 ISEEENESEEEEEVRYDALGNIIESEEEAAELKYDSLGNLI 319

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  317 bits (813), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 171/314 (54%), Positives = 203/314 (64%), Gaps = 15/314 (4%)

Query: 1   MAKGKNKGHXXXXXXXXXXXXXXXXXHSLSI------KSTKTNFPVKLAMWDFDHCDPKR 54
           M KGKNK H                  +         KS K  FPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKTHEPKNERQQRGANGHSARQNHKHMEMKYDKSEKMKFPVKLAMWDFDHCDPKR 60

Query: 55  CSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEV 114
           CSGKKLER GL +SLRVGQ+F G+VVSPNG+ VV P D E +EQ+G +VVECSWARL+EV
Sbjct: 61  CSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEEV 120

Query: 115 PFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSW 174
           PFNK+GGK   E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  ++AS++L  FSW
Sbjct: 121 PFNKIGGK--YERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSW 178

Query: 175 GHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNRK 234
           G  FL+LN ELL+IY  CTD+ SV+KA+ EWLEK+E+E +ERK      D W++GN NR+
Sbjct: 179 GLGFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNINRR 238

Query: 235 NLNDFDNSSESTEDNISTVSSADER---YDALGNLISNDSHSLKYDSLGNVIESEGD--- 288
                 +  ES ED+  +     E+   YDALGN I  DS   +    G   + E D   
Sbjct: 239 GNGVQSDELESGEDSEQSGLENSEQPIEYDALGNAIHVDSVKSRIMLSGVSEDEESDFGE 298

Query: 289 -ALPPKYDKLGNII 301
              P  YD LGN+I
Sbjct: 299 NEKPVNYDSLGNLI 312

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  310 bits (794), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 157/276 (56%), Positives = 198/276 (71%), Gaps = 12/276 (4%)

Query: 38  FPVKLAMWDFDHCDPKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIE 97
            PVKL MWDFDHCDPKRCSGKKLER GL +SL++GQRF G+++SPNGK+VVSP D + I+
Sbjct: 50  IPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIK 109

Query: 98  QYGIAVVECSWARLDEVPFNKLGGK--PSNEVLLPYLVAANPVNYGRPWRLNCVEAFAAC 155
           ++G AVVECSWARLDE+PF+KL G     NE LLPYLVAAN VNYGRPW+LNCVEA AAC
Sbjct: 110 EFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAAC 169

Query: 156 LAIVGFKEYASKVLEGFSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKE 215
            AI+G  ++A+ +L  FSWG  FL LN+EL ++Y  CTDS S+++AQ+ WL KI+ E KE
Sbjct: 170 FAIIGRSDWAADLLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKE 229

Query: 216 RKEKMNSADAWLIGNTNR--KNLNDFDNSSESTEDNIST----VSSADERYDALGNLI-- 267
           RK +    D WL+GNTNR   NL D   S    ++        ++    +YD LGN+I  
Sbjct: 230 RKLQAQDNDIWLMGNTNRVNDNLRDLTLSDGDEDEEEEDAEDYLTEKSVKYDNLGNVIES 289

Query: 268 SNDSHSLKYDSLGNVIESEGDALPPKYDKLGNIIED 303
           S D  +L+YD+LGNVIE E      +YD LGN+IE+
Sbjct: 290 SEDEITLRYDNLGNVIEEE--EEEKRYDALGNLIEN 323

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  309 bits (791), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 172/327 (52%), Positives = 207/327 (63%), Gaps = 41/327 (12%)

Query: 1   MAKGKNKGHXXXXXXXXXXXXXXXXXHS---LSIK---STKTNFPVKLAMWDFDHCDPKR 54
           M KGKNK H                  +   + +K   S  TNFPVKLAMWDFDHCDPKR
Sbjct: 25  MGKGKNKTHEPKNGRPQRGANGHSSRQNHKRMEMKYDNSEMTNFPVKLAMWDFDHCDPKR 84

