Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A072306.16ON1097109748670.0
ZYRO0C07898g6.16ON97463413671e-171
TDEL0G045306.16ON95854413561e-170
NCAS0H008806.16ON100454813291e-165
SAKL0E01078g6.16ON94859613061e-162
YEL061C (CIN8)6.16ON100064312941e-160
Kpol_1032.66.16ON100454812921e-160
NDAI0D008706.16ON106963912971e-160
Smik_5.266.16ON100255012861e-159
Skud_5.286.16ON99863012841e-159
Suva_5.66.16ON99955212531e-154
KAFR0L003706.16ON96354712301e-151
TPHA0M002406.16ON93954712211e-150
KLTH0C11330g6.16ON94154212121e-149
Kwal_56.224036.16ON94354311991e-147
Ecym_30206.16ON94454311901e-146
CAGL0B03641g6.16ON98854611891e-145
KNAG0M011306.16ON95054911461e-139
ACR010C6.16ON94555811441e-139
KLLA0D01045g6.16ON96553811361e-138
Kpol_1045.736.16ON9625457846e-88
Suva_2.547.387ON11102186387e-68
Smik_2.537.387ON11132186352e-67
Skud_2.417.387ON11102186333e-67
SAKL0F12298g7.387ON11122236236e-66
ACR228C7.387ON11292246192e-65
Ecym_46887.387ON11342236077e-64
TDEL0C016007.387ON11052146067e-64
TPHA0E008907.387ON12322256061e-63
NDAI0E043007.387ON11862195999e-63
ZYRO0B03234g7.387ON11382135981e-62
TPHA0J003006.16ON9825345913e-62
KAFR0L017107.387ON11512245864e-61
NCAS0E026407.387ON11023085836e-61
TBLA0D006407.387ON11421974473e-44
KLTH0G03850g5.531ON4731733532e-34
KLLA0B00759g5.531ON4561793432e-33
SAKL0G05016g5.531ON5041753443e-33
YBL063W (KIP1)7.387ON11111863519e-33
Kwal_47.186085.531ON4791733221e-30
KAFR0F042103.528ON6722123254e-30
YGL216W (KIP3)3.528ON8051943258e-30
SAKL0G18920g2.633ON6491753211e-29
Ecym_40665.531ON4781723151e-29
NCAS0E005503.528ON7841963193e-29
Skud_7.533.528ON8051943194e-29
ZYRO0E08668g3.528ON7781803185e-29
NDAI0I029603.528ON8681993185e-29
TDEL0D059603.528ON7331793166e-29
CAGL0I07029g3.528ON7052013158e-29
Suva_7.443.528ON8051943168e-29
Kwal_47.190933.528ON8191953169e-29
Kpol_423.83.528ON8061953151e-28
Smik_7.483.528ON8051943151e-28
KLTH0G01606g3.528ON8191953096e-28
TBLA0C049603.528ON8011833088e-28
Ecym_12003.528ON8332553089e-28
KNAG0B005203.528ON7231833079e-28
SAKL0F01760g3.528ON8091943079e-28
Kpol_1004.255.531ON5062173001e-27
Ecym_34152.633ON6621693041e-27
KLLA0A01606g3.528ON7691963042e-27
ADR145C2.633ON6351723013e-27
TBLA0C039403.479ON7391923015e-27
ZYRO0D12650g5.531ON4781842938e-27
CAGL0D04994g3.479ON6921872971e-26
AER441C3.528ON8182202972e-26
TPHA0D034803.528ON8471952972e-26
KNAG0A078803.479ON7641802892e-25
Kpol_505.393.479ON6921482854e-25
KAFR0B065903.479ON7061512792e-24
ZYRO0B04290g3.479ON7311532764e-24
TBLA0C053103.479ON6761652747e-24
TPHA0D032003.479ON7241652721e-23
YPR141C (KAR3)3.479ON7291442721e-23
Kwal_26.88068.678ON7152072712e-23
NCAS0F034703.479ON6981482702e-23
Kpol_1013.78.678ON6201772683e-23
SAKL0F03168g3.479ON7061442693e-23
Skud_16.4353.479ON7291442694e-23
Smik_16.3883.479ON7291442685e-23
KLLA0B10956g3.479ON6901502667e-23
KAFR0H024108.678ON6582322659e-23
Suva_16.4693.479ON7311452659e-23
AGR253W3.479ON7091682651e-22
TDEL0F036403.479ON7041492631e-22
Kpol_1050.1033.479ON6971442632e-22
KLTH0F14498g3.479ON7021492622e-22
NCAS0C013508.678ON6551822612e-22
NDAI0B057703.479ON7631532622e-22
SAKL0H06490g8.678ON6571772603e-22
Ecym_44073.479ON7111722533e-21
TPHA0D012708.678ON6961852523e-21
KLTH0D11286g8.678ON6781842506e-21
ZYRO0F07414g8.678ON6542082489e-21
ACR145W8.678ON6852082481e-20
Skud_16.1278.678ON7061992391e-19
KNAG0J017208.678ON6251792372e-19
TBLA0C018808.678ON4681502332e-19
YPL155C (KIP2)8.678ON7061992354e-19
Smik_6.3528.678ON7152052344e-19
Ecym_23958.678ON6872212345e-19
KLLA0D05951g8.678ON6681842336e-19
NDAI0E02090singletonON6851952301e-18
TDEL0A062408.678ON6372332301e-18
CAGL0M02189g8.678ON6721932301e-18
TPHA0D041903.479ON6721492255e-18
Suva_16.1558.678ON7041992131e-16
TDEL0B072702.633ON6441992051e-15
Kwal_55.21164singletonOFF5881721933e-14
Kwal_YGOB_55.211643.479ON6571721924e-14
Kpol_1019.112.633ON6471681702e-11
YKL079W (SMY1)2.633ON6561091532e-09
KNAG0M025402.633ON5221191479e-09
TBLA0A008202.633ON8031691434e-08
Suva_11.1452.633ON6571091424e-08
Skud_11.1482.633ON6561291415e-08
Smik_11.1602.633ON6561371407e-08
TPHA0N016502.633ON6821911362e-07
NDAI0C004802.633ON5982351301e-06
NCAS0H031802.633ON6601051291e-06
TBLA0C008002.633ON6931301282e-06
ZYRO0E01078g2.633ON6681081229e-06
CAGL0L05104g2.633ON6751971211e-05
KAFR0C040202.633ON6672091067e-04
KNAG0H003602.633ON6811151010.003
NCAS0C028308.401ON874127791.3
Ecym_81271.151ON84763754.2
TBLA0F002106.374ON42841744.3
NCAS0C052002.633ON572106728.1
Suva_13.2392.632ON501167718.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07230
         (1097 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...  1879   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   531   e-171
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   526   e-170
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   516   e-165
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   507   e-162
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   503   e-160
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   502   e-160
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   504   e-160
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   499   e-159
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   499   e-159
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   487   e-154
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   478   e-151
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   474   e-150
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   471   e-149
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   466   e-147
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   462   e-146
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   462   e-145
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   446   e-139
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   445   e-139
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   442   e-138
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   306   6e-88
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   250   7e-68
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   249   2e-67
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   248   3e-67
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   244   6e-66
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   243   2e-65
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   238   7e-64
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   238   7e-64
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   238   1e-63
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   235   9e-63
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   234   1e-62
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   232   3e-62
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   230   4e-61
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   229   6e-61
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   176   3e-44
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   140   2e-34
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   136   2e-33
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   137   3e-33
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   139   9e-33
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   128   1e-30
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   129   4e-30
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   129   8e-30
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   128   1e-29
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   125   1e-29
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   127   3e-29
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   127   4e-29
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   127   5e-29
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   127   5e-29
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   126   6e-29
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   125   8e-29
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   126   8e-29
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   126   9e-29
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   125   1e-28
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   125   1e-28
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   123   6e-28
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   123   8e-28
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   123   9e-28
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   122   9e-28
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   122   9e-28
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   120   1e-27
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   121   1e-27
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   121   2e-27
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   120   3e-27
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   120   5e-27
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   117   8e-27
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   119   1e-26
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   119   2e-26
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   119   2e-26
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   115   2e-25
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   114   4e-25
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   112   2e-24
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   110   4e-24
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   110   7e-24
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   109   1e-23
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   109   1e-23
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   108   2e-23
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   108   2e-23
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   107   3e-23
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   108   3e-23
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   108   4e-23
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   107   5e-23
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   107   7e-23
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   106   9e-23
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   106   9e-23
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   106   1e-22
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   105   1e-22
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   105   2e-22
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   105   2e-22
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   105   2e-22
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   105   2e-22
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   104   3e-22
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   102   3e-21
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   101   3e-21
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...   100   6e-21
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   100   9e-21
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...   100   1e-20
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    97   1e-19
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    96   2e-19
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    94   2e-19
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    95   4e-19
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    95   4e-19
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    95   5e-19
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...    94   6e-19
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...    93   1e-18
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...    93   1e-18
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...    93   1e-18
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    91   5e-18
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    87   1e-16
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    84   1e-15
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    79   3e-14
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    79   4e-14
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    70   2e-11
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    64   2e-09
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    61   9e-09
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    60   4e-08
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    59   4e-08
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    59   5e-08
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    59   7e-08
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    57   2e-07
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    55   1e-06
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     54   1e-06
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    54   2e-06
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    52   9e-06
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    51   1e-05
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    45   7e-04
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    44   0.003
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     35   1.3  
Ecym_8127 Chr8 complement(264055..266598) [2544 bp, 847 aa] {ON}...    33   4.2  
TBLA0F00210 Chr6 complement(32816..34102) [1287 bp, 428 aa] {ON}...    33   4.3  
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    32   8.1  
Suva_13.239 Chr13 (381069..382574) [1506 bp, 501 aa] {ON} YMR065...    32   8.8  

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_6.16
            YEL061C
          Length = 1097

 Score = 1879 bits (4867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 958/1097 (87%), Positives = 958/1097 (87%)

Query: 1    MQKTHTSGEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHM 60
            MQKTHTSGEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHM
Sbjct: 1    MQKTHTSGEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHM 60

Query: 61   NSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKL 120
            NSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKL
Sbjct: 61   NSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKL 120

Query: 121  YDGELSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYKKLR 180
            YDGELSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYKKLR
Sbjct: 121  YDGELSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYKKLR 180

Query: 181  IFDSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLSTIALKRR 240
            IFDSM                                              LSTIALKRR
Sbjct: 181  IFDSMSSYSNSTATSNNNTSNNTRNNSRNNSRSNSRNTSRNNSPRPSSSTNLSTIALKRR 240

Query: 241  TATRPSSLSSLNPTANSSIYSNNTNNKIRFKDQPANQLRLQSKLQAQQNIEXXXXXXXXX 300
            TATRPSSLSSLNPTANSSIYSNNTNNKIRFKDQPANQLRLQSKLQAQQNIE         
Sbjct: 241  TATRPSSLSSLNPTANSSIYSNNTNNKIRFKDQPANQLRLQSKLQAQQNIELQQIHSQNI 300

Query: 301  XXXXXXXXXXXXXXXENKEQLTNSEKAPDNNNQIYIQNLQEFYINNATDGIKLLQKGLRH 360
                           ENKEQLTNSEKAPDNNNQIYIQNLQEFYINNATDGIKLLQKGLRH
Sbjct: 301  QQQQSQSITSNLQSQENKEQLTNSEKAPDNNNQIYIQNLQEFYINNATDGIKLLQKGLRH 360

Query: 361  RKVASTKMNDVSSRSHTIFTITLYKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKE 420
            RKVASTKMNDVSSRSHTIFTITLYKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKE
Sbjct: 361  RKVASTKMNDVSSRSHTIFTITLYKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKE 420

Query: 421  AGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVD 480
            AGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVD
Sbjct: 421  AGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVD 480

Query: 481  ETSSTLEYASKAKNIKNKPHLGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQH 540
            ETSSTLEYASKAKNIKNKPHLGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQH
Sbjct: 481  ETSSTLEYASKAKNIKNKPHLGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQH 540

Query: 541  YKELNNDLESYKTEVQESKRANERLISQNGSLLKDKKASNELNELQRXXXXXXXXXXXXX 600
            YKELNNDLESYKTEVQESKRANERLISQNGSLLKDKKASNELNELQR             
Sbjct: 541  YKELNNDLESYKTEVQESKRANERLISQNGSLLKDKKASNELNELQRIQIEKKNEKIKEL 600

Query: 601  XXXLDEHYKREDILVELIRQLKNVGTSMQSTIENYRERDLEIEESTKKILENEFKFLKNE 660
               LDEHYKREDILVELIRQLKNVGTSMQSTIENYRERDLEIEESTKKILENEFKFLKNE
Sbjct: 601  YEILDEHYKREDILVELIRQLKNVGTSMQSTIENYRERDLEIEESTKKILENEFKFLKNE 660

Query: 661  LSQILSNINGXXXXXXXXXXXXXXXXXXXXXXXXFQKNIDIIENTTLKILKQVQEKSQHI 720
            LSQILSNING                        FQKNIDIIENTTLKILKQVQEKSQHI
Sbjct: 661  LSQILSNINGNIIDNLKSSIISNNSSIEAIDSSNFQKNIDIIENTTLKILKQVQEKSQHI 720

Query: 721  YSSCIERILSDIPNILNKFKIEINSIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFL 780
            YSSCIERILSDIPNILNKFKIEINSIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFL
Sbjct: 721  YSSCIERILSDIPNILNKFKIEINSIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFL 780

Query: 781  QNNYELILKNHLESGQSQIESFSXXXXXXINKQINEFKLHNSKLYEEKLNNIKNDIVKKE 840
            QNNYELILKNHLESGQSQIESFS      INKQINEFKLHNSKLYEEKLNNIKNDIVKKE
Sbjct: 781  QNNYELILKNHLESGQSQIESFSNNLLLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKE 840

Query: 841  TESIKPYKEKWVKSIEIINSTDKINNTFHNDMXXXXXXXXXXXXXSHXXXXXXXXXXKVN 900
            TESIKPYKEKWVKSIEIINSTDKINNTFHNDM             SH          KVN
Sbjct: 841  TESIKPYKEKWVKSIEIINSTDKINNTFHNDMNNRILQINNLILQSHNDINNSINDIKVN 900

Query: 901  EIRENEAVNEILSSNTEYVNNINELKIKNMDYQEKLKCIGKSSENSINYLDSTKQVIESG 960
            EIRENEAVNEILSSNTEYVNNINELKIKNMDYQEKLKCIGKSSENSINYLDSTKQVIESG
Sbjct: 901  EIRENEAVNEILSSNTEYVNNINELKIKNMDYQEKLKCIGKSSENSINYLDSTKQVIESG 960

Query: 961  LKTRQIAKHYKAFIDHQDNVDEDTFLSTKSHTLQFNSLMKQIESSVLFPTLNRKIITPSN 1020
            LKTRQIAKHYKAFIDHQDNVDEDTFLSTKSHTLQFNSLMKQIESSVLFPTLNRKIITPSN
Sbjct: 961  LKTRQIAKHYKAFIDHQDNVDEDTFLSTKSHTLQFNSLMKQIESSVLFPTLNRKIITPSN 1020

Query: 1021 NNKYPLMDLANHGKENKENDISPPFFSKYNIPNKSLSLSPTQLTKGIVNQNKRSLTIQDR 1080
            NNKYPLMDLANHGKENKENDISPPFFSKYNIPNKSLSLSPTQLTKGIVNQNKRSLTIQDR
Sbjct: 1021 NNKYPLMDLANHGKENKENDISPPFFSKYNIPNKSLSLSPTQLTKGIVNQNKRSLTIQDR 1080

Query: 1081 DDYNHPFDTSKKRPRIE 1097
            DDYNHPFDTSKKRPRIE
Sbjct: 1081 DDYNHPFDTSKKRPRIE 1097

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  531 bits (1367), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 298/634 (47%), Positives = 410/634 (64%), Gaps = 20/634 (3%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D+ + +YIQNLQ+F+I +A DG++LLQKGLR+R+VA+TKMND SSRSHTIFTITLY+EH 
Sbjct: 272 DSPSGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQ 331

Query: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448
           G +++VSKMNLVDLAGSENI++SGAQHQRAKEAGSINQSLLTLGRVINSLADKS H+PFR
Sbjct: 332 GEMFKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFR 391

Query: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508
           ESKLTRLLQDSLGGNTKT LI+TISPAKIN +ET STL+YASKAKNIKN+P L SFIMKD
Sbjct: 392 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKD 451

Query: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568
           +L+KNIT EL K+KSDL+ST+L++GVYMSQ +YKE+ NDLESYKTE+QESKR  ERL SQ
Sbjct: 452 ILVKNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQ 511

Query: 569 NGSLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVGTSM 628
           N  LLKDKKASNE+NELQR                L+  +K+E  LV++   LK+  +  
Sbjct: 512 NSLLLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLT 571

Query: 629 QSTIENYRERDLEIEESTKKILENEF----KFLKNELSQILSNINGXXXXXXXXXXXXXX 684
           QS I+ Y +R+ +I E  + IL  EF    + L N +  I +N +G              
Sbjct: 572 QSVIKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSG-------------N 618

Query: 685 XXXXXXXXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEIN 744
                      Q+N++++    +++L   Q++++ +Y   IE+IL + P +      +++
Sbjct: 619 DILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVD 678

Query: 745 SIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSX 804
            ++   N    ++TENLSD+SE YNN K+Y N+ F +NN+E +L +H++    Q++ FS 
Sbjct: 679 QVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQ-FSA 737

Query: 805 XXXXXINKQINEFKLHNSK-LYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDK 863
                  KQ+ +  L ++K L  + L +   + + KE +  +P ++KW +S ++IN+ D 
Sbjct: 738 DGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDS 797

Query: 864 INNTFHNDMXXXXXXXXXXXXXSHXXXXXXXXXXKVNEIRENEAVNEILSSNTEYVNNIN 923
           I+N F+ DM             S           K +E++  E  + IL  N      I 
Sbjct: 798 ISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVK-DEVKGYEDASTILDGNEVVKRQIA 856

Query: 924 ELKIKNMDYQEKLKCIGKSSENSINYLDSTKQVI 957
           ++  K+   +  L    KSS+  I+  D  K+ I
Sbjct: 857 DIINKDSSLRNGLYKSIKSSQGHISAFDELKERI 890

 Score =  296 bits (757), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 165/177 (93%), Gaps = 1/177 (0%)

Query: 8   GEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTV 67
            EELNITVAVR RGRNERE++AKSSVVVSVPD+MGS+EV+INT+D+VGI A MNSKTY V
Sbjct: 12  AEELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAV 71

Query: 68  DKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSD 127
           DKVFGPSA+Q L+FKEIAEPLF DF+KGYNCT+LVYGMTSTGKTYTMTGDEKLY+ ELSD
Sbjct: 72  DKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSD 131

Query: 128 SAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDN-TYKKLRIFD 183
           SAGIIPR+LFKLFE+ ++ ++DY++KCSFVELYNE+LKDLLDDSV+N + +KLRI+D
Sbjct: 132 SAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSSMRKLRIYD 188

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  526 bits (1356), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 285/544 (52%), Positives = 362/544 (66%), Gaps = 16/544 (2%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D N  IYIQNLQ+F+I NA +GIKLLQKGL+HR+VA+TKMND SSRSHTIFTITLYKE+N
Sbjct: 244 DQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYN 303

Query: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448
           G ++RVSKMNLVDLAGSENI++SGAQHQRAKEAGSINQSLLTLGRVINSL DKS+H+PFR
Sbjct: 304 GEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFR 363

Query: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508
           ESKLTRLLQDSLGGNTKT LI+TISPAKIN +ET STL+YA+KAKNIKNKP LGS IMKD
Sbjct: 364 ESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKD 423

Query: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568
           +L+KNIT EL KIK+DL+ST+ K+G+YMSQ +YKEL NDLESYKTEV+E KRA E L SQ
Sbjct: 424 ILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQ 483

Query: 569 NGSLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVGTSM 628
           N  LLKDKKASNE+N+LQR                 ++  KRE  LV     LK    +M
Sbjct: 484 NTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTM 543

Query: 629 QSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGXXXXXXXXXXXXXXXXXX 688
           QS I+ +  R+ +IE     +  NEF  +K     ILSNI                    
Sbjct: 544 QSIIKEHERRERDIESKMGDLFNNEFARVKQ---TILSNIR-------------DIEQQI 587

Query: 689 XXXXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDF 748
                  Q NID I     K+L++ Q+++  +Y  C+E+IL + P        +++ ++ 
Sbjct: 588 DWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEK 647

Query: 749 QYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSXXXXX 808
                   +TENLSD+SEE+NN ++YLN+ F +NN+E IL +H++     I++ +     
Sbjct: 648 LIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQ 707

Query: 809 XINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINNTF 868
              + ++     N  L  E L     D+++KE +  +P K+KW  S + IN  D IN  F
Sbjct: 708 QFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAF 767

Query: 869 HNDM 872
            N +
Sbjct: 768 QNGV 771

 Score =  292 bits (747), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 163/177 (92%), Gaps = 1/177 (0%)

Query: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68
           EELNITVAVRCRGRNERE++AKSSVVVSVPD+ GSNEVSINT+ +VGI A +NSKTYTVD
Sbjct: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128
           +VFGPSA+Q L+F++IAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYDGELS+S
Sbjct: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVD-NTYKKLRIFDS 184
           AGIIPR+LFKLFE+ E+  +DY++KCSFVELYNE+LKDLL DS +  + +KLRIFDS
Sbjct: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASSRKLRIFDS 189

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  516 bits (1329), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 286/548 (52%), Positives = 363/548 (66%), Gaps = 21/548 (3%)

Query: 327 APD-NNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK 385
            PD N N IYIQNLQEF+I NA +G+ LLQKGL+HR+VASTKMND SSRSHTIFTITLYK
Sbjct: 293 GPDENTNGIYIQNLQEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK 352

Query: 386 EHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHI 445
           EH   L+R+SKMNLVDLAGSENIN+SGA +QRAKE GSINQSLLTLGRVINSLADKS H+
Sbjct: 353 EHKDNLFRLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHV 412

Query: 446 PFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFI 505
           PFRESKLTRLLQDSLGGNTKT LI+TISPAK+  +ET STLEYASKAKNIKNKP LGS I
Sbjct: 413 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVI 472

Query: 506 MKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERL 565
           +KD+LLKNIT+EL K+KSDLMST+ KDG+YMS +HY+EL  +LES KTEVQESKR  E+L
Sbjct: 473 LKDILLKNITSELAKVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKL 532

Query: 566 ISQNGSLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVG 625
            SQN  LLKDK+++NE+NELQR                L+    +E  L+E I QL+   
Sbjct: 533 SSQNSMLLKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSR 592

Query: 626 TSMQSTIENYRERDLEIEESTKKIL-ENEFKFLKNELSQILSNINGXXXXXXXXXXXXXX 684
             + S ++NY+ +  +++     IL EN F     EL +IL++                 
Sbjct: 593 EKLNSLVKNYQTKQSQLKTQISNILNENLF-----ELKKILNS--------------HKD 633

Query: 685 XXXXXXXXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEIN 744
                      + N+ +I++    +L++ Q K++ +Y   IE  L   P  L K    + 
Sbjct: 634 AIRQSEGNFDVEMNLKVIKDEITSMLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVT 693

Query: 745 SIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSX 804
            ++F     +N+ITENLSD+SEEYNN K+YL+N F QNN+E +L  H+ +    +   S 
Sbjct: 694 QVEFMVTGYYNEITENLSDISEEYNNLKQYLDNDFFQNNHEDLLNIHINATSDILAQSSA 753

Query: 805 XXXXXINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKI 864
                    ++   + N KL  +      ND++ KE E  KP + KW +SIE+IN  D I
Sbjct: 754 ELFNKFKIMMDAHLMENKKLMIDNFRTATNDVITKEMELFKPKRNKWEESIELINRCDSI 813

Query: 865 NNTFHNDM 872
           NN FH++M
Sbjct: 814 NNGFHHNM 821

 Score =  272 bits (696), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 131/193 (67%), Positives = 154/193 (79%), Gaps = 18/193 (9%)

Query: 10  ELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDK 69
           ELNITVAVRCRGRNERE+ +KS VVV+VPDI G+ E+SINT+ E GI A MNSKTYTVDK
Sbjct: 28  ELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTYTVDK 87

Query: 70  VFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE--LSD 127
           VFGP+A QDL+F+E+AEPLF DF+KGYNCT+LVYGMTSTGKTYTMTGDEKLY     LSD
Sbjct: 88  VFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGTMLSD 147

Query: 128 SAGIIPRVLFKLFES------PEILND--DYIIKCSFVELYNEDLKDLLD-DSVDNTY-- 176
           +AGIIPR+LFKLF++       ++     D+++KCSFVELYNEDLKDLL+ DS D     
Sbjct: 148 AAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLLNYDSNDEQQQQ 207

Query: 177 -----KKLRIFDS 184
                +KLRIFDS
Sbjct: 208 QQLGSRKLRIFDS 220

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  507 bits (1306), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 282/596 (47%), Positives = 380/596 (63%), Gaps = 17/596 (2%)

Query: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNGGLYR 393
           IYIQNLQEF+I NA DGI LLQ+GL+HR+VASTKMND SSRSHTIFTI LYK HNG ++R
Sbjct: 261 IYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEVFR 320

Query: 394 VSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLT 453
           VSKMNLVDLAGSENI++SGAQ+QRAKEAGSINQSLLTLGRVINSLADK+ HIPFRESKLT
Sbjct: 321 VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLT 380

Query: 454 RLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKDVLLKN 513
           RLLQDSLGGNTKT LI+TISPAKIN +ETSSTLEYA+KAKNIKNKP LG+ +MKD+L+KN
Sbjct: 381 RLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKDILVKN 440

Query: 514 ITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQNGSLL 573
           IT EL KIKSD +ST+ KDG+YM+Q HYKEL +DLE+YKTEVQE KR  E++ SQN  LL
Sbjct: 441 ITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNSQNVLLL 500

Query: 574 KDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVGTSMQSTIE 633
           KDK+AS+E++ELQR                +D+ +K E  LV  I  LK+   ++Q++++
Sbjct: 501 KDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYTVQNSLK 560

Query: 634 NYRERDLEIEESTKKILENEFKFLKNELSQILSNINGXXXXXXXXXXXXXXXXXXXXXXX 693
           N  +  L+ +   + +L +     K  + + L+ +                         
Sbjct: 561 NCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKA----------------SHSSRHL 604

Query: 694 XFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDFQYNDQ 753
               NIDII+    ++L+ +   S  +  SC+E+IL   P      + ++  I    +  
Sbjct: 605 GIDGNIDIIQEELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSY 664

Query: 754 FNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSXXXXXXINKQ 813
            N++ +NL D+SEEYNNF+EYLN    +NN+E  L  H++     ++  +        + 
Sbjct: 665 SNELVKNLGDISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEM 724

Query: 814 INEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINNTFHNDMX 873
           ++     N  L  + L    +++V KE +   P K+KW  S+E IN  D +NNTF + + 
Sbjct: 725 MDSHLEENKSLMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVK 784

Query: 874 XXXXXXXXXXXXSHXXXXXXXXXXKVNEIRENEAVNEILSSNTEYVNNINELKIKN 929
                       S           K + +++ + ++E+L +NT+ VNNINE+K K+
Sbjct: 785 DALRRLEGNIEGSLEFSKNTAGDVK-DSLKKFDGISEVLKNNTKVVNNINEVKEKH 839

 Score =  306 bits (784), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 164/177 (92%), Gaps = 1/177 (0%)

Query: 8   GEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTV 67
           G+ELNITV+VRCRGRNERE++AKSSVVV+VPD+ GSNEVSINT+DE+GI A MNSKTYTV
Sbjct: 14  GQELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTV 73

Query: 68  DKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSD 127
           DKVFGPSA Q L+FK+IAEPLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LYDGELSD
Sbjct: 74  DKVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSD 133

Query: 128 SAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDN-TYKKLRIFD 183
           +AGIIPR+LFKLF++ E  ++DY++KCSF+ELYNE+LKDLL++  ++   KKLRIFD
Sbjct: 134 AAGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESGVIKKLRIFD 190

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  503 bits (1294), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 297/643 (46%), Positives = 400/643 (62%), Gaps = 24/643 (3%)

Query: 324 SEKAP-DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTIT 382
           S  AP D  N IYIQNLQEF+I NA +G+ LLQKGL+HR+VASTKMND SSRSHTIFTIT
Sbjct: 305 SSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTIT 364

Query: 383 LYKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS 442
           LYK+H   L+R+SKMNLVDLAGSENIN+SGA +QRAKEAGSINQSLLTLGRVIN+L DKS
Sbjct: 365 LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS 424

Query: 443 IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLG 502
            HIPFRESKLTRLLQDSLGGNTKT LI+TISPAK+  +ET STLEYASKAKNIKNKP LG
Sbjct: 425 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 484

Query: 503 SFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRAN 562
           SFIMKD+L+KNIT EL KIKSDL+ST+ K+G+YMSQ HYK LN+DLESYK EVQE KR  
Sbjct: 485 SFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREI 544

Query: 563 ERLISQNGSLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLK 622
           E L S+N  L+KDK  S E  + Q                 LD+ +K E  + +   +L+
Sbjct: 545 ESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQ 604

Query: 623 NVGTSMQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGXXXXXXXXXXXX 682
            +   MQ  + +Y++R+L++ +  +  +  E K LK+ L   L+ +              
Sbjct: 605 KLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTM-------------- 650

Query: 683 XXXXXXXXXXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKF--K 740
                        Q N+D+I+N  L +++ +QEK++ +Y  C+++IL++ P   N    K
Sbjct: 651 --QQESILQETNIQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEK 708

Query: 741 IEINSIDFQYNDQFNK-ITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQI 799
           I+I  +DFQ   +F K I ENLSD+SEE NN K+YL N F +NN++ +L  H++S    I
Sbjct: 709 IDIIRVDFQ---KFYKNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENI 765

Query: 800 ESFSXXXXXXINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIIN 859
           E  +        K +N+    N KL  + L    + ++ +E +  +P + KW  S ++IN
Sbjct: 766 EKRTNEFVENFKKVLNDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLIN 825

Query: 860 STDKINNTFHNDMXXXXXXXXXXXXXSHXXXXXXXXXXKVNEIRENEAVNEILSSNTEYV 919
             D +NN F+N M             S           K  ++ E+E    +L +NT++ 
Sbjct: 826 DCDSMNNEFYNSMAATLSQIKSTVDTSSNSMNESISVMK-GQVEESENAISLLKNNTKFN 884

Query: 920 NNINELKIKNMDYQEKLKCIGKSSENSINYLDSTKQVIESGLK 962
           +   +L  K+   ++ +K    S+ + I  +D     IE+ +K
Sbjct: 885 DQFEQLINKHNMLKDNIKNSITSTHSHITNVDDIYNTIENIMK 927

 Score =  290 bits (743), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 132/184 (71%), Positives = 155/184 (84%), Gaps = 9/184 (4%)

Query: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68
           EELNITVAVRCRGRNERE+  KSSVVV+VPDI GS E+SINT+ + GI A MN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128
           KVFGP ASQDL+F E+A PLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GELSD+
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNT---------YKKL 179
           AGIIPRVL KLF++ E+  +DY++KCSF+ELYNE+LKDLLD + + +          KKL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDSNSNGSSNTGFDGQFMKKL 212

Query: 180 RIFD 183
           RIFD
Sbjct: 213 RIFD 216

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  502 bits (1292), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 273/548 (49%), Positives = 367/548 (66%), Gaps = 22/548 (4%)

Query: 328 PDNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEH 387
           PD    IYIQNL+EF+I +A +GI+LLQ+GL++R+VASTKMND SSRSHTIFTI LYKEH
Sbjct: 297 PDKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEH 356

Query: 388 NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPF 447
           +G ++R+SKMNLVDLAGSENI++SGAQ+QRAKEAGSINQSLLTLGRVINSLADK+IHIPF
Sbjct: 357 DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPF 416

Query: 448 RESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMK 507
           RESKLTRLLQDSLGGNTKT LI+TISPAK+N +ET STLEYA+KAK+IKNKP LGS I K
Sbjct: 417 RESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITK 476

Query: 508 DVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLIS 567
           D+L+KNI +EL K+K+DL+ST+ +DGVYMSQ HYKEL NDLESYKTEVQE KR  + L +
Sbjct: 477 DILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTT 536

Query: 568 QNGSLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVGTS 627
           QNG LLKDKKASNE++ LQ+                +++ +++E  LV+LI +LK+    
Sbjct: 537 QNGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIE 596

Query: 628 MQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGXXXXXXXXXXXXXXXXX 687
           MQ+TI+ + ER+   +   K+I   E   LK+ L + L  IN                  
Sbjct: 597 MQATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERIN----------------KK 640

Query: 688 XXXXXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFK---IEIN 744
                     NI+ I++    I+   Q ++ H+Y  C+E+++ + P +L       I++ 
Sbjct: 641 IVINNTDLGMNIEKIKDEVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQ 700

Query: 745 SIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSX 804
            I   YN+Q   ++ ++S+L+ E+N+ K+YLN SF ++++E IL  H+E     I   S 
Sbjct: 701 KISDLYNEQ---LSISISELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRAST 757

Query: 805 XXXXXINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKI 864
                +   +  +   +  +  + L N  +DIVK E E   P K+KW  S E+IN  D +
Sbjct: 758 GIVEQLKTGLELYLEESRNIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSL 817

Query: 865 NNTFHNDM 872
           NN +  D+
Sbjct: 818 NNKYFGDI 825

 Score =  299 bits (766), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 167/179 (93%), Gaps = 2/179 (1%)

Query: 8   GEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTV 67
           G+ELNI VAVRCRGRNERE++AKSSVVVSVPD+ GS+E++INT+++VGIA  MNSKTYTV
Sbjct: 10  GDELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTV 69

Query: 68  DKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSD 127
           DKVFGPSA+Q L+F+E+AEPLF DFI+GYNCT+LVYGMTSTGKTYTMTGDE+LY+GELSD
Sbjct: 70  DKVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSD 129

Query: 128 SAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDD--SVDNTYKKLRIFDS 184
           SAGIIPRVLFKLF++ E  NDDYIIKCSF+ELYNE+LKDLLD+  ++++T KKLRIFDS
Sbjct: 130 SAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTAKKLRIFDS 188

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
           Anc_6.16
          Length = 1069

 Score =  504 bits (1297), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 295/639 (46%), Positives = 393/639 (61%), Gaps = 27/639 (4%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           DNNN IYIQNLQEF+I+NA +G+ LLQKGL++R+VASTKMND SSRSHTIFTITLYKEH 
Sbjct: 342 DNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEHQ 401

Query: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448
           G L+R+SKMNLVDLAGSENIN+SGA +QRAKE GSINQSLLTLGRVINSLAD++ HIPFR
Sbjct: 402 GTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPFR 461

Query: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508
           ESKLTRLLQDSLGGNTKT LI+TISPAK+  +ET STLEYASKAKNIKNKP LGS I KD
Sbjct: 462 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISKD 521

Query: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568
           +LLKNITTEL+++KSDL+ST+ K+G+YMSQ+HY++L N+L+++KTE  ESKR  ERL SQ
Sbjct: 522 ILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSSQ 581

Query: 569 NGSLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVGTSM 628
           N  LLKDK+ SNE+NELQR                ++    +E +LV  + +L+    + 
Sbjct: 582 NALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDTF 641

Query: 629 QSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGXXXXXXXXXXXXXXXXXX 688
           +  IENY  + ++++   ++ILE++   L+N L    + I                    
Sbjct: 642 KKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKI----------------KTLN 685

Query: 689 XXXXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDF 748
                    N+D+I+N  +K+L   QEK++  Y   IE  L   P    K   +IN I+ 
Sbjct: 686 SGTDFDIGSNLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINI 745

Query: 749 QYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSXXXXX 808
           +  +    + +NLSD+SEEYNN K+YLN +  QNN+E ++  H+ S    + + +     
Sbjct: 746 KIQNHHAAVAQNLSDISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFN 805

Query: 809 XINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINNTF 868
                +N+    N  L         ++++ KE E   P K+KW +SI++IN  D +NN F
Sbjct: 806 TFKDMMNKHLESNRNLMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGF 865

Query: 869 HNDMXXXXXXXXXXXXXSHXXXXXXXXXXKVNEIRENEAVNEILSSNTEYVNNI-----N 923
             ++             S           K     +N   N I + N    N I     N
Sbjct: 866 QKEVTDGLSYTRSKITASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFN 925

Query: 924 ELKIKNMDYQE----KLKCIGKSSENSINYL-DSTKQVI 957
           EL  KN  +Q+     LKC   +S N++N+L DS K  +
Sbjct: 926 ELARKNSIFQDNVENSLKC-AVASVNNLNHLEDSIKMAV 963

 Score =  295 bits (754), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 136/180 (75%), Positives = 159/180 (88%), Gaps = 6/180 (3%)

Query: 11  LNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKV 70
           LNITVAVRCRGRNERE++ KSSV+V+VPDI GSNEVSINT+D+VGI A MNSKTYTVDKV
Sbjct: 52  LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 71  FGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDSAG 130
           FGPSA+Q L+F E+AEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GELS+SAG
Sbjct: 112 FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 131 IIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDD------SVDNTYKKLRIFDS 184
           IIPR+LFKLF++ E+  +DY++KCSF+ELYNEDLKDLL+D      +  +   KLRIFDS
Sbjct: 172 IIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLNDNNNSINNSKSNINKLRIFDS 231

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
           YEL061C (REAL)
          Length = 1002

 Score =  499 bits (1286), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 277/550 (50%), Positives = 365/550 (66%), Gaps = 23/550 (4%)

Query: 327 AP-DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK 385
           AP D +N IYIQNLQEF+I NA +G+KLLQKGL+HR+VASTKMND SSRSHTIFTITLYK
Sbjct: 310 APNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK 369

Query: 386 EHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHI 445
           +H   L+R+SKMNLVDLAGSENIN+SGA +QRAKEAGSINQSLLTLGRVIN+L DKS HI
Sbjct: 370 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHI 429

Query: 446 PFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFI 505
           PFRESKLTRLLQDSLGGNTKT LI+TISPAK+  +ET STLEYASKAKNIKNKP LG+FI
Sbjct: 430 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFI 489

Query: 506 MKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERL 565
           MKD+L+KNIT EL KIKSDL+ST+ K+G+YM+Q HYK LN+DLESYK EVQE KR  E L
Sbjct: 490 MKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQECKREIESL 549

Query: 566 ISQNGSLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVG 625
            S+N  L+K+K  S E  + Q                 LD+ +K E  +     +L+ + 
Sbjct: 550 TSKNSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISGFNSKLQKLT 609

Query: 626 TSMQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGXXXXXXXXXXXXXXX 685
             MQ  +++Y+ R+L++ +  +  +  E K +K  L   LS +                 
Sbjct: 610 EVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTL----------------Q 653

Query: 686 XXXXXXXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKF--KIEI 743
                     Q N+DII+N  L +++ +QEK++ +Y  C+++IL++ P   N    KI+I
Sbjct: 654 QRNILQETDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDI 713

Query: 744 NSIDFQYNDQFNK-ITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESF 802
             +DF+   +F K I ENLSD+SEE NN K+Y  N F +NN++ +L +H++S   +IE  
Sbjct: 714 IGVDFE---RFYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKK 770

Query: 803 SXXXXXXINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTD 862
           +        K +N+    N KL  + L    + ++ +E    +P + KW  S ++IN  D
Sbjct: 771 TNQFVENFKKALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECD 830

Query: 863 KINNTFHNDM 872
            +NN F+N M
Sbjct: 831 SMNNEFYNSM 840

 Score =  291 bits (746), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 134/184 (72%), Positives = 155/184 (84%), Gaps = 9/184 (4%)

Query: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68
           EELNITVAVRCRGRNERE+  KSSVVV+VPDI GS E+SINT+ + GI A MN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128
           KVFGP ASQDL+F E+A PLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GELSDS
Sbjct: 93  KVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDS 152

Query: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLD--------DSVDNTY-KKL 179
           AGIIPRVL KLF++ E+  +DY++KCSF+ELYNE+LKDLLD        +  D  + KKL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNSSSNNGFDGQFMKKL 212

Query: 180 RIFD 183
           RIFD
Sbjct: 213 RIFD 216

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  499 bits (1284), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 280/630 (44%), Positives = 394/630 (62%), Gaps = 17/630 (2%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D +N IYIQNLQEF+I NA +G+ LLQ+GL+HR+VASTKMND SSRSHTIFTITLYK+H 
Sbjct: 309 DQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 368

Query: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448
             L+R+SKMNLVDLAGSENIN+SGA +QRAKEAGSINQSLLTLGRVIN+L D+S HIPFR
Sbjct: 369 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSGHIPFR 428

Query: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508
           ESKLTRLLQDSLGGNTKT LI+TISPAK+  +ET STLEYASKAKNIKNKP LG+F+MKD
Sbjct: 429 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGAFMMKD 488

Query: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568
           +L+KNIT EL KIKSDL+ST+ K+G+YMSQ HYK LN+DLES+K EVQE KR  E L S+
Sbjct: 489 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIESLASK 548

Query: 569 NGSLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVGTSM 628
           N  L+KDK  S E  + Q                 LD+ +K E  +     +L+ +   M
Sbjct: 549 NSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQKMTEVM 608

Query: 629 QSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGXXXXXXXXXXXXXXXXXX 688
           Q  +++Y++R+L++ +  +  +  E K LK  L   L N+                    
Sbjct: 609 QVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNM----------------QQKN 652

Query: 689 XXXXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDF 748
                  Q N+D+++N  L +++ +QEK++ +Y  C+++IL++ P   N    +I+ I  
Sbjct: 653 IFQETDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRI 712

Query: 749 QYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSXXXXX 808
           ++ + +  I ENLSD+SEE NN K+YL N F +NN++ +L +H++S    IE  +     
Sbjct: 713 EFQNFYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVE 772

Query: 809 XINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINNTF 868
                +N+    N KL  + + N  + ++ +E +  +P + KW  S ++IN  D +NN F
Sbjct: 773 NFKMTLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEF 832

Query: 869 HNDMXXXXXXXXXXXXXSHXXXXXXXXXXKVNEIRENEAVNEILSSNTEYVNNINELKIK 928
           +N+M             S           K  ++ E+E    +L +NT++ +   +L  K
Sbjct: 833 YNNMAATLSQIKKTVDTSSNSMNESISVMK-GQVEESENAISLLKNNTKFNDQFKQLISK 891

Query: 929 NMDYQEKLKCIGKSSENSINYLDSTKQVIE 958
           ++  ++ ++    S+ + I  +D     IE
Sbjct: 892 HIILKDNIESSITSTHSHITNVDDIYNTIE 921

 Score =  288 bits (738), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 155/184 (84%), Gaps = 9/184 (4%)

Query: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68
           EELNITVAVRCRGRNERE+  KSSVVV+VPDI GS EVSINT+ + GI A MN+K YTVD
Sbjct: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94

Query: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128
           KVFGP ASQDL+F+E+A PLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GEL+D+
Sbjct: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDA 154

Query: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLD--------DSVDNTY-KKL 179
           AGIIPRVL KLF++ E+   DY++KCSF+ELYNE+LKDLLD        +  D  + KKL
Sbjct: 155 AGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKL 214

Query: 180 RIFD 183
           RIFD
Sbjct: 215 RIFD 218

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  487 bits (1253), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 281/552 (50%), Positives = 367/552 (66%), Gaps = 21/552 (3%)

Query: 324 SEKAP-DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTIT 382
           S  AP D +N IYIQNLQEF+I NA +G+ LLQ+GL+HR+VASTKMND SSRSHTIFTIT
Sbjct: 304 SSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTIT 363

Query: 383 LYKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS 442
           LYK+H   L+R+SKMNLVDLAGSENIN+SGA +QRAKEAGSINQSLLTLGRVIN+LADKS
Sbjct: 364 LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALADKS 423

Query: 443 IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLG 502
            HIPFRESKLTRLLQDSLGGNTKT LI+TISPAK+  +ET STLEYASKAKNIKNKP LG
Sbjct: 424 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 483

Query: 503 SFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRAN 562
           +FIMKD+L+KNIT EL KIKSDL+ST+ K+G+YMSQ HYK LN+DLESYK EVQE KR  
Sbjct: 484 AFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRDI 543

Query: 563 ERLISQNGSLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLK 622
           E L S+N  LLKDK  S +  + Q                 LD+ +K E  +     +L+
Sbjct: 544 ESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFNNKLQ 603

Query: 623 NVGTSMQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGXXXXXXXXXXXX 682
            +   MQ  +++Y+ R+L++ +  +  +  E K LK  L   LS +              
Sbjct: 604 KLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGM-------------- 649

Query: 683 XXXXXXXXXXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKF--K 740
                        Q N+DII+N  L +++ +QEK++ +Y  C+++IL++ P   N    K
Sbjct: 650 --EQNNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEK 707

Query: 741 IEINSIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIE 800
           I+I  +DFQ    +N I ENLSD+SEE NN K+YL N F +NN++ +L +H++S    IE
Sbjct: 708 IDIIRVDFQR--FYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIE 765

Query: 801 SFSXXXXXXINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINS 860
             +          +N+    N KL  + L N  + ++ +E +  +P + KW  S ++IN 
Sbjct: 766 KKTSEFVENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINK 825

Query: 861 TDKINNTFHNDM 872
            D +NN F+N+M
Sbjct: 826 CDSMNNEFYNNM 837

 Score =  288 bits (738), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 134/184 (72%), Positives = 157/184 (85%), Gaps = 9/184 (4%)

Query: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68
           EELNITVAVRCRGRNERE+  KSSVVV+VPDI GS EVSINT+ + GI A MN+K YTVD
Sbjct: 33  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGITAQMNAKRYTVD 92

Query: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128
           KVFGP ASQDL+F E+A PLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GELSD+
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152

Query: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNT---------YKKL 179
           AGIIPRVL KLF++ E+  +DY++KCSF+ELYNE+LKDLLD++ +N+          KKL
Sbjct: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSSNNGFEGPFMKKL 212

Query: 180 RIFD 183
           RIFD
Sbjct: 213 RIFD 216

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  478 bits (1230), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 263/547 (48%), Positives = 356/547 (65%), Gaps = 19/547 (3%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D    IYIQNLQEF+I  A +GIKLLQKGL++R+VASTKMND SSRSHTIFTITL+KE  
Sbjct: 285 DQTAGIYIQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVK 344

Query: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448
           G ++R+SKMNLVDLAGSENIN+SGA +QRAKEAGSINQSLLTLGRVINSLADK++H+PFR
Sbjct: 345 GEIFRLSKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFR 404

Query: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508
           ESKLTRLLQDSLGGNTKT LI+TISPAK+ ++ET STLEYASKAKNIKNKP LGSFIMKD
Sbjct: 405 ESKLTRLLQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKD 464

Query: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568
           +LLKNITTEL KIKSDL+ST+ KDG+YM QQHYKEL  DL++YKTE+QE KR  E L SQ
Sbjct: 465 ILLKNITTELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQ 524

Query: 569 NGSLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVGTSM 628
           N  LLKDK+  NE NELQR                ++     E+ L   I+      + +
Sbjct: 525 NALLLKDKRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKL 584

Query: 629 QSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGXXXXXXXXXXXXXXXXXX 688
              I+  + R+  +    K +L++   ++  +L+  + N                     
Sbjct: 585 TKIIDEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENF----------------KDQG 628

Query: 689 XXXXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDF 748
                   +N+ +I++    +L   ++  +  Y  CI + LSD P + ++    + ++  
Sbjct: 629 INQNFTVDENLQLIKSEMTNLLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKA 688

Query: 749 QYNDQFNKITENLSDLSEEYNNFKEYLNNSFL---QNNYELILKNHLESGQSQIESFSXX 805
             ++ +++I ENLSDLSEEYNNFK+++ + F    + +   +L  ++ + Q+ IES S  
Sbjct: 689 LTSNYYSQIAENLSDLSEEYNNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSND 748

Query: 806 XXXXINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKIN 865
               I   +NE    N +L    L+N+  +++  E + +KP   KW +S E+IN +D +N
Sbjct: 749 VMSTIQNLLNEHLRANKELIINSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALN 808

Query: 866 NTFHNDM 872
           N F++++
Sbjct: 809 NEFNDNV 815

 Score =  307 bits (786), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 161/180 (89%), Gaps = 3/180 (1%)

Query: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68
           EELNITVAVRCRGRN+RE+ AKSSVVV+VPDIMGS EV+INTS+++G  A MNSKTYTVD
Sbjct: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74

Query: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128
           KVFGPSA+Q L+F EIAEPLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+ ELSDS
Sbjct: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134

Query: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDN---TYKKLRIFDSM 185
           AGIIPR+LFKLFE+ E LN+D+I+KCSFVELYNE+LKDLL    +N    +KKLRIFDS+
Sbjct: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGNFKKLRIFDSL 194

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  474 bits (1221), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 267/547 (48%), Positives = 359/547 (65%), Gaps = 26/547 (4%)

Query: 331 NNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNGG 390
           N  IYIQNL+EF+I NA +GI+LLQKGL++R+VASTKMNDVSSRSHTIFTI LYKEH G 
Sbjct: 235 NASIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGE 294

Query: 391 LYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRES 450
           ++++SKMNLVDLAGSENI++SGAQ+QRAKEAGSINQSLLTLGRVINS+ADK+IHIPFRES
Sbjct: 295 IFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRES 354