Query: 55  CSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEV 114
           CSGKKLER GL +SLRVGQ+F G+VVSPNG  VV P D E +EQ+G +VVECSWARL+EV
Sbjct: 85  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEEV 144

Query: 115 PFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSW 174
           PFNK+GGK  +E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  ++AS +L  FSW
Sbjct: 145 PFNKIGGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSW 202

Query: 175 GHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNRK 234
           G  FL+LN ELL+IY  CTDS SV+KA++EWL+K+E E +ERK +    D W++GN NRK
Sbjct: 203 GLGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRK 262

Query: 235 NLNDFDNSSESTEDNISTVSSADERYDALGNLISNDSHSLKYDSLGNVI----------- 283
                        DN +    ++   D+  + + +D  S++YDSLGN I           
Sbjct: 263 -------------DNGAQSDESESEEDSDQSELESDKQSIEYDSLGNAICIDNVKSRKML 309

Query: 284 ---------ESEGDALPPKYDKLGNII 301
                    E E D  P  YD LGNII
Sbjct: 310 SEGSEDEESEFEEDEEPVSYDSLGNII 336

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  306 bits (785), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 155/253 (61%), Positives = 181/253 (71%), Gaps = 14/253 (5%)

Query: 31  IKSTKTNFPVKLAMWDFDHCDPKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSP 90
           + ST + FPVKLAMWDFDHCDPKRCSGKKLER GL +SLRVGQ+F G+VVSPNGK VV P
Sbjct: 36  VDSTTSKFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCP 95

Query: 91  ADRETIEQYGIAVVECSWARLDEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVE 150
            D+  +E+ G +VVECSWARLDEVPFNK+GGK  NE LLPYLVAAN VNYGRPWRLNCVE
Sbjct: 96  DDKALVEENGASVVECSWARLDEVPFNKIGGK--NERLLPYLVAANQVNYGRPWRLNCVE 153

Query: 151 AFAACLAIVGFKEYASKVLEGFSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIE 210
           A AAC AIVG  + A+ +L  FSWG AFLELN ELLDIY  CTD  SV+ A+++WL+KIE
Sbjct: 154 ALAACFAIVGRTDLAADLLSNFSWGPAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIE 213

Query: 211 LENKERKEKMNSADAWLIGNTNRKNLNDFDNSSESTEDNISTVSSADERYDALGNLISND 270
            E  ERK++  + D W+IGN NR               ++   S  +E  D L      D
Sbjct: 214 QEAIERKQQAKTEDIWMIGNVNR------------ASRDLPGSSGEEEEEDYLNGDSLID 261

Query: 271 SHSLKYDSLGNVI 283
              +KYDSLGNVI
Sbjct: 262 VRDIKYDSLGNVI 274

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  306 bits (785), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 154/260 (59%), Positives = 189/260 (72%), Gaps = 12/260 (4%)

Query: 36  TNFPVKLAMWDFDHCDPKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRET 95
           T FPVK+AMWDFDHCDPKRCSGKKLER GL  SL+VGQ+F G+VVSPNG+ VV P DR  
Sbjct: 46  TKFPVKMAMWDFDHCDPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAI 105

Query: 96  IEQYGIAVVECSWARLDEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAAC 155
           +E++G +VVECSWARLDEVPFN++GGK  +E LLPYLVAAN VNYGRPWRLNCVEA AAC
Sbjct: 106 VEEFGASVVECSWARLDEVPFNRIGGK--HERLLPYLVAANQVNYGRPWRLNCVEALAAC 163

Query: 156 LAIVGFKEYASKVLEGFSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKE 215
            AIVG  + AS +L  FSWG  FLELN ELL++Y  CTD  SV+KA+++WL KIE E ++
Sbjct: 164 FAIVGRMDLASDLLSNFSWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQ 223

Query: 216 RKEKMNSADAWLIGNTNRKNLNDFDNSSESTEDNISTVSSADERYDALGNLISNDS---- 271
           RK +    D W++GN NR N+N    +    E +     ++  RYD LGN I ++S    
Sbjct: 224 RKNEARDGDIWMMGNVNR-NMNKM--TLSDEESDEEETEASSIRYDNLGNAIIDESDEEE 280

Query: 272 ---HSLKYDSLGNVIESEGD 288
               S++YD+LGNVI  E D
Sbjct: 281 PEISSIRYDNLGNVIVDESD 300

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  305 bits (781), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 148/278 (53%), Positives = 196/278 (70%), Gaps = 9/278 (3%)

Query: 33  STKTNFPVKLAMWDFDHCDPKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPAD 92
           + +T FP KLAMWDFDHCDPKRCSGKKLER GL +SLR+GQ+F G+VVSPNGK VV P D
Sbjct: 38  TKETEFPAKLAMWDFDHCDPKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPND 97

Query: 93  RETIEQYGIAVVECSWARLDEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAF 152
           +E +EQ+G++VVECSWARLDE+PF+K+GG+  +E LLPYLVAAN VNYGRPWRLNCVEA 
Sbjct: 98  KEIVEQHGVSVVECSWARLDEIPFSKIGGR--HERLLPYLVAANQVNYGRPWRLNCVEAI 155

Query: 153 AACLAIVGFKEYASKVLEGFSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELE 212
           AAC AIVG  + A ++L  FSWG  FLELN ELL+ Y  CTD  S++ A++ WL+K+E E
Sbjct: 156 AACFAIVGRTDLAEELLSHFSWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEE 215

Query: 213 NKERKEKMNSADAWLIGNTNRKNLNDFDNSSESTEDNISTVSSADERYDALG------NL 266
            ++R+++ +  D W++GN NRK  N   +S   ++DN  +  ++D  +D +       ++
Sbjct: 216 AEQRRKQTHEEDIWMMGNVNRKAPN-MRSSMLDSDDNSDSEYASDVDHDLVSDTEEGEDI 274

Query: 267 ISNDSHSLKYDSLGNVIESEGDALPPKYDKLGNIIEDN 304
                  + YDSLGNVIE+      P+   L +  ED 
Sbjct: 275 AIGSKRDVTYDSLGNVIENGRREFVPETKILESDEEDQ 312

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  305 bits (780), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 169/327 (51%), Positives = 206/327 (62%), Gaps = 41/327 (12%)

Query: 1   MAKGKNKGHXXXXXXXXXXXXXXXXXHS---LSIK---STKTNFPVKLAMWDFDHCDPKR 54
           M KGKNK H                  +   + +K   S K  FPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKMHEPKNGRPQRGANGHSSRQNHRRMEMKYDNSEKMKFPVKLAMWDFDHCDPKR 60

Query: 55  CSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEV 114
           CSGKKLER GL +SLRVGQ+F G+VVSPNGK VV P D E +EQ+G +VVECSWARL+EV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEEV 120

Query: 115 PFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSW 174
           PFNK+GGK  +E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  ++AS++L  FSW
Sbjct: 121 PFNKIGGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSW 178

Query: 175 GHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNRK 234
           G  FLELN ELL+IY  CTD  SV++A++EWL+K+E E +ERK +    D W++GN NR+
Sbjct: 179 GMGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRR 238

Query: 235 NLNDFDNSSESTEDNISTVSSADERYDALGNLISNDSHSLKYDSLGNVIESEG------- 287
                 N S+S   + S      E+ D  GN     +  ++YDSLGN I  +        
Sbjct: 239 G-----NGSQS---DTSESEENSEQSDLEGN-----NQCIEYDSLGNAIRIDNMKSREAQ 285