Query: 451 KLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKDVL 510
           KLTRLLQDSLGGNTKT LI+TISPAK+N +ET STLEYA+KAK+IKNKP LGS IMKDV 
Sbjct: 355 KLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVR 414

Query: 511 LKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQNG 570
           LK++  EL KIK DL ST+ KDGVYM+Q HYK+L NDLESYKTE+QE  R  + L  QN 
Sbjct: 415 LKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNA 474

Query: 571 SLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVGTSMQS 630
            LLKDKKASNE+N+LQ                 L+  +K+E ILVE +   +     M++
Sbjct: 475 LLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLKMKT 534

Query: 631 TIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGXXXXXXXXXXXXXXXXXXXX 690
            I+ Y E++  I+ + K I  +E   LK EL  ++ N+NG                    
Sbjct: 535 VIKEYSEKEERIQSNMKSIFNDELIKLK-EL--LIENLNG-------------IAKENLI 578

Query: 691 XXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDFQY 750
                + NI +I++  + I+ + QE S+ ++    ++I+ + P IL  F     S D + 
Sbjct: 579 VQTNVKDNIKLIKDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMF-----SSDVKK 633

Query: 751 NDQFNK-----ITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSXX 805
           N + N+     + ENL  + ++Y+   EY +N F ++N+  I+ +H+ + ++ IE     
Sbjct: 634 NQELNETYFANLFENLESIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSD 693

Query: 806 XXXXINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKIN 865
                 + +  F   N KL  E L  + +D+++ E  S K +K +W  S + IN  D +N
Sbjct: 694 IFKQFQQNMEAFAEQNEKLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLN 753

Query: 866 NTFHNDM 872
           N++H+ M
Sbjct: 754 NSYHDQM 760

 Score =  300 bits (769), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 136/184 (73%), Positives = 163/184 (88%), Gaps = 2/184 (1%)

Query: 2   QKTHTSGEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEV--GIAAH 59
           QK     +E+NI VAVRCRGRN+RE+++KSSV+VSVPD+MGSNE+SINTSD++  G+ A 
Sbjct: 6   QKIEDDTDEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQ 65

Query: 60  MNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEK 119
           +NSKTYTVDKVFGPSA+Q L+F+EIAEPLF DF++GYNCT+LVYGMTSTGKTYTMTGDEK
Sbjct: 66  LNSKTYTVDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEK 125

Query: 120 LYDGELSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYKKL 179
           LY G+LSDSAGIIPRVLFKLFE+ E  +D+Y+IKCSF+ELYNE+LKDLL DS +   KKL
Sbjct: 126 LYKGDLSDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTKLKKL 185

Query: 180 RIFD 183
           RIFD
Sbjct: 186 RIFD 189

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  471 bits (1212), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 259/542 (47%), Positives = 352/542 (64%), Gaps = 17/542 (3%)

Query: 331 NNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNGG 390
           N+ I+IQNLQEF+I +A +GI+LLQ+GLRHR+VASTKMNDVSSRSHTIFTI LY++ NG 
Sbjct: 234 NSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGE 293

Query: 391 LYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRES 450
            +RVSKMNLVDLAGSENI++SGAQ+QRAKEAGSINQSLLTLGRVINSLADK+ HIPFRES
Sbjct: 294 SFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRES 353

Query: 451 KLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKDVL 510
           KLTRLLQDSLGGNTKT LI+TISPAKIN +ETSSTLEYA+KAKNIKNKP +GSFIMKDVL
Sbjct: 354 KLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVL 413

Query: 511 LKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQNG 570
           +KN+T EL KI+SDL++T+ KDG+YMSQ++YKEL N+LE+YKTEVQE KRA ERL +QNG
Sbjct: 414 VKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNG 473

Query: 571 SLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVGTSMQS 630
            L K+K+ +NE+NE QR                +D  +K E  L  ++++L     +MQ+
Sbjct: 474 LLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQN 533

Query: 631 TIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGXXXXXXXXXXXXXXXXXXXX 690
           +++ Y ++    +   +++L       K+ L   +  + G                    
Sbjct: 534 SLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKG-----------------TEE 576

Query: 691 XXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDFQY 750
                  NID +     +I   +   +  I    + +I    P  L   + ++ SI    
Sbjct: 577 DGFDVDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVV 636

Query: 751 NDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSXXXXXXI 810
               + +  +LS +SEEYN+ K+YLN  F +NN++  L  H++    Q++  +      +
Sbjct: 637 GSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKL 696

Query: 811 NKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINNTFHN 870
            + +NE    N ++  + L N  +++V KE   + P K+ W  S+E IN  DK+N+ F  
Sbjct: 697 REMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEK 756

Query: 871 DM 872
           D+
Sbjct: 757 DI 758

 Score =  301 bits (772), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 137/178 (76%), Positives = 163/178 (91%), Gaps = 1/178 (0%)

Query: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68
           EELNITVAVRCRGRNE+EV+AKSSVVV+VPD+ G+NEVSINT+ + GI A +NSKTYTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128
           +VFGPSA Q L+FK IAEPLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LYDGELS+ 
Sbjct: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTY-KKLRIFDSM 185
           AGIIPRVLFKLF++ +  NDDY+IKCSF+ELYNE+LKDLLD++ D++  +KLRIFDS+
Sbjct: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPDSSMPRKLRIFDSV 182

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  466 bits (1199), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 259/543 (47%), Positives = 355/543 (65%), Gaps = 28/543 (5%)

Query: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNGGLYR 393
           I+IQNLQEF+I +A +GI+LLQ+GLRHR+VASTKMNDVSSRSHTIFTI LYK+ NG  +R
Sbjct: 238 IHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYKKCNGESFR 297

Query: 394 VSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLT 453
           VSKMNLVDLAGSENI++SGAQ+QRAKEAGSINQSLLTLGRVINSLADKS+HIPFRESKLT
Sbjct: 298 VSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLHIPFRESKLT 357

Query: 454 RLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKDVLLKN 513
           RLLQDSLGGNTKT LI+TISPAKIN +ETSSTLEYA+KAKNIKNKP +GSFIMKDVLLK+
Sbjct: 358 RLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLLKS 417

Query: 514 ITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQNGSLL 573
           +T EL KIKSDL+ST+ KDG+YMSQ++YKEL N+LE+YKTEV+E KRA E++ +QN  L+
Sbjct: 418 VTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEKVSAQNSLLI 477

Query: 574 KDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVGTSMQSTIE 633
           K+K+ SNE+NE Q+                +D  +K E  L  ++++L     +MQ ++ 
Sbjct: 478 KEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRALHTMQQSLR 537

Query: 634 NYRERDLEIEESTKKILENEF----KFLKNELSQILSNI--NGXXXXXXXXXXXXXXXXX 687
            Y ++        +++L +      K L +E+ ++  N+  NG                 
Sbjct: 538 IYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENG----------------- 580

Query: 688 XXXXXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSID 747
                   + N+D +     +I   +   +  ++ + I+++    P        ++ SI 
Sbjct: 581 -----DDVEVNVDAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESIT 635

Query: 748 FQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSXXXX 807
              +   + +  +LS +SEEYNN K+YLN  F +NN++  L  H++    Q++  +    
Sbjct: 636 SVVSSYSSNLMIHLSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIF 695

Query: 808 XXINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINNT 867
             + + +NE    N +   + L +  +++V KE   + P K+ W  S+E IN  DK+NN 
Sbjct: 696 LKLREMLNEELDTNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNV 755

Query: 868 FHN 870
           F N
Sbjct: 756 FEN 758

 Score =  298 bits (764), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 159/176 (90%), Gaps = 1/176 (0%)

Query: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68
           EELNITVAVRCRGRNE+EV+A+SSVVV+VPD+ G+NEVSINT+ + GI A +NSKTYTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128
           KVFGPSA Q L+FK IAEPLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDE+LYDGELS+ 
Sbjct: 65  KVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTY-KKLRIFD 183
           AGIIPRVLFKLF++     DDY+IKCSF+ELYNE+LKDLLD++ D++  KKLRIFD
Sbjct: 125 AGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPDSSMPKKLRIFD 180

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  462 bits (1190), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 255/543 (46%), Positives = 348/543 (64%), Gaps = 18/543 (3%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           + ++ IYIQNLQEF+I NA +GI +LQKGL+HR+VASTKMND SSRSHTIFTI LYK + 
Sbjct: 242 EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE 301

Query: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448
           G L+R+SKMNLVDLAGSENI++SGAQ+QRAKEAGSINQSLLTLGRVINSLADKSIHIPFR
Sbjct: 302 GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 361

Query: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508
           ESKLTRLLQDSLGGNTKT LI+TISPAKIN DETSSTLEYA+KAKNIKN+P LGSF+MKD
Sbjct: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD 421

Query: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568
           +L+K+I++EL+K+KSD +ST+ K+G+YMS +HY+E+ NDLE+Y+TE+QESKR  E   SQ
Sbjct: 422 ILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQ 481

Query: 569 NGSLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVGTSM 628
           N  LLKDKKAS +LNELQ                 ++  ++ E  LV  I +LK    +M
Sbjct: 482 NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTM 541

Query: 629 QSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGXXXXXXXXXXXXXXXXXX 688
           + +++NY   +L ++   K++L       +  + Q L  +                    
Sbjct: 542 KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVK----------------TRM 585

Query: 689 XXXXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNI-LNKFKIEINSID 747
                    N+D I     + L  V+     + ++ + +I+ D P+    +FK  +  +D
Sbjct: 586 LDKNLSINHNMDEIRTIFHETLDSVRSAGSDMCTNIV-KIVKDQPSTSYQQFKEALGDLD 644

Query: 748 FQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSXXXX 807
            +       +T  L++++EE NN KEYL+  FL+NN + +L   +E    + ++ S    
Sbjct: 645 TKVQTYSVTLTNKLTEMTEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALI 704

Query: 808 XXINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINNT 867
             +   +      +  L    + +  ++++ KE E  +P KE+WV S E IN  D  +  
Sbjct: 705 SSVVSMMESHMEESRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQ 764

Query: 868 FHN 870
           F N
Sbjct: 765 FEN 767

 Score =  304 bits (778), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 161/176 (91%), Gaps = 1/176 (0%)

Query: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68
           EELNITVAVRCRGRNERE++AKS+VVV+VPD+ GSNEVSINT+ ++GIA  MNS+TYTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78

Query: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128
           +VFGPSA Q L+FK IAEPLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYDGELSDS
Sbjct: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSDS 138

Query: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYKKLRIFDS 184
           AGIIPRVLF+LF++ E    D+++KCS++ELYNE+LKDLLDD+ D + K+LRIFDS
Sbjct: 139 AGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPDYS-KRLRIFDS 193

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  462 bits (1189), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 247/546 (45%), Positives = 353/546 (64%), Gaps = 20/546 (3%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D +  IYIQNL+EF+I +A +G++LLQKGL+ R+VASTKMND SSRSH+IFTITLYKE N
Sbjct: 304 DQSASIYIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKEQN 363

Query: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448
           G L+RVSKMNLVDLAGSENI++SGA +QRAKEAGSINQSLLTLGRVINSLADKS HIPFR
Sbjct: 364 GELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIPFR 423

Query: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508
           ESKLTRLLQDSLGGNTKT LI+TISPAK+  +ET STLEYASKAKNIKNKP LG+FIMKD
Sbjct: 424 ESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIMKD 483

Query: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568
           +L+++IT+EL KIKSDL+ST+ K+GVYMS +HYK+L+ D+E YKTE++ESKRA E L +Q
Sbjct: 484 ILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLTAQ 543

Query: 569 NGSLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVGTSM 628
           N  L +++ +  + N   +                L E   +E  +  L++ ++     M
Sbjct: 544 NAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANEEM 603

Query: 629 QSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNI--NGXXXXXXXXXXXXXXXX 686
           + TI  +  +  E+++S    + +E   +++ L + +  +  NG                
Sbjct: 604 KKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNG---------------- 647

Query: 687 XXXXXXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSI 746
                      N+  +E   +K++K  +E++   Y  C++ +L + P +       +++I
Sbjct: 648 --DLKDTEISGNLMRLEKEVVKVIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNI 705

Query: 747 DFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSXXX 806
                +  +KI E LSD+SEEYNN K+YL N+F +NN+E +L +H+++  +Q+E  S   
Sbjct: 706 SKLAEENHSKIAETLSDVSEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQL 765

Query: 807 XXXINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINN 866
                  +++    N +   E +  + ++++  E +     + KW KS  +IN  D +N+
Sbjct: 766 MQNFTMMLDKHIQENKRHMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNH 825

Query: 867 TFHNDM 872
           +FH  +
Sbjct: 826 SFHQAL 831

 Score =  297 bits (760), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 139/179 (77%), Positives = 160/179 (89%), Gaps = 3/179 (1%)

Query: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68
           EELNI VAVRCRGRNERE++AKSSVVV VPD   +NEVSINT+D+VGIAA MNSKTYTVD
Sbjct: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128
           KVFGPSASQ L+++EIAEPLF+DFIKGYNCTILVYGMTSTGKTYTMTGDEKL++GEL D+
Sbjct: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGELGDA 149

Query: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDD---SVDNTYKKLRIFDS 184
           AGIIPRVLF+LF++ E   DDY++KCSFVELYNE+LKDLLD    + ++  KKLRIFDS
Sbjct: 150 AGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDNKKLRIFDS 208

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  446 bits (1146), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 241/549 (43%), Positives = 351/549 (63%), Gaps = 23/549 (4%)

Query: 327 APDNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKE 386
            P     IYIQNL++F+I+ A +G++LLQ+GL+ R+VA+TK+NDVSSRSHTIFTITLYK+
Sbjct: 263 VPPTQTGIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTITLYKK 322

Query: 387 HNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIP 446
               LYR+SK+NLVDLAGSEN+NK+GA + RAKE+GSINQSLLTLGRVINSLADKS HIP
Sbjct: 323 FKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIP 382

Query: 447 FRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIM 506
           FRESKLTRLLQDSLGGNTKTVLI+TISPAKI  +ET STLEYASKAKNIKNKP LGSFI+
Sbjct: 383 FRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFII 442

Query: 507 KDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLI 566
           KD+LLK+++ EL K+++DL  T+ K+G+Y+SQ++YKE+ +DL+++KTE+ E KR N+ L+
Sbjct: 443 KDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLV 502

Query: 567 SQNGSLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVGT 626
            +N  L K+KK+  E  +  +                L +   +   L E +  +  + T
Sbjct: 503 QENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQT 562

Query: 627 SMQSTIENYRERDLEIEESTKKILENEFKFLKNE-LSQ--ILSNINGXXXXXXXXXXXXX 683
            ++S IE Y+++    +   +++L++E   L  + LSQ   L N+N              
Sbjct: 563 ELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVNS------------- 609

Query: 684 XXXXXXXXXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEI 743
                         +ID I    + +L+  +E ++ +Y SCI+ +L + P I       +
Sbjct: 610 -------GNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNV 662

Query: 744 NSIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFS 803
             I     + + ++  N SDLSEE+N FK+YL+  F QNN+  +++ H +   S ++  S
Sbjct: 663 GDIRGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMS 722

Query: 804 XXXXXXINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDK 863
                 +   I  +   N+++    +N++  D++ KE +   P K KW +SI++IN +D 
Sbjct: 723 DDLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDS 782

Query: 864 INNTFHNDM 872
           ++N F N+M
Sbjct: 783 LSNKFRNNM 791

 Score =  229 bits (585), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 145/193 (75%), Gaps = 20/193 (10%)

Query: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68
           +++NITVAVRCRGRN+RE++AKS +VV+VPD+  + EVSINTS   GI A + +KTYTVD
Sbjct: 23  DDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEAQLQAKTYTVD 82

Query: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGD-EKLYDGELSD 127
           KV+GP +SQ L+F++ AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD E   +G+++ 
Sbjct: 83  KVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG 142

Query: 128 SAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVD-------------- 173
            AGI PR+L KLF   E L DDY++KCSFVELYNEDL+DLL +  D              
Sbjct: 143 QAGIAPRILVKLF---ECLQDDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQPE 199

Query: 174 --NTYKKLRIFDS 184
             N  KKLRIFDS
Sbjct: 200 SLNASKKLRIFDS 212

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  445 bits (1144), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 253/558 (45%), Positives = 353/558 (63%), Gaps = 36/558 (6%)

Query: 318 KEQLTNSEKAPDNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHT 377
           K+QL+ S       + IY+QN+QEF+I NA +GI +LQKGL+HR+VASTKMND SSRSHT
Sbjct: 238 KQQLSES------GSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHT 291

Query: 378 IFTITLYKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINS 437
           IFTI LYK  +G L+RVSKMNLVDLAGSENI++SGAQ+QRAKEAGSINQSLLTLGRVINS
Sbjct: 292 IFTIMLYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINS 351

Query: 438 LADKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKN 497
           LADKSIHIPFRESKLTRLLQDSLGGNTKT LI+TISPAKIN DETSSTLEYA+KAKNIKN
Sbjct: 352 LADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKN 411

Query: 498 KPHLGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQE 557
           +P LG+ +MKD+L+KNI++EL KIKSD +ST+ KDG+YMS +HY+E+ NDLE+ +TE+QE
Sbjct: 412 RPQLGALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQE 471

Query: 558 SKRANERLISQNGSLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVEL 617
           SKR  E L SQN  LLKDKKAS E+ ELQ                 ++  +  E  L   
Sbjct: 472 SKRQIESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATT 531

Query: 618 IRQLKNVGTSMQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGXXXXXXX 677
           I +LK    +MQ ++++Y   +L ++   K++L       +  ++Q L  +         
Sbjct: 532 IHKLKEALHTMQGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVK-------- 583

Query: 678 XXXXXXXXXXXXXXXXXFQKNIDIIEN----TTL--KILKQVQEKSQHIYSSCIERILSD 731
                              KN+ I EN    TT+    LK V+     +  + + +++ +
Sbjct: 584 --------------VSMLDKNLSIKENINNITTIFDDTLKSVEANGSDMCDTLV-KLIKE 628

Query: 732 IPNI-LNKFKIEINSIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKN 790
            P++ L +F   ++S+  + +   N +T  L+++SEE N+ +EYL+    +N+ + +L  
Sbjct: 629 TPSMYLKEFNETVSSLKSELSSYSNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDL 688

Query: 791 HLESGQSQIESFSXXXXXXINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEK 850
            +ES   ++++ S      +   +      +  L    + +  N+I+  E    +P +++
Sbjct: 689 RMESVYQKVKNDSDQLLSKLVSMVGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDR 748

Query: 851 WVKSIEIINSTDKINNTF 868
           W+ S + IN  D  +  F
Sbjct: 749 WIASCDNINQCDASHQNF 766

 Score =  313 bits (803), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 140/176 (79%), Positives = 166/176 (94%), Gaps = 1/176 (0%)

Query: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68
           EELNITVAVRCRGRNERE++AKSSVVV+VPD+ GSNEVSINT+DEVGIAA MNS+TYTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78

Query: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128
           KVFGPSA Q L+FKEIAEPLF+DF+KGYNCT+LVYGMTSTGKTYTMTGDEKLYDG+LSDS
Sbjct: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138

Query: 129 AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYKKLRIFDS 184
           AGIIPR++FKLF++ E  + D+++KCS++ELYNE+LKDLLD+S D++ K+LRIFDS
Sbjct: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS-KRLRIFDS 193

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  442 bits (1136), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 244/538 (45%), Positives = 345/538 (64%), Gaps = 16/538 (2%)

Query: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNGGLYR 393
           IYIQ+LQEF+I +A +G++LLQKGL HR+VASTKMNDVSSRSHTIFT+TLYK  NG  +R
Sbjct: 269 IYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGETFR 328

Query: 394 VSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLT 453
           VSK+NLVDLAGSENI++SGAQ+QRAKEAGSINQSLLTLGRVINSLADK+ HIPFRESKLT
Sbjct: 329 VSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESKLT 388

Query: 454 RLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKDVLLKN 513
           RLLQDSLGGNTKT LI+TISPAKIN +ETSSTLEYA+KAKNIKNKP LGSF+MKD+L+KN
Sbjct: 389 RLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILVKN 448

Query: 514 ITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQNGSLL 573
           I+ EL K+KSD +ST+ K+G+YMS  HY E+ ND+E+YKTE+QES+R  E+L SQN  L 
Sbjct: 449 ISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQLLH 508

Query: 574 KDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVGTSMQSTIE 633
           KDKK+S +  E QR                +D  +K E  L  +I +LK+   +MQ  ++
Sbjct: 509 KDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGALK 568

Query: 634 NYRERDLEIEESTKKILENEFKFLKNELSQILSNINGXXXXXXXXXXXXXXXXXXXXXXX 693
            + + +  ++   +K+L +     + ++   L N+                         
Sbjct: 569 THEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNL----------------KQQALEQSF 612

Query: 694 XFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINSIDFQYNDQ 753
               +I+ ++++   +L+ V++ +  +  +  ++++ D P   N    E+N +  + ++ 
Sbjct: 613 TIDDDINNVKDSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEH 672

Query: 754 FNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSXXXXXXINKQ 813
            +++ E LS ++ E NN K YL+  F +NN++ IL  H +    Q+   S      I   
Sbjct: 673 TDRLKEGLSQITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNI 732

Query: 814 INEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKINNTFHND 871
           I++    N  L  + L     +++ +E    +P ++ W +S   IN  D ++N F +D
Sbjct: 733 ISDHVEQNRTLLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDD 790

 Score =  307 bits (786), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 137/181 (75%), Positives = 163/181 (90%), Gaps = 3/181 (1%)

Query: 8   GEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTV 67
           G+ELNITVAVRCRGRNE+E++AKSSVVV+ PD++G+NEVSINTS ++GI A MNSKTYTV
Sbjct: 10  GDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTV 69

Query: 68  DKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSD 127
           DKVFGPSA Q L+FKEIA+P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYDGELS+
Sbjct: 70  DKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSE 129

Query: 128 SAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVD---NTYKKLRIFDS 184
           +AGIIPRVLFKLF++ E+   DY++KCSF+ELYNE+LKDLLDD  D   N  +KLRI+DS
Sbjct: 130 AAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQDSGGNNSRKLRIYDS 189

Query: 185 M 185
           +
Sbjct: 190 L 190

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  306 bits (784), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 189/545 (34%), Positives = 312/545 (57%), Gaps = 38/545 (6%)

Query: 335 YIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNGGLYRV 394
           YIQNL+EF+I NA +GI+LL +GL++R++AS+K    SSR+ TIFTI LYKE  G ++RV
Sbjct: 258 YIQNLEEFHITNAKEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRV 317

Query: 395 SKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTR 454
           SK N VDLAG+E+ +K    +QR K+   INQ +  L +++NSL +K   IPF++SKLT 
Sbjct: 318 SKWNFVDLAGAEHSHKIEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIPFKDSKLTY 377

Query: 455 LLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKDVLLKNI 514
           L++D+L GN+K++ I T+   K ++DE   TLE+ +K +++K  P LG  I K+ L+K+I
Sbjct: 378 LIKDTLEGNSKSIFILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSI 437

Query: 515 TTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQNGSLLK 574
           + EL K+KSDL+ST+ K+GVYMS +HY  L  DL+ +K E+ + K+  + L  Q+ +L K
Sbjct: 438 SNELAKVKSDLLSTKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRK 497

Query: 575 DKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVGTSMQSTIEN 634
           DK+A  E+NE+QR                +++  +RE  L+    +LK    +M  TI  
Sbjct: 498 DKRAFEEVNEVQRIKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIAR 557

Query: 635 YRERDLEIEESTKKILENEFKFLKNELSQILSNINGXXXXXXXXXXXXXXXXXXXXXXXX 694
           Y +R+  ++   K +   E   LK   S +L N+                          
Sbjct: 558 YTDRESSVQTQMKTLFNEELSKLK---SMLLKNL------------------------RQ 590

Query: 695 FQKN--IDIIE-----NTTLKILKQVQEKSQH----IYSSCIERILSDIPNILNKFKIEI 743
           F+KN  ID +E     N   + +KQ+ + S++    ++  CI+++  + P + + F  ++
Sbjct: 591 FEKNELIDNLEIENNLNKAHEEIKQILQISENEIDSLFLDCIKKMSEESPKLFSSFIQDV 650

Query: 744 NSIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFS 803
           + ++   ++ +N + E LSD+SEE+NN K+Y+N  F +NN+E +LK ++     Q++  S
Sbjct: 651 SRLENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELLKTYVNKTYHQVQKSS 710

Query: 804 XXXXXXINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDK 863
                  N  +  +   N  +  + + +  +++++ E     P KEKW KSIE+I  +  
Sbjct: 711 DDFLLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQKEKWEKSIELIEKSKH 770

Query: 864 INNTF 868
            +N F
Sbjct: 771 SSNEF 775

 Score =  125 bits (313), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 69/183 (37%), Positives = 106/183 (57%), Gaps = 19/183 (10%)