Query: 288 -------------DALPPKYDKLGNII 301
                        +  P  YD LGN+I
Sbjct: 286 SEESEDEESGSKENGEPLSYDPLGNLI 312

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  304 bits (779), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 171/314 (54%), Positives = 210/314 (66%), Gaps = 15/314 (4%)

Query: 1   MAKGKNKGHXXXXXXXXXXXXXXXXXHS---LSIK---STKTNFPVKLAMWDFDHCDPKR 54
           M KGKNK H                  +   + +K   S K  FPVKLAMWDFDHCDPKR
Sbjct: 1   MGKGKNKAHEPKNGRPQRGANGHSSRQNHRRMEMKYENSDKVKFPVKLAMWDFDHCDPKR 60

Query: 55  CSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEV 114
           CSGKKLER GL +SLRVGQ+F G+VVSPNGK VV P D E +EQ+G +VVECSWARL+EV
Sbjct: 61  CSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEEV 120

Query: 115 PFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSW 174
           PFNK+GGK  +E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  ++AS++L  FSW
Sbjct: 121 PFNKIGGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSW 178

Query: 175 GHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNRK 234
           G  FLELN ELL+IY  CTD+ SV++A++EWL+K+E E +ERK +    D W++GN NR+
Sbjct: 179 GMGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINRR 238

Query: 235 NLNDFDNSSESTEDNISTVSSADER---YDALGNLISNDS----HSLKYDSLGNVIESEG 287
                 + SES   +  + S  D++   YD+LGN I  DS     SL  +S     + E 
Sbjct: 239 GGGWQSDESESGGSSGESESEGDKQCVEYDSLGNAICIDSINSRKSLSEESEDEENDLEE 298

Query: 288 DALPPKYDKLGNII 301
           +  P  YD LGN+I
Sbjct: 299 NKEPVSYDSLGNLI 312

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  300 bits (769), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 158/283 (55%), Positives = 198/283 (69%), Gaps = 20/283 (7%)

Query: 33  STKTNFPVKLAMWDFDHCDPKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPAD 92
           S +T+FPVKLAMWDFDHCDPKRCSGKKLER  L +SL++ Q+F G+ VSPNGK+ VSP D
Sbjct: 42  SRETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKINQKFQGITVSPNGKKFVSPED 101

Query: 93  RETIEQYGIAVVECSWARLDEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAF 152
           RE + ++G AVVECSWAR+DE+PF+K    P  + LLPYLVAAN VNYGRPW+LNCVEA 
Sbjct: 102 RELVTEFGCAVVECSWARIDEIPFSKF-STPKLDRLLPYLVAANQVNYGRPWKLNCVEAI 160

Query: 153 AACLAIVGFKEYASKVLEGFSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELE 212
           AACLAIVGF + A ++L  FSWG  FL+LN ELL+IY  CTDS  +E AQD W+++IE E
Sbjct: 161 AACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCTDSDEIEAAQDAWMDQIEKE 220

Query: 213 NKERKEKMNS--ADAWLIGNTNRKNLNDFDNSSESTEDNISTVSSADERYDALGNLISND 270
            +ERK   N+   D W+ GN NR + +D DN  E +ED   T       YD LGN+I N+
Sbjct: 221 VQERKASNNAQNVDIWMSGNVNRIDESDEDNEDEDSEDEEVT-------YDNLGNIIENE 273

Query: 271 SHSLKYDSLGNVIESEGDALPP----------KYDKLGNIIED 303
              ++YD+LGN+IE   +              KYD LGN+IE+
Sbjct: 274 PREVRYDNLGNIIEESSEESSGEEEEDEEEDVKYDSLGNVIEE 316

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  298 bits (763), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 146/244 (59%), Positives = 178/244 (72%), Gaps = 9/244 (3%)

Query: 33  STKTNFPVKLAMWDFDHCDPKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPAD 92
           S  ++FPVKLAMWDFDHCDPKRCSGKKLER GL +SLRVGQ+F G+VVSPNGK VV P D
Sbjct: 42  SKDSSFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDD 101

Query: 93  RETIEQYGIAVVECSWARLDEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAF 152
           RE +E +G +VVECSWARL+EVPFNK+GGK  +E LLPYLVAAN VNYGRPWRLNCVEA 
Sbjct: 102 REIVEAHGASVVECSWARLEEVPFNKIGGK--HERLLPYLVAANQVNYGRPWRLNCVEAL 159

Query: 153 AACLAIVGFKEYASKVLEGFSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELE 212
           AAC AIVG  + A ++L  FSWG  FLELN +LL+ Y  CTDS S++K +++WL++I+ E
Sbjct: 160 AACFAIVGRTDLAHELLSHFSWGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQE 219

Query: 213 NKERKEKMNSADAWLIGNTNRKNLNDFDNSSESTEDNIS-------TVSSADERYDALGN 265
            +ERK K  + D W++GNTNR N      S    E           T +  + RYD LGN
Sbjct: 220 VQERKLKAQTEDVWMMGNTNRGNSGLMPPSDSEEEYEEEAEEEEEDTTTRKNVRYDNLGN 279

Query: 266 LISN 269
           +I +
Sbjct: 280 IIED 283

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  297 bits (761), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 151/272 (55%), Positives = 187/272 (68%), Gaps = 8/272 (2%)

Query: 37  NFPVKLAMWDFDHCDPKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETI 96
           NFPVKLAMWDFD CDPKRCSGKKLER G+ +SLRVGQ+F G+VVSPNGK VV P DR  +
Sbjct: 44  NFPVKLAMWDFDQCDPKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIV 103

Query: 97  EQYGIAVVECSWARLDEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACL 156
           E+ G AVVECSWARLDEVPFNK+GG+  NE LLPYLVAAN VNYGRPWRLNCVEA AAC 
Sbjct: 104 EENGAAVVECSWARLDEVPFNKIGGR--NERLLPYLVAANQVNYGRPWRLNCVEALAACF 161

Query: 157 AIVGFKEYASKVLEGFSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKER 216
           AIVG  + A+++L  FSWG  FLELN ELL++Y  CTD+ S++KA+D WLE+IE E +ER
Sbjct: 162 AIVGRLDLATELLSHFSWGLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQER 221

Query: 217 KEKMNSADAWLIGNTNRKNLNDFDNSSESTEDNISTVSSADERYDALGNLISNDSHS--- 273
           K +    D WL GN N K  +    +    E  + +     E  +   +  + D      
Sbjct: 222 KARNPGDDLWLTGNVNHKKGHGVTQNENKDEAEVGSTWEQGENSEYESDESAADGEEAYH 281

Query: 274 --LKYDSLGNVIESEGDALPPKYDKLGNIIED 303
             +KYDSLGN I +  ++  P+Y     ++E+
Sbjct: 282 GPVKYDSLGNEI-TLSESSDPEYSDSEELLEE 312

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  297 bits (760), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 159/294 (54%), Positives = 200/294 (68%), Gaps = 29/294 (9%)

Query: 38  FPVKLAMWDFDHCDPKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIE 97
            PVKL MWDFDHCDPKRCSGKKLER GL +SL++GQRF G+++SPNGK+VVSP D + I+
Sbjct: 108 IPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDADIIK 167

Query: 98  QYGIAVVECSWARLDEVPFNKLGGK--PSNEVLLPYLVAANPVNYGRPWRLNCVEAFAAC 155
           ++G AVVECSWARLDE+PF+KL G     NE LLPYLVAAN VNYGRPW+LNCVEA AAC
Sbjct: 168 EFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAAC 227

Query: 156 LAIVGFKEYASKVLEGFSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKE 215
            AI+G  ++AS +L  FSWG  FL+LN+EL ++Y  CTDS SV+ AQ+EWL+KIE E  E
Sbjct: 228 FAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQEATE 287