Query: 10  ELNITVAVRCRGR--NEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTV 67
           E NI V  R +G+  NE+    +  +++  P +     +     D+         + + +
Sbjct: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGL-----IKFKGKDDAV------KREFGM 60

Query: 68  DKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE-KLYDGELS 126
           D +F     Q+ ++ +  +P+F+DFI GYNC+ LVYG T +GKTYT++G+E  L   E S
Sbjct: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120

Query: 127 D-SAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDS----VDNTYKKLRI 181
             S G+IPRVL +LF+     N D+++KCS+VE+YNE+LKDLL D     +  + KKLRI
Sbjct: 121 RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSASIKKLRI 180

Query: 182 FDS 184
            DS
Sbjct: 181 VDS 183

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  250 bits (638), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 124/218 (56%), Positives = 171/218 (78%), Gaps = 8/218 (3%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITL----- 383
           +NN+ I ++ +QE +IN+A +G+ LL +G   RKVA+TK ND+SSRSHT+FTIT      
Sbjct: 236 NNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIEQ 295

Query: 384 -YKEH--NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLAD 440
             KEH  N    ++ K+NLVDLAGSENIN+SGA+++RA+EAG IN+SLLTLGRVIN+L D
Sbjct: 296 DSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 355

Query: 441 KSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPH 500
            S HIP+RESKLTRLLQDSLGG TKT +I+T+SPAKI+++ET+STLEYA++AK+IKN P 
Sbjct: 356 HSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSPQ 415

Query: 501 LGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQ 538
           +   + KD  LK+   E+ K+++DL ++R K G++++Q
Sbjct: 416 VNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQ 453

 Score =  151 bits (382), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 84/188 (44%), Positives = 112/188 (59%), Gaps = 18/188 (9%)

Query: 10  ELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDK 69
           E NI V VRCR RN RE+  KSSVV+S     G   +  N S +   +   + KTY  D+
Sbjct: 50  ESNIHVYVRCRSRNRREIDEKSSVVISTLGPQGKEIILSNGSHQ---SYSSSKKTYQFDQ 106

Query: 70  VFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE----- 124
           VFG  + Q+++F   A+    + + GYNCTI  YG T TGKTYTM+GD  +  G+     
Sbjct: 107 VFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDVQSTD 165

Query: 125 ---LSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVD------NT 175
              L + AGIIPRVL  LF+    LN +Y +K SF+ELYNE+LKDLL D+ D      ++
Sbjct: 166 NLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNEDDDPTANDS 225

Query: 176 YKKLRIFD 183
            K++RIFD
Sbjct: 226 KKQIRIFD 233

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  249 bits (635), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/218 (56%), Positives = 171/218 (78%), Gaps = 8/218 (3%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITL----- 383
           +NN+ I ++ +QE +IN+A +G+ LL +G   RKVA+TK ND+SSRSHT+FTIT      
Sbjct: 236 NNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQ 295

Query: 384 -YKEH--NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLAD 440
             K+H  N    ++ K+NLVDLAGSENIN+SGA+++RA+EAG IN+SLLTLGRVIN+L D
Sbjct: 296 DSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 355

Query: 441 KSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPH 500
            S HIP+RESKLTRLLQDSLGG TKT +I+T+SPAKI+++ET+STLEYA++AK+IKN P 
Sbjct: 356 HSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTPQ 415

Query: 501 LGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQ 538
           +   + KD  LK+   E+ K+K+DL ++R K G++++Q
Sbjct: 416 VNQSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQ 453

 Score =  141 bits (355), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 86/188 (45%), Positives = 112/188 (59%), Gaps = 22/188 (11%)

Query: 12  NITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKVF 71
           NI V VRCR RN+RE+  KSSVV+S     G   +  N S +   +   + KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQ---SYSSSKKTYQFDQVF 108

Query: 72  GPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGD----------EKLY 121
           G  + Q+ +F   A+    + + GYNCTI  YG T TGKTYTM+GD          +KL 
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKLL 168

Query: 122 DGELSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDS------VDNT 175
            GE    AGIIPRVL  LF+    LN +Y +K SF+ELYNE+LKDLL DS      V++T
Sbjct: 169 LGE---HAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLKDLLSDSDDDDPVVNDT 225

Query: 176 YKKLRIFD 183
            +++RIFD
Sbjct: 226 KRQIRIFD 233

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  248 bits (633), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 124/218 (56%), Positives = 171/218 (78%), Gaps = 8/218 (3%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITL----- 383
           +NN+ I ++ +QE +IN+A +G+ LL +G   RKVA+TK ND+SSRSHT+FTIT      
Sbjct: 235 NNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQ 294

Query: 384 -YKEH--NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLAD 440
             K+H  N    ++ K+NLVDLAGSENIN+SGA+++RA+EAG IN+SLLTLGRVIN+L D
Sbjct: 295 DSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 354

Query: 441 KSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPH 500
            S HIP+RESKLTRLLQDSLGG TKT +I+TISPAKI+++ET+STLEYA++AK+IKN P 
Sbjct: 355 HSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTPQ 414

Query: 501 LGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQ 538
           +   + KD  LK+   E+ K+++DL ++R K G++++Q
Sbjct: 415 VNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQ 452

 Score =  148 bits (373), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/186 (43%), Positives = 112/186 (60%), Gaps = 18/186 (9%)

Query: 12  NITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKVF 71
           NI V VRCR RN+RE+  KSSVV+S     G   +  N S +   +   + KTY  D+VF
Sbjct: 51  NIHVYVRCRSRNKREIDEKSSVVISTLGPQGKEIILSNGSHQ---SYSSSKKTYQFDQVF 107

Query: 72  GPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE------- 124
           G  + Q+ +F   A+    + + GYNCTI  YG T TGKTYTM+GD  +  G+       
Sbjct: 108 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDVQSTDNL 166

Query: 125 -LSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDD------SVDNTYK 177
            L + AGIIPRVL  LF+    LN +Y +K +F+ELYNE+LKDLL D      +V+++ +
Sbjct: 167 LLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSDNEDDDPAVNDSKR 226

Query: 178 KLRIFD 183
           ++RIFD
Sbjct: 227 QIRIFD 232

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  244 bits (623), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 169/223 (75%), Gaps = 9/223 (4%)

Query: 328 PDNNNQ----IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITL 383
           P+ N Q    I ++ ++E YI +A +G+KLL +G   R+VASTK ND+SSRSHT+FTIT 
Sbjct: 242 PEKNTQGSHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTITT 301

Query: 384 ----YKEHNGGLY-RVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSL 438
                   +G  Y +  K+NLVDLAGSENIN+SGA+++RA+EAG IN+SLLTLGRVIN+L
Sbjct: 302 NVTKVDPLSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINAL 361

Query: 439 ADKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNK 498
            D S HIP+RESKLTRLLQDSLGG TKT +I+T+SPAKI+++ET STLEYA++AK+IKN 
Sbjct: 362 VDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIKNT 421

Query: 499 PHLGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHY 541
           P +   + KD  +     E+++++ +L +TR KDG+Y++Q+ Y
Sbjct: 422 PQINQSMTKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKY 464

 Score =  150 bits (379), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 112/187 (59%), Gaps = 13/187 (6%)

Query: 12  NITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKVF 71
           NI V VRCR RN+RE+  KSSVV+S     G + +  N S     +     KTYT D+VF
Sbjct: 54  NIKVYVRCRSRNKREIGEKSSVVISTMGAQGRDVILSNPSSSSSGSLTNVKKTYTFDRVF 113

Query: 72  GPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE------- 124
           G  + Q+++F  +A+    + ++GYNCT+  YG T TGKTYTM+GD  +           
Sbjct: 114 GAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTHNHDQS 173

Query: 125 ---LSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDS---VDNTYKK 178
              LS+ AGIIPRVL  LF+  +  + DY +K SF+ELYNE LKDLL DS    DN  + 
Sbjct: 174 SILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLLADSNKEDDNNAES 233

Query: 179 LRIFDSM 185
           +RIFD++
Sbjct: 234 IRIFDNI 240

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  243 bits (619), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 121/224 (54%), Positives = 172/224 (76%), Gaps = 5/224 (2%)

Query: 324 SEKAPDNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTIT- 382
           +++   N   I+++ ++E YI +A +G+KLL  G   RKVA+TK ND+SSRSHTIFTIT 
Sbjct: 241 TDRTSPNGYSIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITT 300

Query: 383 -LYKEH--NGGLY-RVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSL 438
            + K H  +G  Y +V K+NLVDLAGSENIN+SGA+++RA+EAG IN+SLLTLGRVIN+L
Sbjct: 301 NVTKIHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINAL 360

Query: 439 ADKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNK 498
            D S HIP+RESKLTRLLQDSLGG TKT +I+TISPAKI+++ET STLEYA++AK+IKN 
Sbjct: 361 VDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNT 420

Query: 499 PHLGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYK 542
           P +   + K+  +     E+ +++ +L ++  K+G+Y++Q+ ++
Sbjct: 421 PQVNQLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFE 464

 Score =  152 bits (384), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 122/203 (60%), Gaps = 31/203 (15%)

Query: 5   HTSGE-ELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSN--EVSINTSDEVGIAAHMN 61
            + GE E NI V VRCR RNERE++ KSSVV+S    +G+N  EV I T+   G     +
Sbjct: 46  QSEGEPEYNIKVYVRCRSRNEREIREKSSVVIST---LGNNGREV-ILTNPGTG-----S 96

Query: 62  SKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLY 121
           +KTYT D+VFG  + Q+ MF ++A     + I+GYNCT+  YG T TGKTYTM+GD  + 
Sbjct: 97  NKTYTFDRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMM 156

Query: 122 DGE--------LSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVD 173
                      LS+ AGIIPRVL +LF     +++DY +K SF+ELYNE L+DLL D  D
Sbjct: 157 GSSEDDPNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDDKD 216

Query: 174 NTY-----------KKLRIFDSM 185
            +            + +RI+DS+
Sbjct: 217 VSLEDHNFNGMAPPESIRIYDSL 239

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  238 bits (607), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 172/223 (77%), Gaps = 5/223 (2%)

Query: 325 EKAPDNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTIT-- 382
           +++  + + I ++ ++E YI +A +G+KLL +G   RKVA+T+ ND+SSRSHTIFTIT  
Sbjct: 246 DRSNSSGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTN 305

Query: 383 LYKEH--NGGLY-RVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA 439
           + K H  +G  Y ++ K+NLVDLAGSENIN+SGA+++RA+EAG IN+SLLTLGRVIN+L 
Sbjct: 306 VTKIHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 365

Query: 440 DKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKP 499
           D S HIP+RESKLTRLLQDSLGG TKT +I+T+SPAK +++ET+STLEYA++AK+IKN P
Sbjct: 366 DHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTP 425

Query: 500 HLGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYK 542
            +   + K+  +     E+ K++ +L +   K+G+Y++++ Y+
Sbjct: 426 QINQLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYE 468

 Score =  147 bits (370), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 115/195 (58%), Gaps = 28/195 (14%)

Query: 12  NITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKVF 71
           NI V VRCR RN RE++ KSSVVVS    +GS    I  S++    +  N+KTYT D+VF
Sbjct: 56  NIKVYVRCRSRNVREIKEKSSVVVST---LGSQGREIILSNQ----STGNNKTYTFDQVF 108

Query: 72  GPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS--- 128
           G  + Q+ +F ++A     + ++GYNCT+  YG T TGKTYTM+GD  +    L D    
Sbjct: 109 GVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGASLEDPNYV 168

Query: 129 -----AGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLL-------------DD 170
                AGIIPRVL +LF+  +  ++DY +K SF+ELYNE L+DLL               
Sbjct: 169 LLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVEDKEPLIDEGGIGG 228

Query: 171 SVDNTYKKLRIFDSM 185
            V N+ + +RI+D++
Sbjct: 229 GVANSPETIRIYDNL 243

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  238 bits (606), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 117/214 (54%), Positives = 163/214 (76%), Gaps = 5/214 (2%)

Query: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEH-----N 388
           I ++ ++EFYI +A +G++LL  G   RKVA+TK ND+SSRSHT+FTIT          N
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSN 307

Query: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448
               ++ K+NLVDLAGSENIN+SGA+++RA+EAG IN+SLLTLGRVIN+L D S HIP+R
Sbjct: 308 EQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYR 367

Query: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508
           ESKLTRLLQDSLGG TKT +I+TISPAKI++DET STLEYA++AK+IKN P +   + K+
Sbjct: 368 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKN 427

Query: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYK 542
             L     E+ +++ +L ++R K+G+Y+++  ++
Sbjct: 428 SCLGEYIHEIERLRQELKASRQKEGMYITEDQFQ 461

 Score =  147 bits (371), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 80/182 (43%), Positives = 114/182 (62%), Gaps = 18/182 (9%)

Query: 12  NITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKVF 71
           N+ V VRCR RNE+E++ KSSVV+S    +G+    +  S+  G  +H + +TYT D+VF
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVIST---LGAKGREVILSNGAGSLSH-SKRTYTFDQVF 96

Query: 72  GPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGD----------EKLY 121
           G  + Q+ +F E+A+    + ++GYNCT+  YG T TGKTYTM+GD          +K+ 
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKIL 156

Query: 122 DGELSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYKKLRI 181
            GE S   GIIPRVL  LF+      ++Y +K SF+ELYNE LKDLL +S +   + +RI
Sbjct: 157 LGEHS---GIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAES-EQEEENIRI 212

Query: 182 FD 183
           FD
Sbjct: 213 FD 214

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  238 bits (606), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 121/225 (53%), Positives = 170/225 (75%), Gaps = 7/225 (3%)

Query: 321 LTNSEKAPDNNN--QIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTI 378
           ++N  K+  N N   I ++ ++E YI +A +G++LL +G   RKVASTK+ND+SSRSHTI
Sbjct: 325 MSNQNKSASNCNGSSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTI 384

Query: 379 FTI----TLYKEHNGGLY-RVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGR 433
           FTI    T      G  + +  K+NLVDLAGSENIN+SGA+++RA+EAG IN+SLLTLGR
Sbjct: 385 FTIITNVTKVDPVTGKHFVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGR 444

Query: 434 VINSLADKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAK 493
           VIN+L D+S HIP+RESKLTRLLQDSLGG TKT +I+T+SPAKI+++ET STLEYA++AK
Sbjct: 445 VINALVDRSHHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAK 504

Query: 494 NIKNKPHLGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQ 538
           +IKN P +   + KD  +     E+++++++L   R K+G+Y++Q
Sbjct: 505 SIKNTPQINQSLSKDTFIHEYINEIDRLRNELKLARTKEGIYITQ 549

 Score =  115 bits (287), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 80/234 (34%), Positives = 108/234 (46%), Gaps = 77/234 (32%)

Query: 4   THTSGEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNE----VSINTSDEV----- 54
           +HT  +  NI V VRCR R +RE+  KSSVV+S    +G+N     +S N S ++     
Sbjct: 45  SHTKDD--NIKVYVRCRSRTQREIDEKSSVVIST---LGANGNKVILSPNQSRKLYNTNA 99

Query: 55  ---------------------GIAAHMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFI 93
                                      N +TYT DKVFG  + Q+ +F+ +A+    + +
Sbjct: 100 NGSTRTKNNTNLNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKNYIYEML 159

Query: 94  KGYNCTILVYGMTSTGKTYTMTGD----------EKLYDGELSDSAGIIPRVLFKLF--- 140
           +GYNCT+  YG T TGKTYTM+GD          +K+  GE    AGIIPRVL  LF   
Sbjct: 160 QGYNCTVFAYGQTGTGKTYTMSGDLNILGNLDSKDKILLGE---HAGIIPRVLVYLFKEL 216

Query: 141 --------------------------ESPEILNDDYIIKCSFVELYNEDLKDLL 168
                                     E   + N +Y +K SF+ELYNE L DLL
Sbjct: 217 SKNDTITNTKVNNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLL 270

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  235 bits (599), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 122/219 (55%), Positives = 164/219 (74%), Gaps = 9/219 (4%)

Query: 329 DNNN----QIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTI--- 381
           DNNN     I ++ ++E YI +A +G++LL  G   RKVASTK ND+SSRSHT+FTI   
Sbjct: 280 DNNNNASSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATN 339

Query: 382 -TLYKEHNGGLY-RVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA 439
            T     +G  Y +  K+NLVDLAGSENIN+SGA+++RA+EAG IN+SLLTLGRVIN+L 
Sbjct: 340 ITKIDPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 399

Query: 440 DKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKP 499
           D S HIP+RESKLTRLLQDSLGG TKT +I+TISPAKI+++ET STLEYA +AK+IKN P
Sbjct: 400 DHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTP 459

Query: 500 HLGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQ 538
            +   + KD  +    +E+ +++ +L ++R KDG+ ++Q
Sbjct: 460 QINQSMSKDTCINEYVSEIERLRLELKTSRQKDGICITQ 498

 Score =  139 bits (351), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 106/179 (59%), Gaps = 13/179 (7%)

Query: 12  NITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKVF 71
           NI V VRCR R+ERE++ KSSVV+S     G+  +  N S  +        K+Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK----KSYSFDRVF 163

Query: 72  GPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDG-------E 124
           G  + Q+ +F + A+    + + GYNCT+  YG T TGKTYTM+GD  +           
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 125 LSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYKKLRIFD 183
           L + AGIIPRVL  LF+    L +DY +K SF+ELYNE LKDL   + ++  + +RIFD
Sbjct: 224 LGEHAGIIPRVLVNLFKMLA-LENDYSVKISFLELYNERLKDLFAQN-ESEEETIRIFD 280

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  234 bits (598), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 116/213 (54%), Positives = 163/213 (76%), Gaps = 5/213 (2%)

Query: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEH----NG 389
           I ++ ++E YI +A +G++LL KG   RKVA+TK ND+SSRSHTIFTI  +       +G
Sbjct: 268 ITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPVSG 327

Query: 390 GLY-RVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448
             Y ++ K+NLVDLAGSENIN+SGA++ RA+EAG IN+SLLTLGRVIN+L + S HIP+R
Sbjct: 328 EQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIPYR 387

Query: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508
            SKLTRLLQDSLGG TKT +I+TISPA+I++DET STLEYA++AK+IKN P +   + KD
Sbjct: 388 GSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLSKD 447

Query: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHY 541
             +     E+ +++ +L ++R ++G+Y++Q+ Y
Sbjct: 448 SCIMEYIYEIERLRQELKASRQREGMYITQEQY 480

 Score =  148 bits (374), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/179 (45%), Positives = 111/179 (62%), Gaps = 12/179 (6%)

Query: 12  NITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKVF 71
           NI V VRCR RN+RE+  KSSVVVS    MG    S+  S+     +H   KTY  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVST---MGRKGKSVILSNPSSPLSHPK-KTYMFDEVF 99

Query: 72  GPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLY---DGE---- 124
           G  + Q+ +F E+A+   ++ ++GYNCT+  YG T TGKTYTM+GD  ++   D +    
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIWGDLDSQDKIL 159

Query: 125 LSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYKKLRIFD 183
           L + AGIIPRVL  LF+       ++ +K SF+ELYNE LKDLL D+ D+    +RIFD
Sbjct: 160 LGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLADN-DSDEDNIRIFD 217

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  232 bits (591), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 168/534 (31%), Positives = 287/534 (53%), Gaps = 29/534 (5%)

Query: 332 NQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKM----NDVSSRSHTIFTITLYKEH 387
           N IYIQNLQE  I    +G+ +++KGL++R++AST      N+ S RSH+IF ITLYKE 
Sbjct: 270 NSIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEE 329

Query: 388 N-GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIP 446
               ++R+SK++ V+ AGSE  + + +++      G+ N +L +  ++IN + + S +  
Sbjct: 330 EVNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYAS 383

Query: 447 FRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIM 506
           F +SKLT+LLQ++  G T+T+ I+ I+P K  +D T S L  A+K K IKN+P  GS I 
Sbjct: 384 FLDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVIT 443

Query: 507 KDVLLKNITTELNKIKSDLMSTRLKD-GVYMSQQHYKELNNDLESYKTEVQESKRANERL 565
           K+ L+K ++ EL K KSDL+S +  D G+YM ++HY EL   LESYK ++Q SK +   L
Sbjct: 444 KESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINEL 503

Query: 566 ISQNGSLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVG 625
             +   +  +K+   E+NE QR                L++  KRE  L  +  +L ++ 
Sbjct: 504 TKKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSIL 563

Query: 626 TSMQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGXXXXXXXXXXXXXXX 685
            +MQ ++E Y ++++ ++   K + + E   LKN L    ++I                 
Sbjct: 564 GNMQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLESNFADIKN--------------- 608

Query: 686 XXXXXXXXXFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEINS 745
                       NID I+   LKI  Q Q K + + ++   ++L   P    +    + +
Sbjct: 609 -RMPDDNDNMNTNIDNIKAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKN 667

Query: 746 IDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSXX 805
           ++       NK +E LSD+SEE+NN   Y+N++FL++++E ++  ++     +++  S  
Sbjct: 668 LEESVEINHNKYSELLSDISEEFNNLNNYINDNFLKSSHEELIDTYINRTYHEVQGISVE 727

Query: 806 XXXXINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKW-VKSIEII 858
                 K ++ +   N+K   + + ++ ++IV+ E     P K+KW + S EII
Sbjct: 728 FTENFKKLLDIYVEKNTKSLSKSITSLTSEIVENELTQFNPEKKKWELASNEII 781

 Score =  124 bits (311), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 109/191 (57%), Gaps = 25/191 (13%)

Query: 12  NITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGI--AAHMNSKTYTVDK 69
           NITVAVRCR   + E  + S  ++S+    G NE    TS+EV +   +    K YT+D 
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTIISI----GDNEDG--TSNEVIVLDESTGRKKIYTLDA 62

Query: 70  VFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGD----EKLYDGEL 125
           V+G    Q  +F E   P ++ F  GYN +I+ YG   +GK YT+ G+    +   + E 
Sbjct: 63  VYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE- 121

Query: 126 SDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDS------------VD 173
           S++ G++PRVL +LF+  E   +D+IIKCSFVE+YN++L+DLL D+              
Sbjct: 122 SENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGATG 181

Query: 174 NTYKKLRIFDS 184
           +T KKLRI DS
Sbjct: 182 STGKKLRIVDS 192

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  230 bits (586), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 123/224 (54%), Positives = 171/224 (76%), Gaps = 7/224 (3%)

Query: 325 EKAPDNN--NQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTIT 382
           +K+  NN  + I ++ ++E YI +A +G++LL +G   RKVASTK ND+SSRSHTIFTIT
Sbjct: 243 QKSSRNNTYSSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFTIT 302

Query: 383 LYKEH----NGGLY-RVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINS 437
                    +G  Y ++ K+NLVDLAGSENI++SGA++ RA+EAG IN+SLLTLGRVIN+
Sbjct: 303 TNITKIDPVSGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVINA 362

Query: 438 LADKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKN 497
           L D S HIP+RESKLTRLLQDSLGG TKT +I+T+SPAKI+++ET STLEYA++AK+IKN
Sbjct: 363 LVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSIKN 422

Query: 498 KPHLGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHY 541
            P +   + KDV +     E+ +++ +L ++R KDGVY++Q+ +
Sbjct: 423 TPQINQSMSKDVCINEYVQEIERLRQELKASRQKDGVYITQEQF 466

 Score =  150 bits (378), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 84/179 (46%), Positives = 111/179 (62%), Gaps = 12/179 (6%)

Query: 12  NITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKVF 71
           NI V VRCR RN+RE++ KSSVV+S    MG+    +  SD   + +H   KTY  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVIST---MGAQGKEVVLSDPSSVLSH-TKKTYIFDQVF 114

Query: 72  GPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGD-EKLYDGE------ 124
           G  + Q+++F   A+    + ++GYNCTI  YG T TGKTYTM+GD   L D E      
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 125 LSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYKKLRIFD 183
           L + AGIIPRVL  LF+     + +Y +K SF+ELYNE LKDLL  S + T + +RIFD
Sbjct: 175 LGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLLSQSKE-TEESIRIFD 232

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  229 bits (583), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 134/308 (43%), Positives = 190/308 (61%), Gaps = 30/308 (9%)

Query: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITL----YKEHNG 389
           I ++ ++E YIN+A  G++LL  G   RKVA+TK ND+SSRSHT+FTIT         +G
Sbjct: 242 IMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDPVSG 301

Query: 390 GLY-RVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448
             Y +  K+NLVDLAGSENIN+SGA+++RA+EAG IN+SLLTLGRVIN+L D + HIP+R
Sbjct: 302 EQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHIPYR 361

Query: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIMKD 508
           ESKLTRLLQDSLGG TKT +I+TISPAKI++DET STLEYA++AK+IKN P +   + KD
Sbjct: 362 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSMSKD 421