Query: 216 RKEKMNSADAWLIGNTNR--KNLNDFDNSSESTEDNIS----------TVSSADERYDAL 263
           RK +    D W++GNTNR   NL   + S E  E+                + + RYD L
Sbjct: 288 RKLQAQETDIWMMGNTNRLDANLRSMNISDEDEEEEEEYDEEEDGGEHITRNKELRYDNL 347

Query: 264 GNLISN--------DSHSLKYDSLGNVIESEGDALPP-------KYDKLGNIIE 302
           GN+I +        +   ++YD+LGN+IESE +           +YD LGNIIE
Sbjct: 348 GNVIEDTDEEYLSEEEKEIRYDNLGNIIESEEEEEEEKEEGIELRYDSLGNIIE 401

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  289 bits (740), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 141/242 (58%), Positives = 171/242 (70%), Gaps = 11/242 (4%)

Query: 1   MAKGKNKGHXXXXXX---------XXXXXXXXXXXHSLSIKSTKTNFPVKLAMWDFDHCD 51
           M KGKNK H                          H  +  S KTNFPVKL MWDFDHCD
Sbjct: 1   MGKGKNKNHEVRSTRPGRGANGHNSKQNHKHMEMKHGGASNSNKTNFPVKLGMWDFDHCD 60

Query: 52  PKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARL 111
           PKRCSGKKLER GL +SLRVGQ+F G+VV+PNG  VV P D+  +E++G +VVECSWARL
Sbjct: 61  PKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWARL 120

Query: 112 DEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEG 171
           DEVPFN++GG+  +E LLPYLVAAN VNYGRPW+LNCVEA AAC AIVG  ++AS++L  
Sbjct: 121 DEVPFNRIGGR--HERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSN 178

Query: 172 FSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNT 231
           FS+G +FLE+N ELL+IY  CTD+ SV+ A+  WLEKIE E K+RK +  + D W+ GN 
Sbjct: 179 FSYGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNV 238

Query: 232 NR 233
           NR
Sbjct: 239 NR 240

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  290 bits (743), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 153/281 (54%), Positives = 195/281 (69%), Gaps = 19/281 (6%)

Query: 37  NFPVKLAMWDFDHCDPKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETI 96
           NFPVKLAMWDFD CDPKRCSGKKLER G+ +SLRVGQ+F G+VVSPNGK VV P D++ +
Sbjct: 39  NFPVKLAMWDFDQCDPKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIV 98

Query: 97  EQYGIAVVECSWARLDEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACL 156
           E+ G AVVECSWARL+E+PFNK+GG+  NE LLPYLVAAN VNYGRPWRLNCVEA AAC 
Sbjct: 99  EESGAAVVECSWARLNEIPFNKIGGR--NERLLPYLVAANQVNYGRPWRLNCVEALAACF 156

Query: 157 AIVGFKEYASKVLEGFSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKER 216
           AIVG  + A+++L  FSWG  FLELN EL+++Y  CTD+ SV++A+  WLEKIE E  ER
Sbjct: 157 AIVGRMDLATELLAHFSWGLGFLELNKELIEVYQKCTDAESVKEAEASWLEKIEREANER 216

Query: 217 KEKMNSADAWLIGNTNRKNL--NDFDNSSESTEDNISTVSSADERYDALGNLISNDSHSL 274
           +    + D W+ GN NR++   ND ++S E +E+++ T    ++  +       N    +
Sbjct: 217 RNHSATDDLWMTGNVNRRSPLGNDTESSQEESENSVDT-GDEEDDDNEDDYATGNRKRVV 275

Query: 275 KYDSLGNVIE--------------SEGDALPPKYDKLGNII 301
           KYD+LGN I                E + +  K+D LGNII
Sbjct: 276 KYDNLGNEIYPSESSESSEERDDLDEQEEVKYKFDSLGNII 316

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  288 bits (738), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 144/248 (58%), Positives = 175/248 (70%), Gaps = 13/248 (5%)

Query: 36  TNFPVKLAMWDFDHCDPKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRET 95
           T FPVKLAMWDFDHCDPKRCSGKKLER GL +SLRVGQ+F G+VVSPNG  VV P D+  
Sbjct: 41  TKFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSI 100

Query: 96  IEQYGIAVVECSWARLDEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAAC 155
           +E++G +VVECSWARLDEVPFNK+GGK  +E LLPYLVAAN VNYGRPW+LNCVEA AAC
Sbjct: 101 VEEHGASVVECSWARLDEVPFNKIGGK--HERLLPYLVAANQVNYGRPWKLNCVEALAAC 158

Query: 156 LAIVGFKEYASKVLEGFSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKE 215
            AIVG  ++AS++L  FSWG  FLELN ELL+IY  CTD+ SV+ A+  WL KI+ E +E
Sbjct: 159 FAIVGRMDWASELLSHFSWGLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEE 218

Query: 216 RKEKMNSADAWLIGNTNRKNLNDFDNSSESTEDNISTVSSADERYDALGNLISNDSHSLK 275
           RK +    D W+ GN NRK     D++ E     +                  ++  +L+
Sbjct: 219 RKSQAKDEDIWMTGNVNRKGTTFLDDNEEEESSEVEESDEE-----------EDNGKTLR 267

Query: 276 YDSLGNVI 283
           YD LGN+I
Sbjct: 268 YDRLGNLI 275

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  291 bits (745), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 135/206 (65%), Positives = 162/206 (78%), Gaps = 2/206 (0%)

Query: 33  STKTNFPVKLAMWDFDHCDPKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPAD 92
           S    FPVKLAMWDFDHCDPKRCSGKKLER GL +SLRVGQ+F G+VVSPNG+ VV P D
Sbjct: 41  SAGNKFPVKLAMWDFDHCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPND 100

Query: 93  RETIEQYGIAVVECSWARLDEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAF 152
           R  +E++G +VVECSWARLDEVPF ++GGK  +E LLPYLVAAN VNYGRPWRLNCVEA 
Sbjct: 101 RVIVEEHGASVVECSWARLDEVPFGRIGGK--HERLLPYLVAANQVNYGRPWRLNCVEAL 158

Query: 153 AACLAIVGFKEYASKVLEGFSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELE 212
           AAC AIVG  + AS++L  FSWG  FLELN ELL+IY  CTD+ SV+ A++ WL+KIE E
Sbjct: 159 AACFAIVGRTDLASELLSNFSWGLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEE 218

Query: 213 NKERKEKMNSADAWLIGNTNRKNLND 238
            ++RK++    D W++GN NR+   D
Sbjct: 219 AQQRKQQSKEEDIWMMGNVNRRRTCD 244

 Score = 29.6 bits (65), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 13/56 (23%)

Query: 260 YDALGNLI-----SNDSHSLKYDSLGNVIESEGDAL--------PPKYDKLGNIIE 302
           YD+LGN+I       D  + +++S G+   SE D            KYD  GNI E
Sbjct: 368 YDSLGNIIEKHSKETDFKTTRHNSFGSTTSSEEDEYIEELHTKKEAKYDSFGNISE 423

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  286 bits (733), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 169/241 (70%), Gaps = 10/241 (4%)

Query: 1   MAKGKNKGHXXXXXXXXXXXXXXXXXHSL------SIKSTKTNFPVKLAMWDFDHCDPKR 54
           M KG+NK +                 H        +I+ +K  FPV LAMWDFDHCDPKR
Sbjct: 1   MGKGRNKDYDKNHSQKGSNGHSSRTNHRRIETKYNAIQGSK--FPVTLAMWDFDHCDPKR 58