Query: 509 VLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLISQ 568
             +     E+ +++ +L ++R KDG+ ++Q  +                       L   
Sbjct: 422 SCINEYVHEIERLRQELKTSRQKDGISITQDQFD----------------------LYES 459

Query: 569 NGSLLKDKKASNELNELQRXXXXXXXXXXXXXXXXLDEHYKREDILVELIRQLKNVGTSM 628
           NG L+ ++K   +  E Q                 L+   K+ ++      QLK+  T +
Sbjct: 460 NGILVDEQKTKIQNMEEQIQRFKDKYVKQTELNKNLESRLKQNELQT---IQLKSQRTQL 516

Query: 629 QSTIENYR 636
            S +EN++
Sbjct: 517 LSLLENFQ 524

 Score =  144 bits (363), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 110/181 (60%), Gaps = 13/181 (7%)

Query: 13  ITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKVFG 72
           I V VRCR RNERE+Q KSSVV+S    +G+ + +        +      +TYT D+VFG
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVIST---LGAPQSTQLLLSNPLLPLAYAKRTYTFDRVFG 117

Query: 73  PSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE-------- 124
             + Q+ +F + A+    + ++GYNCT+  YG T TGKTYTM+GD  +  G+        
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 125 LSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYKKLRIFDS 184
           L + AGIIPRVL +LF   +  N+ Y +K SF+ELYNE LKDLL  S  +  + +RIFD+
Sbjct: 178 LGEHAGIIPRVLVELFRWLD-GNEGYSVKVSFLELYNERLKDLL-ASEQSEEENIRIFDN 235

Query: 185 M 185
           +
Sbjct: 236 V 236

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  176 bits (447), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 134/197 (68%), Gaps = 31/197 (15%)

Query: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTIT-----LYKEHN 388
           I ++ +QE +I NA +G+ LL KG   RKV STK+ND+SSRSHTIFTIT     L  + N
Sbjct: 208 IIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIKLDNQTN 267

Query: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS------ 442
               ++ K+NLVDLAGSENI KSG +  R++E G IN+SLLTLGRVIN+L+DK+      
Sbjct: 268 KEYIKIGKLNLVDLAGSENITKSGLK--RSQETGLINKSLLTLGRVINALSDKTNNTHGS 325

Query: 443 ------------------IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSS 484
                              HIP+RESKLTRLLQDSLGG TKT +I+TISPAK  +DET S
Sbjct: 326 NNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTCLDETIS 385

Query: 485 TLEYASKAKNIKNKPHL 501
           TLEYA++A +IKN P +
Sbjct: 386 TLEYATRAMSIKNNPKI 402

 Score =  134 bits (337), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 81/186 (43%), Positives = 104/186 (55%), Gaps = 30/186 (16%)

Query: 4   THTSGEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSK 63
           TH S    NI V VRCR RN++E+  KSSVVVS    +G N       +++ I+   N  
Sbjct: 5   THNS----NIKVYVRCRSRNQKEIDEKSSVVVST---LGQN------GNQIIISNSTNKN 51

Query: 64  TYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDG 123
            Y  D VFG  + Q+ +F  +A    ++ I GYNCT+  YG T TGKTYTM+GD  +  G
Sbjct: 52  KYIFDNVFGVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNII-G 110

Query: 124 ELSDS--------AGIIPRVLFKLFESPE--ILND------DYIIKCSFVELYNEDLKDL 167
           +L+ +        AGIIPRVL +LF S E  I N        Y +K SF+ELYNE LKDL
Sbjct: 111 DLNSTKNILLGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDL 170

Query: 168 LDDSVD 173
           L    D
Sbjct: 171 LSADAD 176

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  140 bits (353), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 77/173 (44%), Positives = 114/173 (65%), Gaps = 8/173 (4%)

Query: 335 YIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNGGLYRV 394
           +++ LQEF +N+  + +  L++G   + V +T +N+ SSRSHTIFTI + ++ N  L  V
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 395 ----SKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIH--IPFR 448
               S + L+DLAGSE  N SGA  +R KE  +IN+SL TLGRVI  LA K     IP+R
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHL 501
           ++ LT +L++SLGGN+KT +I+ +SP   + +ET STL YA+ A+++K    L
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPC--DFEETMSTLRYATLARSVKTFAQL 339

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 82/168 (48%), Gaps = 29/168 (17%)

Query: 12  NITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKVF 71
           NI V+VR R   ERE     S    +  ++  N + +        A    ++ +  D   
Sbjct: 4   NIKVSVRLRKPLERE-----SAERVIAQVVSENLIKVEQR-----AKREETRNFEFDLCC 53

Query: 72  GPSAS----QDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSD 127
             S S    Q  +++++A       + GYN  I  YG T +GK++TMTG  +L       
Sbjct: 54  TYSESLEEDQAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL------- 106

Query: 128 SAGIIPRVLFKLFESPEIL--NDD-----YIIKCSFVELYNEDLKDLL 168
             GI+PR+  +LFE  E+   +DD     + I+CS++E+YNE ++DLL
Sbjct: 107 -PGIVPRMCQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLL 153

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  136 bits (343), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 116/179 (64%), Gaps = 5/179 (2%)

Query: 330 NNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNG 389
           N+ + ++Q++  F +N   + ++ L  G   R VAST+MN  SSRSH IFT+++ ++   
Sbjct: 144 NDKKTFVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPD 203

Query: 390 GLYRVSKMNLVDLAGSENINKSGA--QHQRAKEAGSINQSLLTLGRVINSLADKSIH-IP 446
           G  R S + LVDLAGSE  N +      +R KE  +IN+SL TLGR I+ LA  S H IP
Sbjct: 204 GSIRESDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIP 263

Query: 447 FRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFI 505
           +R+S LT +L+++LGGN+KT +I+ ISP  I+++E+ STL YA+ AK IK +  +   +
Sbjct: 264 YRDSLLTWVLKENLGGNSKTCMIACISP--IDLEESLSTLRYATTAKEIKLRATMNEIV 320

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 59/111 (53%), Gaps = 11/111 (9%)

Query: 63  KTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYD 122
           +++  D +F  S+SQ  +  E+        ++GYN  I  YG T +GKTYTM G      
Sbjct: 35  RSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRGT----- 89

Query: 123 GELSDSAGIIPRVLFKLFESPEILNDDYI--IKCSFVELYNEDLKDLLDDS 171
              + + GIIP +   LF++ E L+   +  +  ++ E+YNE L DLL D+
Sbjct: 90  ---NSNPGIIPLLCRDLFDALE-LDKTTVSSVSITYFEIYNEKLIDLLGDT 136

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  137 bits (344), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 116/175 (66%), Gaps = 8/175 (4%)

Query: 335 YIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN---GGL 391
           +++ L EF +    + ++ +++G R R V  T MN+ SSRSH IFTI++ +      G L
Sbjct: 198 FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDL 257

Query: 392 Y-RVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIH--IPFR 448
             R S + LVDLAGSE ++ +GA+  R KE  +IN+SL TLGRV++ LA K+    IP+R
Sbjct: 258 TERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYR 317

Query: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGS 503
           +S LT +L+++LGGN+KTV+I+ +SP   + +ET STL YA+ AK +KN   + S
Sbjct: 318 DSALTWVLKENLGGNSKTVMIACVSPC--DYEETISTLRYATTAKEVKNTARVNS 370

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 82/180 (45%), Gaps = 22/180 (12%)

Query: 12  NITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKVF 71
           NI VAVR R    RE        V+ P      +  I+TS  +        K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSPTSFVIQQ-HISTSSLLATEEFTQGKIFTFDHCF 62

Query: 72  ----GPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE--------- 118
                 S  Q++++  I        + GYN  IL YG T +GK++TM G E         
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 119 KLYDGELSDSA-GIIPRVLFKLFESPEILNDD-------YIIKCSFVELYNEDLKDLLDD 170
              D  + DSA GIIPRV   LF+   + N +       + I CS++E+YNE ++DLL +
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLLSE 182

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  139 bits (351), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 113/186 (60%), Gaps = 18/186 (9%)

Query: 12  NITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKVF 71
           NI V VRCR RN+RE++ KSSVV+S     G   +  N S +   +   + KTY  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIEEKSSVVISTLGPQGKEIILSNGSHQ---SYSSSKKTYQFDQVF 108

Query: 72  GPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE------- 124
           G  + Q+ +F   A+   ++ + GYNCTI  YG T TGKTYTM+GD  +  G+       
Sbjct: 109 GAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINIL-GDVQSTDNL 167

Query: 125 -LSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDD------SVDNTYK 177
            L + AGIIPRVL  LF+    LN +Y +K SF+ELYNE+LKDLL D      +V++  +
Sbjct: 168 LLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLKDLLSDSEDDDPAVNDPKR 227

Query: 178 KLRIFD 183
           ++RIFD
Sbjct: 228 QIRIFD 233

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  128 bits (322), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 111/173 (64%), Gaps = 8/173 (4%)

Query: 335 YIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNGGLYRV 394
           +++ L+EF +++  D +  +++G   R + ST +N+ SSRSHTIFTI++ ++    L  V
Sbjct: 169 FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 395 ----SKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIH--IPFR 448
               S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ LA +     IP+R
Sbjct: 229 IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHL 501
           ++ LT +L++SLGGN+KT +I+ +SP   + +ET STL YA+ A+N+K    L
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPC--DYEETLSTLRYATLARNVKTCAQL 339

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 86/168 (51%), Gaps = 29/168 (17%)

Query: 12  NITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKVF 71
           NI VAVR R   EREV    S++  V D    N + +   ++        ++++  D+ F
Sbjct: 4   NIKVAVRLRRPLEREVD--ESIIARVED---GNVIQVKDRNQKN-----ETRSFHFDQCF 53

Query: 72  GPS----ASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSD 127
             S    A Q  ++++++       + GY+  +  YG T +GK++TMTG          +
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS--------PE 105

Query: 128 SAGIIPRVLFKLFESPEI-------LNDDYIIKCSFVELYNEDLKDLL 168
           S GI+ R+  +LFE  EI       +N  + I+CS++E+YNE ++DLL
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLL 153

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  129 bits (325), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 128/212 (60%), Gaps = 20/212 (9%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK--- 385
           D N++I + NL      N  D I L+ +G  +R  + T+ N+VSSRSH++  I + +   
Sbjct: 206 DQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLK 265

Query: 386 --EHNGGLYRV-SKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA--D 440
             +  G   ++ S ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L    
Sbjct: 266 NFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINK 325

Query: 441 KSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKP- 499
           KS HIP+R+SKLTRLL+ SLGGN KTV+I  +SP+ ++ DET +TL+YA++AK IK K  
Sbjct: 326 KSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTKVI 385

Query: 500 --------HLGSFIMKDVLLKNITTELNKIKS 523
                   H+GS++    L+     E++K+K+
Sbjct: 386 RNQTSLNRHVGSYLK---LITEQKQEIDKLKA 414

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 60/109 (55%), Gaps = 13/109 (11%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  DK+F   ++Q+ +F++   PL +  + G+N T+  YG T  GKTYT+ G        
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING-------- 143

Query: 125 LSDSAGIIPRVLFKLFESPEILNDD-----YIIKCSFVELYNEDLKDLL 168
            S+  GII R + +LF   EIL  D       I  S++E+YNE ++DLL
Sbjct: 144 TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL 192

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  129 bits (325), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 114/194 (58%), Gaps = 17/194 (8%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D  N I + NL   + N   D + L+ +G  +R  + T+ N+VSSRSH +  I + + + 
Sbjct: 264 DTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 389 ----GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA----D 440
                  +  + ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 441 KSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNK-- 498
           +S HIP+R+SKLTRLL+ SLGGN KTV+I  ISP+  + DET +TL+YA++AK IK K  
Sbjct: 384 RSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKII 443

Query: 499 -------PHLGSFI 505
                   H+GS++
Sbjct: 444 RNQQSLSRHVGSYL 457

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 59/112 (52%), Gaps = 10/112 (8%)

Query: 59  HMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE 118
           H     +  DK+F  ++SQ  ++KE   PL +  + G+N T+  YG T  GKTYT++G  
Sbjct: 147 HGGEIKFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT- 205

Query: 119 KLYDGELSDSAGIIPRVLFKLFESPEILND--DYIIKCSFVELYNEDLKDLL 168
                      GII   + +LF     L D  D+ I  S++E+YNE ++DLL
Sbjct: 206 -------PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  128 bits (321), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/175 (46%), Positives = 105/175 (60%), Gaps = 14/175 (8%)

Query: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK----EHNG 389
           IY++ L   Y+ +  + +  +++G   R V+ST MN  SSRSH+I  I L K    E N 
Sbjct: 197 IYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKRNALEEN- 255

Query: 390 GLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLAD-------KS 442
              + S + LVDLAGSE + K+ A     +EA  IN SL  LG VIN+L          S
Sbjct: 256 --IQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSKRTS 313

Query: 443 IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKN 497
            HIP+R+SKLTRLLQDSLGGN+KT LI   S ++ N  ET STL + S+AK IKN
Sbjct: 314 AHIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKN 368

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 72/121 (59%), Gaps = 11/121 (9%)

Query: 61  NSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKL 120
           N + +T D+VF   ++Q+ +++ +A  + + F +GYN TIL YG T +GK++TM G +  
Sbjct: 71  NDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFGPK-- 128

Query: 121 YDGELSDSAGIIPRV---LFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYK 177
                 ++ G+IPR+   +FK  E+P+  +  + +  SF+E+Y E + DLL  S++    
Sbjct: 129 ------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEKIYDLLAQSLEKPAD 182

Query: 178 K 178
           K
Sbjct: 183 K 183

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  125 bits (315), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 110/172 (63%), Gaps = 7/172 (4%)

Query: 335 YIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK----EHNGG 390
           YI+ L +  +N+  + +K +++G   R VA T +N+ SSRSH I TI + +         
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 391 LYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA-DKSIHIPFRE 449
           + RVS + LVDLAGSE    S  + +R KE  +IN+SL+TL RV+  L+ +K   +P+RE
Sbjct: 233 VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 450 SKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHL 501
           S LTR+L+D+L GN+ T +++ ISP   + +E+ STL YAS AK+++ + HL
Sbjct: 293 SLLTRVLRDNLDGNSITCILACISPC--DYEESISTLRYASTAKHVRTEAHL 342

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 86/172 (50%), Gaps = 35/172 (20%)

Query: 12  NITVAVRCRGRNEREVQAKSSVVVSVPDIM---GSNEVSI---NTSDEVGIAAHMNSKTY 65
           NI VA+R R +  RE         S P ++    SNE+++   NT++ +    H    T+
Sbjct: 4   NIKVAIRIRDKISRET--------SRPSVIKRKTSNEITLQKDNTANVITTVEH----TF 51

Query: 66  TVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGEL 125
             D+VF  S++Q  ++ E+A       ++GY+  ++ YG T  GKTYTM G E+      
Sbjct: 52  YFDQVFDESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ------ 105

Query: 126 SDSAGIIPRVLFKLFESPEILNDD---------YIIKCSFVELYNEDLKDLL 168
               GIIP V  +LF+  ++  D+         + +  S+ ++YNE + D+L
Sbjct: 106 --EPGIIPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDML 155

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  127 bits (319), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 76/196 (38%), Positives = 115/196 (58%), Gaps = 19/196 (9%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D  N+I + NL         + I L+ KG  +R  + T+ N+VSSRSH +  I + + + 
Sbjct: 262 DGANKISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTNR 321

Query: 389 GG----LYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA----- 439
                  +  + ++++DLAGSE    +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 322 TADLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDGG 381

Query: 440 -DKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNK 498
            ++S HIP+R+SKLTRLL+ SLGGN KTV+I  ISP+  + DET +TL+YA++AK IK K
Sbjct: 382 TNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

Query: 499 ---------PHLGSFI 505
                     H+GS++
Sbjct: 442 IIRNQQSLNRHVGSYL 457

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 60/106 (56%), Gaps = 10/106 (9%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  DK+F   ASQ+ +++     L +  + G+N T+  YG T  GKTYT++G        
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 203

Query: 125 LSDSAGIIPRVLFKLFESPEILNDD--YIIKCSFVELYNEDLKDLL 168
             +  GII RV+ +LFE  E L D   + +  S++E+YNE ++DLL
Sbjct: 204 -PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  127 bits (319), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 115/194 (59%), Gaps = 17/194 (8%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D  N I + NL   +     D + L+ +G  +R  + T+ N+VSSRSH++  I + + + 
Sbjct: 264 DTQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNK 323

Query: 389 ----GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA----D 440
                  +  + ++++DLAGSE  + +  +  R  E  +IN+SLL LG  IN+L      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 441 KSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNK-- 498
           ++ HIP+R+SKLTRLL+ SLGGN KTV+I  ISP+  + DET +TL+YA++AK IK K  
Sbjct: 384 RTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKII 443

Query: 499 -------PHLGSFI 505
                   H+GS++
Sbjct: 444 RNQQSLSRHVGSYL 457

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 58/112 (51%), Gaps = 10/112 (8%)

Query: 59  HMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE 118
           H     +  DK+F  ++SQ  ++KE   PL +  + G+N T+  YG T  GKTYT++G  
Sbjct: 147 HGGEIKFVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT- 205

Query: 119 KLYDGELSDSAGIIPRVLFKLFESPEILNDD--YIIKCSFVELYNEDLKDLL 168
                      GII   + +LF     L D+  + I  S++E+YNE + DLL
Sbjct: 206 -------PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL 250

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  127 bits (318), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 73/180 (40%), Positives = 108/180 (60%), Gaps = 11/180 (6%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D+N  I + NL  +      D + L+ KG  +R  ++T  N+ SSRSH +  I +  +HN
Sbjct: 239 DSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIM-QHN 297

Query: 389 GGL-----YRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA---- 439
                   +  + ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L     
Sbjct: 298 RTADLKSDHTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDG 357

Query: 440 -DKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNK 498
             +S H+P+R+SKLTRLL+ SLGGN KTV+I  ISP+  + DET +TL+YA++AK IK K
Sbjct: 358 TRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKTK 417

 Score = 66.2 bits (160), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 66/121 (54%), Gaps = 12/121 (9%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  D++F   ++Q  +++    PL +  + G+N T+  YG T  GKTYT++G        
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------- 180

Query: 125 LSDSAGIIPRVLFKLFESPEILNDD--YIIKCSFVELYNEDLKDLLDDSVDNTYKKLRIF 182
             ++ GII + + +LF   E L D   + +  SF+E+YNE ++DLL    + + KKL I 
Sbjct: 181 -PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLL--CPETSSKKLVIL 237

Query: 183 D 183
           +
Sbjct: 238 E 238

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  127 bits (318), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 117/199 (58%), Gaps = 22/199 (11%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D +++I + NL   Y  +  D I L+ +G  +R  +ST+ N+VSSRSH +  I + + + 
Sbjct: 302 DKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQTNT 361

Query: 389 ----GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS-- 442
                  +  + ++++DLAGSE    +  + +R  E  +IN+SLL LG  IN+L   +  
Sbjct: 362 KIDLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPTNN 421

Query: 443 -------IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNI 495
                   HIP+R+SKLTRLL+ SLGGN KTV+I  ISP+  + DET +TL+YA++AK I
Sbjct: 422 TRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEI 481

Query: 496 KNK---------PHLGSFI 505
           K K          H+GS++
Sbjct: 482 KTKIIRNQQSLNRHVGSYL 500

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/126 (35%), Positives = 69/126 (54%), Gaps = 12/126 (9%)

Query: 58  AHMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGD 117
           A  N   +  DK+F  ++SQD ++      L +  + G+N T+  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 118 EKLYDGELSDSAGIIPRVLFKLFESPEILNDD--YIIKCSFVELYNEDLKDLLDDSVDNT 175
           +        ++ GII RV+ +LFE  E L D+  + +  S++E+YNE + DLL    D  
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL--KPDTP 293

Query: 176 YKKLRI 181
            KKL I
Sbjct: 294 SKKLII 299

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  126 bits (316), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 69/179 (38%), Positives = 108/179 (60%), Gaps = 9/179 (5%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D+ N+I + NL         D + L+  G  +R  ++T  N+ SSRSH +  I + +   
Sbjct: 240 DSENRISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSR 299

Query: 389 GGL----YRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA----- 439
                  +  +K++++DLAGSE    +  + +R +E  +IN+SLL LG  IN+L      
Sbjct: 300 TAEITSDHTFAKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISDGT 359

Query: 440 DKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNK 498
            ++ H+P+R+SKLTRLL+ SLGGN KTV+I  +SP+  + DET +TL+YA++AK IK K
Sbjct: 360 RRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTK 418

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 64/119 (53%), Gaps = 12/119 (10%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  DK+F  +A+Q+ ++      L +  + G+N T+  YG T  GKTYT++G        
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------- 181

Query: 125 LSDSAGIIPRVLFKLFESPEILNDD--YIIKCSFVELYNEDLKDLLDDSVDNTYKKLRI 181
             +  G+I   + +LF   E L D   + I  S++E+YNE ++DLL  S + + KKL I
Sbjct: 182 -PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLL--SPEMSPKKLVI 237

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  125 bits (315), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 75/201 (37%), Positives = 114/201 (56%), Gaps = 29/201 (14%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK--- 385
           D +N+I + NL + +     + + L+ +G  +R  + T+ N+VSSRSH +  I + +   
Sbjct: 267 DTDNKITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNR 326

Query: 386 ------EHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA 439
                 EH  G      ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L 
Sbjct: 327 TPDIKEEHTFG-----TLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALC 381

Query: 440 ------DKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAK 493
                     H+P+R+SKLTRLL+ SLGGN KTV+I  ISP+  + DET +TL+YA++AK
Sbjct: 382 INGNDERPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAK 441

Query: 494 NIKNK---------PHLGSFI 505
            IK K          H+GS++
Sbjct: 442 EIKTKIIRNQQSLNRHVGSYL 462

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 59/106 (55%), Gaps = 10/106 (9%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  DK+F   A+Q  +++     L +  + G+N T+  YG T  GKTYT++G        
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG-------- 207

Query: 125 LSDSAGIIPRVLFKLFESPEILND--DYIIKCSFVELYNEDLKDLL 168
             ++ GI+ + + +LF+  E L D   + I  SF+E+YNE ++DLL
Sbjct: 208 TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLL 253

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  126 bits (316), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 113/194 (58%), Gaps = 17/194 (8%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D  N I + NL   +     D + L+ +G  +R  + T+ N+VSSRSH +  I + + + 
Sbjct: 264 DTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 389 ----GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA----D 440
                  +  + ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L      
Sbjct: 324 LVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 441 KSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNK-- 498
           ++ HIP+R+SKLTRLL+ SLGGN KTV+I  ISP+  + DET +TL+YA++AK IK K  
Sbjct: 384 RTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKII 443

Query: 499 -------PHLGSFI 505
                   H+GS++
Sbjct: 444 RNQQSLSRHVGSYL 457

 Score = 71.6 bits (174), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 60/112 (53%), Gaps = 10/112 (8%)

Query: 59  HMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE 118
           H     +  DK+F  ++SQ  ++KE   PL +  + GYN T+  YG T  GKTYT++G  
Sbjct: 147 HGGEIKFVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFAYGATGCGKTYTVSGT- 205

Query: 119 KLYDGELSDSAGIIPRVLFKLFESPEILNDD--YIIKCSFVELYNEDLKDLL 168
                      G+I   + +LF   + L D+  + I  S++E+YNE ++DLL
Sbjct: 206 -------PSQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEIYNERIRDLL 250

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  126 bits (316), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 72/195 (36%), Positives = 115/195 (58%), Gaps = 18/195 (9%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D++  I + NL    ++   D + L+ KG  +R  ++T  N+ SSRSH +  + + + + 
Sbjct: 236 DSHRHITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNR 295

Query: 389 GGL----YRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA----- 439
                  ++ + ++L+DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 296 TAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRK 355

Query: 440 DKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNK- 498
               H+P+R+SKLTRLL+ SLGGN KTV+I  ISP+  + DET +TL+YA++AK IK K 
Sbjct: 356 RGGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTKI 415

Query: 499 --------PHLGSFI 505
                    H+GS++
Sbjct: 416 IRNQHSLDRHVGSYL 430

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 59/107 (55%), Gaps = 10/107 (9%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  D+VF   +SQ  +++    PL +  + G+N T+  YG T  GKTYT++G        
Sbjct: 125 FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------- 177

Query: 125 LSDSAGIIPRVLFKLFESPEILNDD--YIIKCSFVELYNEDLKDLLD 169
             ++ GII   + +LF   E L D   + +  S++E+YNE ++DLL+
Sbjct: 178 -PENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLLE 223

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  125 bits (315), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 114/195 (58%), Gaps = 18/195 (9%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           DN ++I + NL         D + L+ KG  +R  ++T  N+ SSRSH +  I + + + 
Sbjct: 257 DNESKISVANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNR 316

Query: 389 G----GLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA----- 439
                  +  + ++++DLAGSE    +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 317 TVDLTSSHVFATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLNDGT 376

Query: 440 DKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKP 499
            +S H+P+R+SKLTRLL+ SLGGN KTV+I  +SP+  + DET +TL+YA++AK IK K 
Sbjct: 377 RRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKTKV 436

Query: 500 ---------HLGSFI 505
                    H+GS++
Sbjct: 437 IRNQQSLNRHVGSYL 451

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 64/119 (53%), Gaps = 12/119 (10%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  DK+F   +SQ  +++     L +  + G+N T+  YG T  GKTYT++G        
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------- 198

Query: 125 LSDSAGIIPRVLFKLFESPEILND--DYIIKCSFVELYNEDLKDLLDDSVDNTYKKLRI 181
             +  GII   + +LF+  E + D  ++ +  S++E+YNE ++DLL+   D   KKL I
Sbjct: 199 -PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLLNP--DTPSKKLVI 254

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  125 bits (315), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 74/194 (38%), Positives = 113/194 (58%), Gaps = 17/194 (8%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D  + I + NL   +     D + L+ +G  +R  + T+ N+VSSRSH +  I + + + 
Sbjct: 264 DTQSHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 389 ----GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA----D 440
                  +  + ++++DLAGSE    +  +  R  E  +IN+SLL LG  IN+L      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 441 KSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNK-- 498
           +S HIP+R+SKLTRLL+ SLGGN KTV+I  ISP+  + DET +TL+YA++AK IK K  
Sbjct: 384 RSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTKII 443

Query: 499 -------PHLGSFI 505
                   H+GS++
Sbjct: 444 RNQQSLSRHVGSYL 457

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 59/112 (52%), Gaps = 10/112 (8%)

Query: 59  HMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE 118
           H     +  DK+F  ++SQ  ++KE   PL +  + G+N T+  YG T  GKTYT++G  
Sbjct: 147 HGGEIKFVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT- 205

Query: 119 KLYDGELSDSAGIIPRVLFKLFESPEILNDD--YIIKCSFVELYNEDLKDLL 168
                      GII   + +LF     L D+  + I  S++E+YNE ++DLL
Sbjct: 206 -------PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLL 250

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  123 bits (309), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 72/195 (36%), Positives = 113/195 (57%), Gaps = 18/195 (9%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D +  I + NL    +    D + L+ KG  +R  ++T  N+ SSRSH +  + + +++ 
Sbjct: 236 DVHRHITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNR 295

Query: 389 GGL----YRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA----- 439
                  ++ + ++L+DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 296 TAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKR 355

Query: 440 DKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNK- 498
               H+P+R+SKLTRLL+ SLGGN KTV+I  ISP   + DET +TL+YA++AK IK K 
Sbjct: 356 GGGFHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTKI 415

Query: 499 --------PHLGSFI 505
                    H+GS++
Sbjct: 416 IRNQHSLDRHVGSYL 430

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 65/117 (55%), Gaps = 15/117 (12%)

Query: 60  MNSKT-----YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTM 114
           MNS+      +  D+VF   ASQ+ +++    PL +  + G+N T+  YG T  GKTYT+
Sbjct: 115 MNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTV 174

Query: 115 TGDEKLYDGELSDSAGIIPRVLFKLFESPEILNDD--YIIKCSFVELYNEDLKDLLD 169
           +G         +++ GII   + +LF   E L D   + +  S++E+YNE ++DLL+
Sbjct: 175 SGT--------AENPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNESIRDLLE 223

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  123 bits (308), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 73/183 (39%), Positives = 109/183 (59%), Gaps = 13/183 (7%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEH- 387
           D NN+I + NL  +      + + L+ +G  +R  +ST  N+ SSRSH +  I L +++ 
Sbjct: 221 DANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNK 280

Query: 388 -----NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA--- 439
                N      S ++++DLAGSE    +  + +   E  +IN+SLL LG  IN+L    
Sbjct: 281 LNNDINSTEQLFSTLSIIDLAGSERAASTKNRGETLLEGANINKSLLALGNCINALCINT 340

Query: 440 ----DKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNI 495
                + IHIP+R+SKLTRLL+ SLGGN KTV+I  +SP+  + DET +TL+YA++AK I
Sbjct: 341 SSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYANRAKEI 400

Query: 496 KNK 498
           K K
Sbjct: 401 KTK 403

 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 66/119 (55%), Gaps = 12/119 (10%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  DK+   +++Q  +F+   EPL +  + GYN T+  YG T  GKTYT++G        
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGT------- 162

Query: 125 LSDSAGIIPRVLFKLFESPEILND--DYIIKCSFVELYNEDLKDLLDDSVDNTYKKLRI 181
             ++ GII   L  LF   E L D  +  I  S++E+YNE +KDLLD ++ +  KKL I
Sbjct: 163 -PENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLLDPTISS--KKLVI 218

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  123 bits (308), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 136/255 (53%), Gaps = 25/255 (9%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D +N   + NL      +  D + L+ KG  +R  + T  N+ SSRSH +  I + +   
Sbjct: 241 DTDNTTTVANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSSR 300

Query: 389 GGLYRVSK----MNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS-- 442
               +  K    ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 301 SVDLKEDKTYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRR 360

Query: 443 --IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKP- 499
              H+P+R+SKLTRLL+ SLGGN KTV+I  +SP+  + DET +TL+YA++AK+IK K  
Sbjct: 361 TYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTKVI 420

Query: 500 --------HLGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESY 551
                   H+GS+      LK IT++  +I  D +  R    + +  Q YK   N L+  
Sbjct: 421 RNQHSLDRHVGSY------LKMITSQKQEI--DELRNREAKMIDLRLQQYKLSRNKLQMA 472

Query: 552 KTEVQESKRANERLI 566
             E     ++N +++
Sbjct: 473 MWEAVNQLKSNYQVL 487

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 10/107 (9%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  DK+F   A+Q  +F     PL +  I G+N T+  YG T  GKT+T++G        
Sbjct: 130 FMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISG-------- 181

Query: 125 LSDSAGIIPRVLFKLFESPEILND--DYIIKCSFVELYNEDLKDLLD 169
             ++ GII   + +LF+  E L D   + +  S++E+YNE ++DLL+
Sbjct: 182 TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNEMIRDLLE 228

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  122 bits (307), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 73/183 (39%), Positives = 108/183 (59%), Gaps = 17/183 (9%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLY---- 384
           D+N +I + NL      +  D + L+ +G  +R  + T+ N VSSRSH +  I +     
Sbjct: 254 DSNEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRNK 313

Query: 385 ----KEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLAD 440
               KEH         ++++DLAGSE    +  + +R  E  +IN+SLL LG  IN+L  
Sbjct: 314 LVDLKEHQT----FGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCS 369

Query: 441 -----KSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNI 495
                ++ H+P+R+SKLTRLL+ SLGGN KTV+I  ISP+  + DET +TL+YA++AK I
Sbjct: 370 NDGSHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEI 429

Query: 496 KNK 498
           K K
Sbjct: 430 KTK 432

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 63/119 (52%), Gaps = 12/119 (10%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  DK+F    SQ+ +++     L +  + G+N T+  YG T  GKTYT++G        
Sbjct: 143 FVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSGTR------ 196

Query: 125 LSDSAGIIPRVLFKLFESPEIL--NDDYIIKCSFVELYNEDLKDLLDDSVDNTYKKLRI 181
             ++ GII R + +LF   + L    D+ +  SF+E+YNE + DLL  S D   +KL I
Sbjct: 197 --ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLL--SPDTPPQKLVI 251

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  122 bits (307), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 112/194 (57%), Gaps = 17/194 (8%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D+   I + NL         D + L+ +G  +R  + T  N+ SSRSH +  I + +++ 
Sbjct: 247 DSIKGISVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNR 306

Query: 389 GG----LYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA----D 440
                  +  + ++++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 307 TAELSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRR 366

Query: 441 KSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKP- 499
            + H+P+R+SKLTRLL+ SLGGN KTV+I  I+P+  + DET +TL+YA++AK IK K  
Sbjct: 367 STCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTKVI 426

Query: 500 --------HLGSFI 505
                   H+GS++
Sbjct: 427 RNQHSLDRHVGSYL 440

 Score = 68.9 bits (167), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 65/119 (54%), Gaps = 12/119 (10%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  DK+F   A+Q  +++    PL +  + G+N T+  YG T  GKT+T++G        
Sbjct: 136 FVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 187

Query: 125 LSDSAGIIPRVLFKLFESPEILNDD--YIIKCSFVELYNEDLKDLLDDSVDNTYKKLRI 181
             +  G+I   + +LF+  E L D   + +  S++E+YNE ++DLL  S D + KKL I
Sbjct: 188 TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLL--SPDISSKKLVI 244

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  120 bits (300), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 82/217 (37%), Positives = 119/217 (54%), Gaps = 28/217 (12%)

Query: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEH-----N 388
           +YI+N+ E  ++N    IK ++ G R+R   ST MN  SSRSH I +IT+ +       N
Sbjct: 189 MYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDIDLNTN 248

Query: 389 GGLYRVSKMNLVDLAGSENINKSGAQH-QRAKEAGSINQSLLTLGRVINSLADK------ 441
             +   S    VDLAGSE    +   H  R KE  SIN+SL TL RV+ SL  +      
Sbjct: 249 SSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKREELKYN 308

Query: 442 --------SIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAK 493
                   +I +PFRES LT +L+D+LGGN+KT +I+ ISP   N +E++STL YA  A+
Sbjct: 309 SNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPT--NFEESASTLRYADIAQ 366

Query: 494 NIKNKPHLGSFIMKDVL------LKNITTELNKIKSD 524
            IK    + ++    +L      L+ +  E+NK++ D
Sbjct: 367 TIKTNSIINTYSNTTLLDNLQKQLRIMEIEVNKLQKD 403

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 82/183 (44%), Gaps = 20/183 (10%)

Query: 13  ITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKVF- 71
           ++V VR   R+E         V++   I+ S+     T+       +   K +  DK F 
Sbjct: 5   VSVYVRVAPRDESRRHRAICKVINTDSILLSSNPKRQTTFIRSSFENKEEKIFKFDKCFD 64

Query: 72  ---GPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDS 128
              G   SQ   +K       +D + GYNC IL YG T +GKTYTM G+ K      +D+
Sbjct: 65  EGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------NDT 118

Query: 129 AGIIPRVLFKLFESPEIL----------NDDYIIKCSFVELYNEDLKDLLDDSVDNTYKK 178
            G+IPR    LF   E +            +Y + CS  E+YNE + DLL+ +   +  K
Sbjct: 119 RGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQIIDLLEMNEVQSCSK 178

Query: 179 LRI 181
            R+
Sbjct: 179 YRV 181

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 103/169 (60%), Gaps = 4/169 (2%)

Query: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN-GGLY 392
           +Y+Q+     +++  + +  +  G   R  +ST MN  SSRSH I  I L K  N  G  
Sbjct: 216 VYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVKINLLKRDNLEGSI 275

Query: 393 RVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS---IHIPFRE 449
           + S + LVDLAGSE ++K+ A     +EA  IN SL +LG VIN+L  K     HIP+R+
Sbjct: 276 QKSDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALTQKDKKRTHIPYRD 335

Query: 450 SKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNK 498
           S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL + S+AK I+NK
Sbjct: 336 SQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIENK 384

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 95/174 (54%), Gaps = 24/174 (13%)

Query: 12  NITVAVRCRGRNEREVQAKSSVV------VSVPDIMGSNEVSINTSDEVGIAAHMNSKTY 65
           N+ V VR +  +  E Q   +VV      V  P+    N+ S  +++  G+     S+++
Sbjct: 34  NVKVMVRLKPIDAPEKQYNVAVVALDESTVEFPN----NDTSPGSTN--GVQGESPSRSF 87

Query: 66  TVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGEL 125
             D VFG +++QD ++  +AE + + F  GYN TIL YG T +GK+YTM G         
Sbjct: 88  HFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP-------- 139

Query: 126 SDSAGIIPRVLFKLFESPEILND----DYIIKCSFVELYNEDLKDLLDDSVDNT 175
            D+ G+IPR+  ++FE   +L      +Y++  SF+E+Y E + DLL +S++ +
Sbjct: 140 IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLEKVYDLLGESINKS 193

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 72/196 (36%), Positives = 114/196 (58%), Gaps = 19/196 (9%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D+ N+ ++ NL +    N  + + L+ KG  +R  + T  N+ SSRSH +  I + + + 
Sbjct: 235 DSYNRTFVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNR 294

Query: 389 GGLYR----VSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS-- 442
               +     + ++++DLAGSE    +  + +R  E  +IN+SLL LG  IN+L   S  
Sbjct: 295 TADIKQDQTFATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSSTR 354

Query: 443 ----IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNK 498
                H+P+R+SKLTRLL+ SLGGN KTV+I  +SP+  + DET +TL+YA++AK IK K
Sbjct: 355 TGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIKTK 414

Query: 499 P---------HLGSFI 505
                     H+GS++
Sbjct: 415 VIRNKQSLDRHVGSYL 430

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 65/119 (54%), Gaps = 12/119 (10%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  D++F    +Q  +++    PL +  + G+N T+  YG T  GKT+T++G        
Sbjct: 124 FIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT------- 176

Query: 125 LSDSAGIIPRVLFKLFESPEILND--DYIIKCSFVELYNEDLKDLLDDSVDNTYKKLRI 181
            S+  GII   + +LF   E L D   + ++ SF+E+YNE + DLLD ++ +  KKL I
Sbjct: 177 -SEQPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLLDPNISS--KKLVI 232

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  120 bits (301), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 103/172 (59%), Gaps = 3/172 (1%)

Query: 330 NNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN- 388
           N   +Y++      +++  + +  +  G   R   ST MN  SSRSH I  I L K  N 
Sbjct: 185 NTFGVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHAIVKINLLKRDNL 244

Query: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA--DKSIHIP 446
            G  + S + LVDLAGSE + K+ A     +EA  IN SL +LG VIN+L   +K  HIP
Sbjct: 245 EGNIQKSDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVINALTQKEKRTHIP 304

Query: 447 FRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNK 498
           +R+S+LTRLL+DSLGGN+KT LI   +  K N  ET +TL + S+AK+IKNK
Sbjct: 305 YRDSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIKNK 356

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/150 (32%), Positives = 79/150 (52%), Gaps = 15/150 (10%)

Query: 30  KSSVVVSVPDIMGSNEVSINTSDEVGI---AAHMNSKTYTVDKVFGPSASQDLMFKEIAE 86
           K  VVV +  +      ++  +DE  +    A   ++ +  D VFG  A Q+ +F  +AE
Sbjct: 22  KMKVVVRLRPLPEGGSAAVVAADEGTVEFAGAADEARAFRFDYVFGTDARQEEVFDYVAE 81

Query: 87  PLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDSAGIIPRVLFKLFESPEIL 146
            + + F  GYN TIL YG T +GK+YTM G             G+IPR+  ++FE   +L
Sbjct: 82  EMLDQFFTGYNSTILAYGQTGSGKSYTMFGP--------PGHRGLIPRICQQIFERIGLL 133

Query: 147 ND----DYIIKCSFVELYNEDLKDLLDDSV 172
            +    +Y++  SF+E+Y E + DLL +S+
Sbjct: 134 KNCADIEYVVSVSFLEIYLEKVYDLLGESI 163

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  120 bits (301), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 78/192 (40%), Positives = 111/192 (57%), Gaps = 13/192 (6%)

Query: 318 KEQLTNSEKAPDNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHT 377
           K+ +++  +  D +   Y+ N++ F I N +D I L+ K    R  +ST +N  SSRSH 
Sbjct: 546 KDSISHEIRHDDQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHG 605

Query: 378 IFTITLYK-EHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVIN 436
           IF I L    H      +SK+NLVDLAGSE IN S  Q  R KE  SIN+SL  LG VI+
Sbjct: 606 IFIIYLEGYNHKTNEKCISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIH 665

Query: 437 SL------------ADKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSS 484
           +L              K+ HIPFR SKLT LL+ SL G++KT++   +S  + +++ET +
Sbjct: 666 ALNRGNKNHLNSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETIN 725

Query: 485 TLEYASKAKNIK 496
           +L +A+K  N K
Sbjct: 726 SLRFATKVNNTK 737

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/115 (36%), Positives = 59/115 (51%), Gaps = 16/115 (13%)

Query: 61  NSKTYTV--DKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE 118
           N+ TY+   D VF        +F EI E L +  + GYN  I  YG T +GKTYTM    
Sbjct: 438 NNATYSFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM---- 492

Query: 119 KLYDGELSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLLDD 170
                 L+ + G+IP  +  +F S + L     +Y + C F+ELYNE++ DL  D
Sbjct: 493 ------LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLFRD 541

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  117 bits (293), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 72/184 (39%), Positives = 109/184 (59%), Gaps = 11/184 (5%)

Query: 330 NNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITL-----Y 384
           +++  +++ L+E  ++N  + I  + KG  +R V ST MN  SSRSH IF I++     +
Sbjct: 174 HDHSTFVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQKETH 233

Query: 385 KEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLAD---- 440
           K+    +   S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI+ LA+    
Sbjct: 234 KKTGTVVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEGDRQ 293

Query: 441 KSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPH 500
           +S  IP+RES LT +L+++LGGN+ T L++ +SP   N  E+ STL YAS  K +K    
Sbjct: 294 RSQMIPYRESALTWILKENLGGNSNTCLVACVSPE--NYYESLSTLRYASLTKKVKTNAT 351

Query: 501 LGSF 504
           + S 
Sbjct: 352 INSM 355

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 61/120 (50%), Gaps = 21/120 (17%)

Query: 62  SKTYTVDKVFGPSASQDLMFKEIAEPLFEDFI----KGYNCTILVYGMTSTGKTYTMTGD 117
           +K +  D  FG + S D     I E L   ++    +GYN  IL YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 118 EKLYDGELSDSAGIIPRVLFKLFESPEILND---------DYIIKCSFVELYNEDLKDLL 168
           +         + GI+PR   +LFE   + +          D+ +KCSF E+YNE + DLL
Sbjct: 109 K--------GNEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDLL 160

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 115/187 (61%), Gaps = 13/187 (6%)

Query: 323 NSEKAPDNNNQI-YIQNLQEFYINNATDGI--------KLLQKGLRHRKVASTKMNDVSS 373
           N+++  D+ ++I + Q L+  YI N T  +        K+L++  + R  AST  N+ SS
Sbjct: 501 NNDRNADSKHEIRHDQELKTTYITNITTCVLDSRDTVDKVLKRANKLRSTASTAANEHSS 560

Query: 374 RSHTIFTITLYKEHNG-GLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLG 432
           RSH+IF I L  ++ G G      +NLVDLAGSE +N S    +R +E  SIN+SL  LG
Sbjct: 561 RSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERLNSSMVVGERLRETQSINKSLSCLG 620

Query: 433 RVINSL---ADKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYA 489
            VI++L     +  HIPFR SKLT LLQ SL G++KT++   ISPA ++++ET ++L +A
Sbjct: 621 DVIHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTLMFVNISPAALHLNETINSLRFA 680

Query: 490 SKAKNIK 496
           SK  N K
Sbjct: 681 SKVNNTK 687

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 14/107 (13%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  DK+F    + D +FKE+ + L +  + GYN  I  YG T +GKTYTM          
Sbjct: 397 FKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM---------- 445

Query: 125 LSDSAGIIPRVLFKLFESPEIL---NDDYIIKCSFVELYNEDLKDLL 168
           L+   GI+P  +  +F   + L      Y + C F+E+YNE++ DLL
Sbjct: 446 LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLL 492

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  119 bits (297), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 121/220 (55%), Gaps = 17/220 (7%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D+++   + NL         D + L+ +G  +R  + T  N+ SSRSH +  + + +   
Sbjct: 239 DSDSTTTVANLSYHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQSSR 298

Query: 389 GGLYRVSKM----NLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS-- 442
               +  KM    +++DLAGSE  + +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 299 TVDLKEDKMYATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTGRR 358

Query: 443 --IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKP- 499
              H+P+R+SKLTRLL+ SLGGN KTV+I  +SP+  + DET +TL+YA++AK+IK K  
Sbjct: 359 AVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTKVI 418

Query: 500 --------HLGSFIMKDVLLKNITTELNKIKSDLMSTRLK 531
                   H+GS++      K    EL   ++ ++  RL+
Sbjct: 419 RNQHSLDRHVGSYLKMITAQKQEIEELRSREAKVIDLRLQ 458

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 64/119 (53%), Gaps = 12/119 (10%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  DK+F   ASQ  +F+    PL +  + G+N T+  YG T  GKT+T++G        
Sbjct: 128 FMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 125 LSDSAGIIPRVLFKLFESPEILND--DYIIKCSFVELYNEDLKDLLDDSVDNTYKKLRI 181
             DS GII   + +LF+    L D   + +  S++E+YNE ++DLL+   D   +KL I
Sbjct: 180 TPDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNETIRDLLEP--DTPSQKLII 236

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  119 bits (297), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 112/195 (57%), Gaps = 18/195 (9%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK-EH 387
           D++ +I + NL         + +  + +G  +R  + T  N+ SSRSH +  I + + + 
Sbjct: 239 DSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDR 298

Query: 388 NGGLYR---VSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA----- 439
              L      + ++++DLAGSE    +  + +R  E  +IN+SLL LG  IN+L      
Sbjct: 299 TPDLISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGT 358

Query: 440 DKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNK- 498
            ++ H+P+R+SKLTRLL+ SLGGN KTV+I  ISP+  + DET +TL YA++AK+IK K 
Sbjct: 359 RRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTKI 418

Query: 499 --------PHLGSFI 505
                    H+GS++
Sbjct: 419 IRNQQSLNRHVGSYL 433

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 65/119 (54%), Gaps = 12/119 (10%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  DK+F  +A+Q  ++      L +  + G+N T+  YG T  GKT+T++G        
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG-------- 179

Query: 125 LSDSAGIIPRVLFKLFESPEILNDDYIIK--CSFVELYNEDLKDLLDDSVDNTYKKLRI 181
             +  GII   + +LF+  E L D   I+   S++E+YNE ++DLL+ +V  + KKL I
Sbjct: 180 TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLLNPNV--SSKKLVI 236

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  115 bits (289), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/180 (41%), Positives = 107/180 (59%), Gaps = 21/180 (11%)

Query: 337 QNLQEFYINNATDGI--------KLLQKGLRHRKVASTKMNDVSSRSHTIFTITLY---- 384
            +L +  I NAT  +        K+L++  + R  AST  N+ SSRSH+IF I L+    
Sbjct: 588 HDLGKTTITNATTCVLESKESVDKVLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNH 647

Query: 385 --KEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS 442
             KE + G+     +NLVDLAGSE ++ S    +R +E  +IN+SL  LG VI +L DK+
Sbjct: 648 KTKEESCGV-----LNLVDLAGSERVHSSQVTGERLRETQNINRSLSCLGDVIYALNDKN 702

Query: 443 I--HIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPH 500
              HIPFR SKLT LLQ SL GN+KT++   ISP+  +++ET ++L +ASK    +   H
Sbjct: 703 TKRHIPFRNSKLTYLLQYSLVGNSKTLMFVNISPSSSHINETINSLRFASKVNATRMAKH 762

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 60/108 (55%), Gaps = 14/108 (12%)

Query: 64  TYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDG 123
           ++  DK+F    S D +FKE+ + L +  + GYN  I  YG T +GKTYTM         
Sbjct: 471 SFKFDKIFDTGESNDEVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 520

Query: 124 ELSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLL 168
            L  + G+IP  +  +F+  E L +   +Y I C FVE+YNE++ DLL
Sbjct: 521 -LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLL 567

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  114 bits (285), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 90/148 (60%), Gaps = 4/148 (2%)

Query: 353 LLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN-GGLYRVSKMNLVDLAGSENINKS 411
           L++K  + R  A+T  N+ SSRSH+IF I L   +N  G      +NLVDLAGSE +N S
Sbjct: 539 LIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGESSYGILNLVDLAGSERLNSS 598

Query: 412 GAQHQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLTRLLQDSLGGNTKTVL 468
             +  R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ SL GN+KT++
Sbjct: 599 QVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKTLM 658

Query: 469 ISTISPAKINVDETSSTLEYASKAKNIK 496
              ISP +  + ET ++L +ASK    K
Sbjct: 659 FVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 82/175 (46%), Gaps = 33/175 (18%)

Query: 5   HTSGEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSI--------NTSDEVGI 56
           H   +EL   + V CR R           + SV DI  +N + +        N S E+ +
Sbjct: 340 HNDLQELRGNIRVFCRIR---------PPLKSVEDI-NTNHIKVQPFNDNHGNQSMEI-V 388

Query: 57  AAHMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTG 116
             H   + +  D++F        +F EI + L +  + GYN  I  YG T +GKT+TM  
Sbjct: 389 KDHRCIQKFQFDRIFDQHEVNKDVFDEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM-- 445