Query: 55  CSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARLDEV 114
           CSGKKLER GL +SLRV Q+F G+VVSPNGK VV P DRE  E+YG++VVECSWARL+E+
Sbjct: 59  CSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEEI 118

Query: 115 PFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEGFSW 174
           PF K+GG+  +E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  + A  +L  FSW
Sbjct: 119 PFEKIGGR--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSW 176

Query: 175 GHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNTNRK 234
           G  FLELN E+L+IY  CTD  S++ A++ WL++IE E  ER+++    D W++GN NRK
Sbjct: 177 GLGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNRK 236

Query: 235 N 235
           N
Sbjct: 237 N 237

>KLTH0H10736g Chr8 complement(924558..926990) [2433 bp, 810 aa] {ON}
           similar to uniprot|P40367 Saccharomyces cerevisiae
           YJL062W LAS21 Integral plasma membrane protein involved
           in the synthesis of the glycosylphosphatidylinositol
           (GPI) core structure mutations affect cell wall
           integrity
          Length = 810

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 45/114 (39%), Gaps = 18/114 (15%)

Query: 200 KAQDEWLEKIELENKERKEKMNSADAWL----------IGNTNRKNLNDFDNSSESTEDN 249
           K QD WL +  +  K  K K    D WL             TN   ++DF+    +   +
Sbjct: 131 KEQDSWLRQFRMHQK--KIKFFGDDTWLKLFPSEFFDETDGTNSFFVSDFEEVDLNVTRH 188

Query: 250 ISTVSSADERYDALGNLISNDSHSLKYDSLGNVIESEGDALPPKYDKLGNIIED 303
           +     + + +D L        H L  D +G+   +    +PPK+ ++  +IE 
Sbjct: 189 LPQQLQSQDSWDVL------ILHYLGLDHIGHKGGAFSSFMPPKHREMDAVIEQ 236

>TBLA0D05650 Chr4 (1384163..1387090) [2928 bp, 975 aa] {ON}
           Anc_1.224 YJL129C
          Length = 975

 Score = 31.2 bits (69), Expect = 4.1,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 27/52 (51%)

Query: 206 LEKIELENKERKEKMNSADAWLIGNTNRKNLNDFDNSSESTEDNISTVSSAD 257
           LEK    +K+R+    S D  L GN +     D + S  ++ DNISTV + D
Sbjct: 450 LEKTNKRSKQRRNNEQSYDEPLSGNHSLSFNTDSEASFSASLDNISTVMTYD 501

>KNAG0C05830 Chr3 (1132645..1135137) [2493 bp, 830 aa] {ON}
           Anc_1.317 YJL062W
          Length = 830

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 48/122 (39%), Gaps = 19/122 (15%)

Query: 194 DSISVEKAQDEWLEKIELENKERKEKMNSADAWL------------IGNTNRKNLNDFDN 241
           D  S  K QD W+ +  L N  +  +    D WL               TN   ++DF  
Sbjct: 128 DQTSTIKEQDSWINQF-LTNGNQSIRFFGDDTWLKLFAPANETFQEWEGTNSFFVSDFTQ 186

Query: 242 SSESTEDNISTVSSADERYDALGNLISNDSHSLKYDSLGNVIESEGDALPPKYDKLGNII 301
              +   +I T     +++D L        H L  D +G+   +    +P K+ ++ N++
Sbjct: 187 VDLNVTRHIPTQLQEKDQWDTL------ILHYLGLDHIGHKGGAYSHFMPEKHKEMDNVL 240

Query: 302 ED 303
           +D
Sbjct: 241 KD 242

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,368,163
Number of extensions: 1494026
Number of successful extensions: 6939
Number of sequences better than 10.0: 163
Number of HSP's gapped: 7123
Number of HSP's successfully gapped: 164
Length of query: 304
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 195
Effective length of database: 40,982,805
Effective search space: 7991646975
Effective search space used: 7991646975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)