Query: 117 DEKLYDGELSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLL 168
                   L+ + G+IP  +  +F+  + L +   +Y + C FVE+YNE++ DLL
Sbjct: 446 --------LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLL 492

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 96/151 (63%), Gaps = 8/151 (5%)

Query: 352 KLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEH---NGGLYRVSKMNLVDLAGSENI 408
           K+L +  + R  ASTK N+ SSRSH+IF I L+ ++   N   Y +  +NLVDLAGSE I
Sbjct: 554 KVLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGI--LNLVDLAGSERI 611

Query: 409 NKSGAQHQRAKEAGSINQSLLTLGRVINSL---ADKSIHIPFRESKLTRLLQDSLGGNTK 465
           N S    +R +E   IN+SL  LG VI++L     K  HIPFR SKLT LL+ SL GN+K
Sbjct: 612 NSSQVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNSK 671

Query: 466 TVLISTISPAKINVDETSSTLEYASKAKNIK 496
           T++   IS +  +V+ET ++L +ASK  + K
Sbjct: 672 TLMFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 62/116 (53%), Gaps = 14/116 (12%)

Query: 56  IAAHMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMT 115
           I  + N+  Y  DK+F    S   +FKE+ + L +  + GYN  I  YG T +GKT+TM 
Sbjct: 412 ITKNNNTNKYKFDKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGKTFTM- 469

Query: 116 GDEKLYDGELSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLL 168
                    L+ S GIIP  +  +F   + L +   +Y I C FVE+YNE++ DLL
Sbjct: 470 ---------LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDLL 516

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 70/153 (45%), Positives = 93/153 (60%), Gaps = 6/153 (3%)

Query: 348 TDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKE-HNGGLYRVSKMNLVDLAGSE 406
            DG  LL+K  R R  AST  N+ SSRSH++F I L    H  G      +NLVDLAGSE
Sbjct: 563 VDG--LLRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQSDGILNLVDLAGSE 620

Query: 407 NINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLTRLLQDSLGGN 463
            IN S    +R +E  +IN+SL  LG V+++L        HIPFR SKLT LLQ SL GN
Sbjct: 621 RINSSQVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGN 680

Query: 464 TKTVLISTISPAKINVDETSSTLEYASKAKNIK 496
           +KT++   IS  + +++ET ++L +ASK  + K
Sbjct: 681 SKTLMFVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 86/176 (48%), Gaps = 20/176 (11%)

Query: 5   HTSGEELNITVAVRCRGRNEREVQAKSSVVVSV---PDIMGSNEVSINTSDEVGIAAHMN 61
           H   +EL   + V CR R   + +  ++  ++V    D  G   + I  S+  G +   N
Sbjct: 368 HNELQELRGNIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQN 427

Query: 62  SKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLY 121
              +  D++F  + + + +F+EI + L +  + GYN  I  YG T +GKTYTM       
Sbjct: 428 ---FKFDRIFDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM------- 476

Query: 122 DGELSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLLDDSVDN 174
              L+   GIIP  +  +F   E L +   +Y I C F+E+YNE++ DLL    D+
Sbjct: 477 ---LNPRNGIIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLLRSDQDD 529

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  110 bits (274), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 67/165 (40%), Positives = 100/165 (60%), Gaps = 4/165 (2%)

Query: 336 IQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNG-GLYRV 394
           ++NL+   + +      +L+  ++ R  AST  N+ SSRSH+IF I ++  + G G  R 
Sbjct: 506 VENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIFIIKIHGINEGLGEERN 565

Query: 395 SKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESK 451
             +NL+DLAGSE ++ S  Q +R KE   IN+SL  LG V+NSL        HI FR+SK
Sbjct: 566 GLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMNSLGSPDATTRHISFRDSK 625

Query: 452 LTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIK 496
           LT LLQ SL GN+KT+++  IS +  +++ET  +L +A K  + K
Sbjct: 626 LTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVNSTK 670

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 62/116 (53%), Gaps = 16/116 (13%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           Y+ DKVF  + +   +FKE++E L +  + G+N  I  YG T +GKT+TM          
Sbjct: 383 YSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTGSGKTFTM---------- 431

Query: 125 LSDSAGIIPRV---LFKLFESPEILNDDYIIKCSFVELYNEDLKDLL--DDSVDNT 175
           L+   GIIP     +F   ++       Y + C F+E+YN+++ DLL  DD+  N+
Sbjct: 432 LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDEIYDLLRSDDNKSNS 487

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 99/165 (60%), Gaps = 4/165 (2%)

Query: 336 IQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLY-KEHNGGLYRV 394
           + N+    +NN      +L+K  + R  A+T  N+ SSRSH++F I L  K    G    
Sbjct: 554 VTNINTIALNNKGIVNNVLKKATKLRATAATNSNERSSRSHSVFMIYLKGKNEITGDSSE 613

Query: 395 SKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA---DKSIHIPFRESK 451
             +NLVDLAGSE +N S A   R +E  +IN+SL  LG VI++L    +   HIPFR SK
Sbjct: 614 GILNLVDLAGSERLNSSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSK 673

Query: 452 LTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIK 496
           LT LLQ SL G++KT++   ISP K +++ET ++L +ASK  + K
Sbjct: 674 LTYLLQYSLTGSSKTLMFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 65/116 (56%), Gaps = 15/116 (12%)

Query: 62  SKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLY 121
           S+ Y  D++F  + S   +FKEI + L +  + G+N  I  YG T +GKTYTM       
Sbjct: 427 SQIYKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM------- 478

Query: 122 DGELSDSAGIIPRVLFKLFESPEILNDD---YIIKCSFVELYNEDLKDLL-DDSVD 173
              L+D+ G+IP  +  +F+  E + +    Y I C F+E+YNE + DLL D+S D
Sbjct: 479 ---LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLLRDNSTD 531

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 90/144 (62%), Gaps = 4/144 (2%)

Query: 353 LLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEH-NGGLYRVSKMNLVDLAGSENINKS 411
           +L+K  + R  AST  N+ SSRSH+IF I L   +   G +    +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 412 GAQHQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLTRLLQDSLGGNTKTVL 468
                R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++KT++
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 469 ISTISPAKINVDETSSTLEYASKA 492
              ISP+  +++ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 68.2 bits (165), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 55/107 (51%), Gaps = 14/107 (13%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  DK+F    +   +FKE+ + L +  + GYN  I  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 125 LSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLL 168
           L+   GIIP  +  +F     L     DY + C F+E+YNE++ DLL
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  108 bits (271), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 113/207 (54%), Gaps = 20/207 (9%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITL-YKEH 387
           D+ + + +  L E  + ++ D +K +  G  +R+   T  N  SSRSH I T+ L   + 
Sbjct: 273 DSKHGVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACTDL 332

Query: 388 NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIH--- 444
             G    S ++L DLAGSE   ++  QH+R KE   IN+SLL LG VI+ L+  S+H   
Sbjct: 333 VSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSMHTTP 389

Query: 445 ------IPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNI--- 495
                 IP+R+SKLTR+LQ +L G +    I TI      + ET +T+ +AS+AKN+   
Sbjct: 390 SFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKNVSMT 449

Query: 496 --KNKPHLGSFIMKDVLLKNITTELNK 520
             +N+  L     KD L+ N+  +L++
Sbjct: 450 VKRNEAELAH--EKDALIHNLRRQLDE 474

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 78/152 (51%), Gaps = 12/152 (7%)

Query: 21  GRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKVFGPSASQDLM 80
           G N ++ +   SV + +     + +     SDE  IA H +   +  D VF P ++   +
Sbjct: 96  GENSQQYRGAISVSIRLKPTDANAKNPWFVSDEQTIA-HNDVGEFKFDNVFRPQSNNYEV 154

Query: 81  FKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDSAGIIPRVLFKLF 140
           +++I +P+ +   +GYN  I  YGMT +GKT+TM+G          + AG+I   +  +F
Sbjct: 155 YQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGT--------PEEAGLISLSVEHIF 206

Query: 141 E---SPEILNDDYIIKCSFVELYNEDLKDLLD 169
               S  + N  + +  S++E+YNE + DLL+
Sbjct: 207 AQIMSESLANKSFQVTVSYLEIYNEKIYDLLN 238

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 92/148 (62%), Gaps = 4/148 (2%)

Query: 353 LLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN-GGLYRVSKMNLVDLAGSENINKS 411
           +L++  + R  AST  N+ SSRSH+IF I L   ++  G      +NLVDLAGSE IN S
Sbjct: 548 ILKRANKLRSTASTGSNEHSSRSHSIFIIHLRGSNSLTGEESYGILNLVDLAGSERINSS 607

Query: 412 GAQHQRAKEAGSINQSLLTLGRVINSLADKS---IHIPFRESKLTRLLQDSLGGNTKTVL 468
                R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ SL GN+KT++
Sbjct: 608 QVTGDRLRETQNINRSLSCLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSKTLM 667

Query: 469 ISTISPAKINVDETSSTLEYASKAKNIK 496
              ISP+  +++ET ++L +ASK  + K
Sbjct: 668 FVNISPSANHINETINSLRFASKVNSTK 695

 Score = 78.2 bits (191), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 85/178 (47%), Gaps = 25/178 (14%)

Query: 5   HTSGEELNITVAVRCRGRNE-REVQAKSSVVVSVPDIMGSNEVSINTSDEV--GIAAHMN 61
           H   +EL   + V CR R     +++K +  + V D    N +    S EV  GI  + N
Sbjct: 339 HNELQELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDNGIQ---SMEVMKGIEVNNN 395

Query: 62  SKT-----YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTG 116
           + T     +  DK+F  + +   +FKE+ + L +  + GYN  I  YG T +GKTYTM  
Sbjct: 396 NATQIPQRFKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM-- 452

Query: 117 DEKLYDGELSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLLDDS 171
                   L    GIIP  +  +F   + L +    Y I C FVE+YNE++ DLL  S
Sbjct: 453 --------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDLLRSS 502

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  107 bits (268), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 101/177 (57%), Gaps = 13/177 (7%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK-EH 387
           D N  + +  L E    +  + +  ++ G +HRK +ST  N  SSRSH I  I L   + 
Sbjct: 226 DPNYGVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRSHAIILIRLISSDL 285

Query: 388 NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADK------ 441
           + G    S ++L DLAGSE +    AQH+R +E   IN+SLL LG VI+ L+ +      
Sbjct: 286 SSGEVVTSTLSLCDLAGSERVT---AQHERRQEGSFINKSLLALGTVISKLSAEVNNSTE 342

Query: 442 ---SIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNI 495
              + HIP+R+SKLTR+LQ +L GN+    I TI  +    +E+ +TL +AS+AKN+
Sbjct: 343 SVNNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVNTLRFASRAKNV 399

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 64/119 (53%), Gaps = 12/119 (10%)

Query: 59  HMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE 118
           H +   YT D VF P AS   ++    +PL +    G+N T+  YGMT +GKTYTM+G  
Sbjct: 98  HTDIGEYTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG-- 155

Query: 119 KLYDGELSDSAGIIP----RVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVD 173
              DG    +AG+IP     +  K+F+S    N  Y    S++E+YNE + DLL+   D
Sbjct: 156 --VDG----NAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLLETDFD 208

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 89/144 (61%), Gaps = 4/144 (2%)

Query: 353 LLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEH-NGGLYRVSKMNLVDLAGSENINKS 411
           LL++  + R  A+T  N+ SSRSH++F I L   + N G      +NLVDLAGSE IN S
Sbjct: 554 LLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYNSNTGEECQGTLNLVDLAGSERINAS 613

Query: 412 GAQHQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLTRLLQDSLGGNTKTVL 468
                R +E  +IN+SL  LG VI++LA       HIPFR SKLT LLQ SL G++KT++
Sbjct: 614 QVTGDRLRETQNINKSLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLLGDSKTLM 673

Query: 469 ISTISPAKINVDETSSTLEYASKA 492
              ISP   + +ET ++L +ASK 
Sbjct: 674 FVNISPCLDHFNETLNSLRFASKV 697

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 52/170 (30%), Positives = 80/170 (47%), Gaps = 19/170 (11%)

Query: 2   QKTHTSGEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMN 61
           +K H   +EL   + V CR R   + +   S  V + ++   +E     +  + I     
Sbjct: 355 RKLHNELQELRGNIRVFCRIRPLLQGEGSESCHVHI-NLFNDDE----GTQSMNITRDSK 409

Query: 62  SKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLY 121
              +  DK+F P  S D +F+EI + L +  + GYN  I  YG T +GKTYTM       
Sbjct: 410 KHEFKFDKIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM------- 461

Query: 122 DGELSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLL 168
              L    G+IP  L  +F+   +L +   +Y I   F+E+YNE + DLL
Sbjct: 462 ---LHPQNGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLL 508

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  108 bits (269), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 89/144 (61%), Gaps = 4/144 (2%)

Query: 353 LLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEH-NGGLYRVSKMNLVDLAGSENINKS 411
           +L+K  + R  AST  N+ SSRSH+IF I L   +   G      +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSERINIS 636

Query: 412 GAQHQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLTRLLQDSLGGNTKTVL 468
                R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++KT++
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 469 ISTISPAKINVDETSSTLEYASKA 492
              ISP+  +++ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 71.2 bits (173), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 84/175 (48%), Gaps = 22/175 (12%)

Query: 5   HTSGEELNITVAVRCRGRNERE-VQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSK 63
           H   +EL   + V CR R   E ++   + ++ V +    +   + + +   I +     
Sbjct: 377 HNELQELRGNIRVYCRIRPPLETLENLDTSLIRVNEF--DDNRGVQSMEVTKIQSTTQVH 434

Query: 64  TYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTM--TGDEKLY 121
            +  DK+F    + + +FKE+ + L +  + GYN  I  YG T +GKT+TM  TGD    
Sbjct: 435 EFKFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD---- 489

Query: 122 DGELSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLL-DDSV 172
                   GIIP  +  +F     L     DY + C F+E+YNE++ DLL +DS+
Sbjct: 490 --------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDLLRNDSI 536

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  107 bits (268), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 89/144 (61%), Gaps = 4/144 (2%)

Query: 353 LLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN-GGLYRVSKMNLVDLAGSENINKS 411
           +L+K  + R  AST  N+ SSRSH+IF I L   +   G      +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINIS 636

Query: 412 GAQHQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLTRLLQDSLGGNTKTVL 468
                R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++KT++
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 469 ISTISPAKINVDETSSTLEYASKA 492
              ISP+  +++ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/168 (28%), Positives = 78/168 (46%), Gaps = 17/168 (10%)

Query: 5   HTSGEELNITVAVRCRGRNERE-VQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSK 63
           H   +EL   + V CR R   E ++   + +++V +    +   I + +   I       
Sbjct: 377 HNELQELRGNIRVYCRIRPALETLEDSDTSLINVNEF--DDNCGIQSMEVTKIHNTAQVH 434

Query: 64  TYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDG 123
            +  DK+F    +   +FKE+ + L +  + GYN  I  YG T +GKT+TM         
Sbjct: 435 EFKFDKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM--------- 484

Query: 124 ELSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLL 168
            L+   GIIP  +  +F     L     DY + C F+E+YNE++ DLL
Sbjct: 485 -LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  107 bits (266), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 64/150 (42%), Positives = 95/150 (63%), Gaps = 2/150 (1%)

Query: 353 LLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN-GGLYRVSKMNLVDLAGSENINKS 411
           +L+   + + +A+T  N+ SSRSH++FTI ++  ++  G      +NLVDLAGSE I+ S
Sbjct: 541 VLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEASDGVLNLVDLAGSERIDTS 600

Query: 412 GAQHQRAKEAGSINQSLLTLGRVINSLADKSI-HIPFRESKLTRLLQDSLGGNTKTVLIS 470
                R +E  +IN+SL  LG VI +L  K + HIPFR SKLT LLQ SL G++KT++  
Sbjct: 601 NVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSKTLMFV 660

Query: 471 TISPAKINVDETSSTLEYASKAKNIKNKPH 500
            +SP+  +V ET ++L +ASK  + K   H
Sbjct: 661 NVSPSSNHVKETLNSLRFASKVNSTKINQH 690

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 88/173 (50%), Gaps = 25/173 (14%)

Query: 2   QKTHTSGEELNITVAVRCRGRN--EREVQAKSSVVVSVPDIM-GSNEVSINTSDEVGIAA 58
           +K H   +EL   + V CR R   E EVQ  S + VS  D   GS  + I+  D      
Sbjct: 346 RKLHNELQELRGNIRVYCRIRPPLENEVQDISHIHVSNFDNRNGSQAIEISNEDR----- 400

Query: 59  HMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE 118
             NS+ +  DKVF  +AS   +F+E+ + L +  + GYN  I  YG T +GKTYTM    
Sbjct: 401 --NSR-FLFDKVFSSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM---- 452

Query: 119 KLYDGELSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLL 168
                 ++D  G+IP  L  +F+   +L +   DY  +  F+E+YNE + DLL
Sbjct: 453 ------MNDPDGVIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQIVDLL 499

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  106 bits (265), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 81/232 (34%), Positives = 117/232 (50%), Gaps = 38/232 (16%)

Query: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN--GGL 391
           + I  L E   + + + +K ++ G  +RK + T+ N  SSRSH +  + L   HN   G 
Sbjct: 267 VKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLVT-HNVIDGS 325

Query: 392 YRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSI-------- 443
              S + L DLAGSE   ++  Q +R KE   IN+SLL LG VI+ L+ +S+        
Sbjct: 326 KTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLSNSKHVSN 382

Query: 444 ----------------HIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLE 487
                           HIP+R+SKLTRLLQ +L GN+    I TI P      ET +TL 
Sbjct: 383 PMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAETINTLR 442

Query: 488 YASKAKNI-------KNKPHLG-SFIMKDVLLKNITTELNKIKSDLMSTRLK 531
           +AS+AKN+       KN   +  S + KD ++K +T  L K K  +   +LK
Sbjct: 443 FASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQKETINDMKLK 494

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 62/118 (52%), Gaps = 13/118 (11%)

Query: 61  NSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKL 120
           N+  Y  D VF P      ++K  A PL +    G+N T+  YGMT +GKTYTM GD + 
Sbjct: 129 NNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMGDNEN 188

Query: 121 YDGELSDSAGIIPRVLFKLFESPEILND----DYIIKCSFVELYNEDLKDLLDDSVDN 174
            D       GI+P  +  LF   ++LN      Y +  S++E+YNE + DLLDD   N
Sbjct: 189 PD-------GIVPLSVSLLFN--QVLNSRNDKKYDVILSYLEIYNEKIYDLLDDDRTN 237

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  106 bits (265), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 89/145 (61%), Gaps = 4/145 (2%)

Query: 352 KLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK-EHNGGLYRVSKMNLVDLAGSENINK 410
           ++L++  + R  AST  N+ SSRSH+IF I L       G      +NLVDLAGSE IN 
Sbjct: 575 RVLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQSYGTLNLVDLAGSERINI 634

Query: 411 SGAQHQRAKEAGSINQSLLTLGRVINSLADKSI---HIPFRESKLTRLLQDSLGGNTKTV 467
           S     R +E  +IN+SL  LG VI++L        HIPFR SKLT LLQ SL G++KT+
Sbjct: 635 SQVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTL 694

Query: 468 LISTISPAKINVDETSSTLEYASKA 492
           +   ISP+  +++ET ++L +ASK 
Sbjct: 695 MFVNISPSSSHINETLNSLRFASKV 719

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 56/107 (52%), Gaps = 14/107 (13%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  DK+F    + + +FKE+ + L +  + GYN  I  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 125 LSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLL 168
           L+   GIIP  +  +F     L     DY + C F+E+YNE++ DLL
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  106 bits (265), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 100/168 (59%), Gaps = 8/168 (4%)

Query: 335 YIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKE--HNGGLY 392
           YI N+    + + +    +L+K  + R  A+T+ N+ SSRSH++F + +     H G   
Sbjct: 540 YITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHINGRNLHTGETS 599

Query: 393 RVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSL----ADKSIHIPFR 448
           +  K+NLVDLAGSE IN S    +R +E  +IN+SL  LG VI +L    A K  +IPFR
Sbjct: 600 Q-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKR-YIPFR 657

Query: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIK 496
            SKLT LLQ SL G++KT++   I P   ++ ET ++L +ASK  + K
Sbjct: 658 NSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 87/175 (49%), Gaps = 22/175 (12%)

Query: 2   QKTHTSGEELNITVAVRCRGRNE--REVQAKSSVVVS-VPDIMGSNEVSINTSDEVGIAA 58
           +K H   +EL   + V CR R     E Q  S +++    +  G+  ++IN ++      
Sbjct: 354 RKLHNELQELRGNIRVYCRVRPPLLNEPQDMSHILIEKFNEAKGAQSLTINRNE-----G 408

Query: 59  HMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE 118
            + S  +  D +F PS +   +F+EI + L +  + GYN  I  YG T +GKTYTM    
Sbjct: 409 RILSYNFQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---- 463

Query: 119 KLYDGELSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLLDD 170
                 L+   G+IP  L  +F+    L +   +Y ++C ++E+YNE + DLL D
Sbjct: 464 ------LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLLRD 512

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/149 (47%), Positives = 94/149 (63%), Gaps = 4/149 (2%)

Query: 352 KLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN-GGLYRVSKMNLVDLAGSENINK 410
           +LL++  + R  AST  N+ SSRSH+IF + L  E+   G      +NLVDLAGSE IN 
Sbjct: 548 ELLKRANKLRSTASTACNERSSRSHSIFIVHLSGENVLTGERSHGILNLVDLAGSERINT 607

Query: 411 SGAQHQRAKEAGSINQSLLTLGRVINSL--ADKS-IHIPFRESKLTRLLQDSLGGNTKTV 467
           S    +R +E  SIN+SL  LG VI++L  AD S  HIPFR SKLT LLQ SL GN+KT+
Sbjct: 608 SQVIGERLRETQSINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNSKTL 667

Query: 468 LISTISPAKINVDETSSTLEYASKAKNIK 496
           +   IS    + +ET ++L +ASK  + K
Sbjct: 668 MFVNISGNPNHTNETLNSLRFASKVNSTK 696

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 84/173 (48%), Gaps = 19/173 (10%)

Query: 1   MQKT-HTSGEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAH 59
           M++T H   +EL   + V CR R     +  +S  + V +    N+ + N   EV    +
Sbjct: 340 MRRTLHNELQELRGNIRVFCRVRPPLPRENATSNHLKVREF---NDDAGNQVIEVAKNGY 396

Query: 60  MNS-KTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE 118
            +  + +  D++F    +   +F+EI + L +  + GYN  I  YG T +GKTYTM    
Sbjct: 397 GSGPQIFKFDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---- 451

Query: 119 KLYDGELSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLL 168
                 L+ + GIIP  +  +F   + L +    Y + C FVE+YNE + DLL
Sbjct: 452 ------LNPTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLL 498

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/144 (41%), Positives = 96/144 (66%), Gaps = 4/144 (2%)

Query: 353 LLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNGGLYRVSK-MNLVDLAGSENINKS 411
           L+Q+  + R+ A T MN+ SSRSH++F + +   +     R    +NLVDLAGSE +N+S
Sbjct: 551 LVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCKGVLNLVDLAGSERMNRS 610

Query: 412 G-AQHQRAKEAGSINQSLLTLGRVINSL--ADKSIHIPFRESKLTRLLQDSLGGNTKTVL 468
           G    +R +E   IN+SL ++G VI++L     S+HIPFR +KLT LL+ SL G++KT++
Sbjct: 611 GLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSLQGSSKTLM 670

Query: 469 ISTISPAKINVDETSSTLEYASKA 492
           + T+SP+  + +ET ++L +A+K 
Sbjct: 671 LVTVSPSNSSRNETMNSLRFATKV 694

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 52/175 (29%), Positives = 80/175 (45%), Gaps = 23/175 (13%)

Query: 2   QKTHTSGEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHM- 60
           +K H   +EL   + V CR R        +    ++  + G +  +   S  + I   M 
Sbjct: 350 RKVHNQIQELRGNIRVFCRVR-------PTDDDTNIIKVHGFDSDTGTQSLTLDIKRPMT 402

Query: 61  -NSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEK 119
             S  +  DK+F    S   +F E+ E L +  + G+N  I  YG T +GKTYTM     
Sbjct: 403 NGSVNFQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGKTYTM----- 456

Query: 120 LYDGELSDSAGIIPRVLFKLFE---SPEILNDDYIIKCSFVELYNEDLKDLLDDS 171
                L++  GIIP  L  + +   S + L   Y +K  FVE+YN+ + DLL+D 
Sbjct: 457 -----LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLNDG 506

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 94/149 (63%), Gaps = 4/149 (2%)

Query: 352 KLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN-GGLYRVSKMNLVDLAGSENINK 410
           ++L++ L+ R  A+T  N  SSRSH++F I L   +   G      +NLVDLAGSE I+ 
Sbjct: 549 RMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEKSTGTLNLVDLAGSERIHS 608

Query: 411 SGAQHQRAKEAGSINQSLLTLGRVINSL--ADKS-IHIPFRESKLTRLLQDSLGGNTKTV 467
              Q +R +E  +IN+SL  LG VI++L  AD S  HIPFR SKLT LLQ SL G++KT+
Sbjct: 609 LQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLMGDSKTL 668

Query: 468 LISTISPAKINVDETSSTLEYASKAKNIK 496
           +   +SP   ++ ET ++L +A+K  + K
Sbjct: 669 MFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 75.5 bits (184), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 88/191 (46%), Gaps = 32/191 (16%)

Query: 2   QKTHTSGEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVG---IAA 58
           +K H   +EL   + V CR R   E +  SS  + +             SDE G   I  
Sbjct: 351 RKLHNELQELRGNIRVFCRLRPALENENYSSSSIEIEKF----------SDETGMQSITI 400

Query: 59  HMNSKT--YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTG 116
             +SK   +T D+ F    +   +F EI + L +  + GYN  I  YG T +GKT+TM  
Sbjct: 401 KRDSKQHKFTFDRCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM-- 457

Query: 117 DEKLYDGELSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLL---DD 170
                   L+ + GIIP  L  +F   E L +    Y I   FVE+YNE++KDL    D 
Sbjct: 458 --------LNPNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLFKENDA 509

Query: 171 SVDNTYKKLRI 181
            VD+T + L+ 
Sbjct: 510 DVDDTGESLKF 520

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/182 (37%), Positives = 101/182 (55%), Gaps = 18/182 (9%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN 388
           D+   + +  L+E    ++ + +K +++G  HRK A T  N  SSRSH I  I L   + 
Sbjct: 274 DSKYGVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTNV 333

Query: 389 -GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSI---- 443
             G    S ++L DLAGSE   ++  Q +R KE   IN+SLL LG VI+ L+ +S     
Sbjct: 334 IDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAASH 390

Query: 444 ----------HIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAK 493
                     HIP+R+SKLTR+LQ +L G++    I TI   K +  ET +TL +AS+AK
Sbjct: 391 GNSPNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRAK 450

Query: 494 NI 495
           N+
Sbjct: 451 NV 452

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 61/116 (52%), Gaps = 8/116 (6%)

Query: 58  AHMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGD 117
            H +   +  D V+ P  S   +++ I +P+ +   +G+N T+  YGMT +GKTYTM G 
Sbjct: 128 VHDDMGEFKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGS 187

Query: 118 EKLYDGELSDSAGIIP---RVLF-KLFESPEILNDDYIIKCSFVELYNEDLKDLLD 169
                 +  D  G+IP     LF K+ E   +    + +  S++E+YNE + DLLD
Sbjct: 188 GG----DGGDDDGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLLD 239

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 92/153 (60%), Gaps = 9/153 (5%)

Query: 353 LLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN-GGLYRVSKMNLVDLAGSENINKS 411
           +L++  + R  AST  N+ SSRSH+IF I L   +   G      +NLVDLAGSE IN S
Sbjct: 603 ILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEKSYGILNLVDLAGSERINSS 662

Query: 412 GAQHQRAKEAGSINQSLLTLGRVINSLAD--------KSIHIPFRESKLTRLLQDSLGGN 463
               +R +E  +IN+SL  LG VI++L          K  HIPFR SKLT LLQ SL GN
Sbjct: 663 QVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSLIGN 722

Query: 464 TKTVLISTISPAKINVDETSSTLEYASKAKNIK 496
           +KT++   ISP+   V+ET ++L +ASK  + K
Sbjct: 723 SKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 78.6 bits (192), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 86/180 (47%), Gaps = 18/180 (10%)

Query: 5   HTSGEELNITVAVRCRGRNE---REVQAKSSVVVS-VPDIMGSNEVSINTSDEVGIAAHM 60
           H + +EL   + V CR R     +E    S + VS   D  G+  + I  +     + + 
Sbjct: 389 HNTLQELRGNIRVYCRIRPPILPQESNNTSHLKVSEFDDNNGTQTLEIQKALNNNSSNNS 448

Query: 61  NSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKL 120
            +  +  DK+F  + + D +FKE+ + L +  + GYN  I  YG T +GKTYTM      
Sbjct: 449 TTLKFKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM------ 501

Query: 121 YDGELSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLLDDSVDNTYK 177
               L    GIIP  +  +F     L +    Y I+C FVE+YNE++ DLL +  DN  K
Sbjct: 502 ----LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLLRNEHDNNGK 557

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 98/177 (55%), Gaps = 13/177 (7%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITL-YKEH 387
           D+   + +  L E  ++ + D +K +  G  +RK   T  N  SSRSH I  I L   + 
Sbjct: 268 DSKYGVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTDL 327

Query: 388 NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSI---- 443
             GL   S ++L DLAGSE   ++ AQ +R KE   IN+SLL LG VI+ L+ +S     
Sbjct: 328 KSGLETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNMG 384

Query: 444 -----HIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNI 495
                HIP+R+SKLTR+LQ +L G+     I T+     +  ET +T+ +AS+AKNI
Sbjct: 385 VGGGHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNI 441

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 63/111 (56%), Gaps = 11/111 (9%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           ++ D VF P+     +++E A P+ E   +G+N TI  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 125 LSDSAGIIPRVLFKLFE---SPEILNDDYIIKCSFVELYNEDLKDLLDDSV 172
            S+  G+IP  +  +F    S  + N  + +K S++E+YNE + DLL+  V
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLLNYQV 249

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  102 bits (253), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 68/172 (39%), Positives = 99/172 (57%), Gaps = 6/172 (3%)

Query: 330 NNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNG 389
           +N+   I N+ +  + +      +L++  R R  A T+ N+ SSRSH++F + +   HN 
Sbjct: 537 DNHATSITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVFMVHI-NGHND 595

Query: 390 GLYRVS--KMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVI---NSLADKSIH 444
               VS  K+NL+DLAGSE IN S     R +E  +IN+SL  LG VI   NS      H
Sbjct: 596 QTGEVSHGKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYALNSPDAAKRH 655

Query: 445 IPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIK 496
           IPFR SKLT LLQ SL G++KT++   I   + + +ET ++L +ASK  + K
Sbjct: 656 IPFRNSKLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNSTK 707

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 79/171 (46%), Gaps = 18/171 (10%)

Query: 2   QKTHTSGEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEV-SINTSDEVGIAAHM 60
           +K H   +EL   + V CR R     +++ +    +     S    ++    E G     
Sbjct: 356 RKLHNELQELRGNIRVYCRIRPPLLAESQDTSHFHIEKFNESKGFQALTIKRENGRCFSY 415

Query: 61  NSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKL 120
           N   +  DK+F P  +   +F+EI + L +  + GYN  I  YG T +GKTYTM      
Sbjct: 416 N---FHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM------ 465

Query: 121 YDGELSDSAGIIPRVLFKLFESPEILNDD---YIIKCSFVELYNEDLKDLL 168
               L+   G+IP  L  +F+  E L +    Y + C ++E+YNE + DLL
Sbjct: 466 ----LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLL 512

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 104/185 (56%), Gaps = 29/185 (15%)

Query: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK-EHNGGLY 392
           I +  L E   ++  D +K ++ G +++K++ T+ N  SSRSH+I  + L   +   G+ 
Sbjct: 249 IKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSRSSRSHSILLVRLIATDLETGIV 308

Query: 393 RVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS---------- 442
             S ++L DLAGSE   K+ +Q +R KE   IN+SLL LG VI  L+ +S          
Sbjct: 309 TTSTLSLCDLAGSE---KATSQQERRKEGAFINKSLLALGTVIAKLSSESNQHRNADNVN 365

Query: 443 ---------IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVD---ETSSTLEYAS 490
                     HIP+R+SKLTR+LQ +L GN+   +I+TI    I  D   ET +TL +AS
Sbjct: 366 HQETSNPNNSHIPYRDSKLTRILQPALSGNS---IITTICTVDIRSDASSETLNTLRFAS 422

Query: 491 KAKNI 495
           +AKN+
Sbjct: 423 RAKNV 427

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 65/120 (54%), Gaps = 12/120 (10%)

Query: 58  AHMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGD 117
           AH +   + +D++F    S   ++ E+ +PL +    GYN T+  YGMT +GKT+TM+G 
Sbjct: 102 AHDDVGEFRLDRIFDCDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKTFTMSGT 161

Query: 118 EKLYDGELSDSAGIIPRVLFKLF----ESPEILNDDYIIKCSFVELYNEDLKDLLDDSVD 173
           +        +  G+IP  +  LF    E   +    Y +  S++E+YNE L DLLD +V+
Sbjct: 162 Q--------EDTGLIPLSISHLFNTINEENLLGKKKYEMLVSYMEIYNEKLYDLLDTNVE 213

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score =  100 bits (250), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 100/184 (54%), Gaps = 20/184 (10%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITL-YKEH 387
           D  + + +  L E  ++++ D ++ ++ G  +R+   T  N  SSRSH I TI +   E 
Sbjct: 270 DARHGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTIKVTCTEL 329

Query: 388 NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS----- 442
             G    S ++L DLAGSE   ++  QH+R KE   IN+SLL LG VI+ L+  S     
Sbjct: 330 LSGTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVSGASGG 386

Query: 443 -----------IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASK 491
                       H+P+R+SKLTR+LQ +L G++    I TI      + ET +T+ +AS+
Sbjct: 387 GAATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIRFASR 446

Query: 492 AKNI 495
           AKN+
Sbjct: 447 AKNV 450

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 64/114 (56%), Gaps = 11/114 (9%)

Query: 59  HMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE 118
           H +   +  DKVF P  +   +++EI +P+ +   +GYN TI  YGMT +GKT+TM+G  
Sbjct: 134 HNDLGEFWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR 193

Query: 119 KLYDGELSDSAGIIPRVLFKLFES---PEILNDDYIIKCSFVELYNEDLKDLLD 169
                   D AG+I   + ++F       + N  Y ++ S++E+YNE + DLL+
Sbjct: 194 --------DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLN 239

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  100 bits (248), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 104/208 (50%), Gaps = 28/208 (13%)

Query: 322 TNSEKAP-------DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSR 374
           T S K P       D+   + I  L E    ++ + +K ++ G + RK   T  N  SSR
Sbjct: 243 TRSSKTPVELKLREDSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSSR 302

Query: 375 SHTIFTITLYK-EHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGR 433
           SH I  I L K +   G    S ++L DLAGSE   K+   ++R KE   IN+SLL LG 
Sbjct: 303 SHAIVMIRLTKTDLKEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALGT 359

Query: 434 VINSLADKSI-------------HIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVD 480
           VI+ L+ +S              HIP+R+SKLTR+LQ +L GN     I TI        
Sbjct: 360 VISKLSAESTSHRNGGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDASS 419

Query: 481 ETSSTLEYASKAKNIK----NKPHLGSF 504
           ET +TL +AS+AKN+      KP L S 
Sbjct: 420 ETLNTLRFASRAKNVSLHIFRKPLLPSM 447

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 61/115 (53%), Gaps = 12/115 (10%)

Query: 59  HMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE 118
           H +   +  D VF  + +   ++ + ++P+ +   +G N T+  YGMT +GKT+TM G E
Sbjct: 116 HADYGEFKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTE 175

Query: 119 KLYDGELSDSAGIIPRVLFKLFES--PEILNDD--YIIKCSFVELYNEDLKDLLD 169
                   ++ G+IP  +  L+     E L  D  + I  S++E+YNE + DLLD
Sbjct: 176 --------ETLGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLLD 222

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 112/208 (53%), Gaps = 19/208 (9%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK-EH 387
           D+   + + +L E  +++  D +K +  G R+RK   T  N  SSRSH I  + L + + 
Sbjct: 270 DSKYGVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYDL 329

Query: 388 NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA-------- 439
             G    S ++L DLAGSE   ++  Q  R KE   IN+SLL LG VI  L+        
Sbjct: 330 KTGSEATSTLSLCDLAGSE---RAVTQIVRRKEGAFINKSLLALGTVIAKLSMLGSQANG 386

Query: 440 ----DKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNI 495
                 + HIP+R+SKLTR+LQ +L G++    I TI     +  ET++T+ +AS+AKNI
Sbjct: 387 LQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFASRAKNI 446

Query: 496 K---NKPHLGSFIMKDVLLKNITTELNK 520
                K  + S   KD +++N+  +L++
Sbjct: 447 ALNVRKNEMDSHAEKDTIIQNLRKQLDE 474

 Score = 68.2 bits (165), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 61/115 (53%), Gaps = 12/115 (10%)

Query: 59  HMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE 118
           H     +  D VF        +++ +  P+ +   +GYN TI  YGMT +GKT+TM+G++
Sbjct: 140 HTEFGEFQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNK 199

Query: 119 KLYDGELSDSAGIIPRVLFKLFE--SPEILNDD--YIIKCSFVELYNEDLKDLLD 169
           +          G+IP+ +  +F+  S E       Y +K S++E+YNE + DLL+
Sbjct: 200 Q--------EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLLN 246

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 98/199 (49%), Gaps = 35/199 (17%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK-EH 387
           D+   + +  L E    +  + ++ +  G + RK+  T  N  SSRSH I  I L   + 
Sbjct: 298 DSKYGVKVIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTSTDV 357

Query: 388 NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSL-ADKSI--- 443
           N G  R S ++L DLAGSE   ++  Q +R KE   IN+SLL LG VI+ L ADK+    
Sbjct: 358 NNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTSVD 414

Query: 444 ---------------------------HIPFRESKLTRLLQDSLGGNTKTVLISTISPAK 476
                                      HIP+R+SKLTRLLQ +L G++    I T+    
Sbjct: 415 SNISTTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRN 474

Query: 477 INVDETSSTLEYASKAKNI 495
               ET +TL +AS+AKN+
Sbjct: 475 DAAAETMNTLRFASRAKNV 493

 Score = 65.1 bits (157), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 65/113 (57%), Gaps = 12/113 (10%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  D VF    +   +++   +P+ +  + G+N TI  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 125 LSDSAGIIPRVLFKLFES--PEILNDD--YIIKCSFVELYNEDLKDLLDDSVD 173
           L    G+IP  +  LF +   + ++ D  + +  S++E+YNE + DLL+  ++
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLESGLE 267

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 96/179 (53%), Gaps = 21/179 (11%)

Query: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEH--NGGL 391
           + +  + E   + A + +K +  G   RK   T  N  SSRSH I  + L   +  NG  
Sbjct: 243 VKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTNLLNGTT 302

Query: 392 YRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS--------- 442
           +  + ++L DLAGSE   K+  Q +R KE   IN+SLL LG VI+ L+ +S         
Sbjct: 303 H-FNTLSLCDLAGSE---KASEQLERRKEGSFINKSLLALGTVISKLSAESNAHDSSRPS 358

Query: 443 ------IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNI 495
                  HIP+R+SKLTRLLQ +L  ++    I TI P K  + ET +TL +AS+AKN+
Sbjct: 359 SGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASRAKNV 417

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 62/123 (50%), Gaps = 6/123 (4%)

Query: 58  AHMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGD 117
           AH +   +  D VFGP+A+ + +F E+   L E    G N T+L YG T +GKTYTM G 
Sbjct: 120 AHWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVGH 179

Query: 118 EKLYDGELSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYK 177
               DG +         V  ++  + +       +  S++E+YNE + DLL+ +  N   
Sbjct: 180 N---DGIVKMCGDC---VFTRMLNAADERQVKRSVTVSYLEIYNEKICDLLNSNCRNEEL 233

Query: 178 KLR 180
           K+R
Sbjct: 234 KVR 236

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 89/150 (59%), Gaps = 12/150 (8%)

Query: 351 IKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNGGLYRVSKMNLVDLAGSENINK 410
           ++L+ +G R+R+V ST+ N  SSRSH +  + +  +  G   RV  + L DLAGSE    
Sbjct: 241 LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRI-TDSMGSKARV--LTLCDLAGSER--- 294

Query: 411 SGAQHQRA--KEAGSINQSLLTLG---RVINSLADKSIHIPFRESKLTRLLQDSLGGNTK 465
             + H R    E G+IN+SL+ LG   R++N     S H+P+R+SKLTRLL+ SL GN  
Sbjct: 295 -ASVHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNGL 353

Query: 466 TVLISTISPAKINVDETSSTLEYASKAKNI 495
             ++ T+S +  + +++  TL +A +A  +
Sbjct: 354 VTMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 51/108 (47%), Gaps = 22/108 (20%)

Query: 80  MFKEIAEPLFE----DFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDSAGIIPRV 135
           +F    +PL      D I G   TI+ YG T +GKTYTM G +           GI+   
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHGTKA--------EGGIVQLS 170

Query: 136 LFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNTYKKLRIFD 183
           +  L      L+ +  I  S++E+YNE L DLL D      K+LRI D
Sbjct: 171 IRDLLTQ---LSKNCQITISYLEIYNERLHDLLCDGT----KELRILD 211

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score = 95.1 bits (235), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 98/199 (49%), Gaps = 35/199 (17%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEH- 387
           D+   + +  L E    ++ + ++ +  G + RK+  T  N  SSRSH I  I L   + 
Sbjct: 298 DSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNV 357

Query: 388 NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSL-ADK----- 441
             G  R S ++L DLAGSE   ++  Q +R KE   IN+SLL LG VI+ L ADK     
Sbjct: 358 KNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVG 414

Query: 442 -------------------------SIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAK 476
                                    S HIP+R+SKLTRLLQ +L G++    I T+    
Sbjct: 415 SNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRN 474

Query: 477 INVDETSSTLEYASKAKNI 495
               ET +TL +AS+AKN+
Sbjct: 475 DAAAETMNTLRFASRAKNV 493

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 69/119 (57%), Gaps = 12/119 (10%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  D VF    +   +++  ++P+ +  + G+N TI  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 125 LSDSAGIIPRVLFKLFES--PEILNDD--YIIKCSFVELYNEDLKDLLDDSVDNTYKKL 179
           L    G+IP  +  LF +   + +N D  + +  S++E+YNE + DLL+  ++ +  ++
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEESGSRI 273

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 98/205 (47%), Gaps = 41/205 (20%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK-EH 387
           D+   + +  L E    ++ D ++ +  G + RK+  T  N  SSRSH I  I L   + 
Sbjct: 298 DSQYGVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTDV 357

Query: 388 NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSL-ADK----- 441
             G  R S ++L DLAGSE   ++  Q +R KE   IN+SLL LG VI+ L ADK     
Sbjct: 358 RDGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSVG 414

Query: 442 -------------------------------SIHIPFRESKLTRLLQDSLGGNTKTVLIS 470
                                          S HIP+R+SKLTRLLQ +L G++    I 
Sbjct: 415 SIIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTIC 474

Query: 471 TISPAKINVDETSSTLEYASKAKNI 495
           T+        ET +TL +AS+AKN+
Sbjct: 475 TVDTRNDAAAETMNTLRFASRAKNV 499

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 70/119 (58%), Gaps = 12/119 (10%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  D VF    +   ++++ ++P+ +  + G+N TI  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 125 LSDSAGIIPRVLFKLFES--PEILNDD--YIIKCSFVELYNEDLKDLLDDSVDNTYKKL 179
           L    G+IP  +  LF +   + +N D  + +  S++E+YNE + DLL+  ++ +  +L
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLESGLEESGSRL 273

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 94.7 bits (234), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 115/221 (52%), Gaps = 23/221 (10%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK-EH 387
           D+   + + +L E  + +  + IK +  G ++RK   T  N  SSRSH I  + L + E 
Sbjct: 271 DSKYGVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRCEL 330

Query: 388 NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSI---- 443
             G    S ++L DLAGSE   ++  Q  R KE   IN+SLL LG VI  L+  S     
Sbjct: 331 KTGTEVTSTLSLCDLAGSE---RAVTQLVRRKEGAFINKSLLALGTVIAKLSANSAGSGS 387

Query: 444 ------------HIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASK 491
                       HIP+R+SKLTR+LQ +L G++    I TI     +  ET++T+ +AS+
Sbjct: 388 GSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTVRFASR 447

Query: 492 AKNIK---NKPHLGSFIMKDVLLKNITTELNKIKSDLMSTR 529
           AKNI     K  + +   KD +++N+  +L++  + + + R
Sbjct: 448 AKNISLNVRKNEMDTSNEKDSIIQNLRKQLDEQHATIAALR 488

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 59/115 (51%), Gaps = 13/115 (11%)

Query: 59  HMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDE 118
           H     +  D VF    +   ++  + +P+ +   +GYN TI  YGMT +GKT+TM+G +
Sbjct: 139 HTEFGEFQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTK 198

Query: 119 KLYDGELSDSAGIIPRVLFKLF-----ESPEILNDDYIIKCSFVELYNEDLKDLL 168
           +          G+IP  +  +F     E+ +     Y +K S++E+YNE + DLL
Sbjct: 199 Q--------DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLL 245

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 66/184 (35%), Positives = 102/184 (55%), Gaps = 12/184 (6%)

Query: 321 LTNSEKAPDN-NNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIF 379
           LTN  K  D+    + +  L E  +++  + +K +  G  +RK   T  N  SSRSH + 
Sbjct: 222 LTNDLKLRDDLKYGVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVV 281

Query: 380 TITLY-KEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSL 438
            I ++  +   G   +S ++L DLAGSE   ++  Q +R KE   IN+SLL LG VI+ L
Sbjct: 282 LIRVFCTDEITGEQVMSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKL 338

Query: 439 ADKSI-------HIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASK 491
           + +S        HIP+R+SKLTR+LQ +L G++    I T+        E+ +T+ +AS+
Sbjct: 339 SMESSGLSTNVGHIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASR 398

Query: 492 AKNI 495
           AKNI
Sbjct: 399 AKNI 402

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 61/107 (57%), Gaps = 10/107 (9%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  D VF P  + D +++ +A P+ +   +G+NCTI  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 125 LSDSAGIIPRVLFKLFESPEI--LNDDYIIKCSFVELYNEDLKDLLD 169
                GIIP  +  +F+   +      + ++ S++E+YNE + DLL+
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLLN 204

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 97/195 (49%), Gaps = 31/195 (15%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLY-KEH 387
           D+   + +  L E    ++ + +  + KG + RK A T  N  SSRSH I  I L   + 
Sbjct: 276 DSKYGVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSDM 335

Query: 388 NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS----- 442
             G    S ++L DLAGSE   ++  Q +R KE   IN+SLL LG VI+ L+ +S     
Sbjct: 336 KDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKNRS 392

Query: 443 ----------------------IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVD 480
                                  HIP+R+SKLTRLLQ +L G++    I TI     +  
Sbjct: 393 PTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESSA 452

Query: 481 ETSSTLEYASKAKNI 495
           ET +TL +AS+AKNI
Sbjct: 453 ETLNTLRFASRAKNI 467

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 74/149 (49%), Gaps = 15/149 (10%)

Query: 31  SSVVVSVPDIMGSNEVSINTS-----DEVGIAAHMNSKTYTVDKVFGPSASQDLMFKEIA 85
            ++ V++     SN   ++TS     DE  IA H +   +  D VF    S   +++ I 
Sbjct: 99  GTITVAIRPKPTSNPSDVSTSSWLVTDEKTIA-HDDVGEFKFDHVFNSFVSNLEIYQVIN 157

Query: 86  EPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDSAGIIPRVLFKLFES--P 143
            P+ +   +G+N TI  YGMT +GKTYTM G       E     G+IP  +  LF     
Sbjct: 158 RPMIDKLFQGFNSTIFAYGMTGSGKTYTMMGCP-----EREQKDGLIPLSVSYLFTKIME 212

Query: 144 EILNDD--YIIKCSFVELYNEDLKDLLDD 170
           E L+ D  + I  S++E+YNE + DLL D
Sbjct: 213 ETLDGDKKFEIVLSYLEIYNEKIYDLLGD 241

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 79/233 (33%), Positives = 120/233 (51%), Gaps = 30/233 (12%)

Query: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLY-KEHNGGLY 392
           + I  L E    ++ +  + +Q G ++RK + T  N  SSRSH I  + L   +   G  
Sbjct: 251 VRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRSHAIVLVRLNNTDLRSGET 310

Query: 393 RVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSL-------------- 438
             S ++L DLAGSE   K+ +Q++R KE   IN+SLL LG VI+ L              
Sbjct: 311 VSSTLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTVISKLSSESLSKNGPPTFT 367

Query: 439 ----ADKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKN 494
                + + HIP+R+SKLTR+LQ +L GN+    I TI        ET +T+ +AS+AKN
Sbjct: 368 STNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRNEAASETVNTIRFASRAKN 427

Query: 495 ----IKNKPHL--GSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHY 541
               +  +P +  GS+  KD  ++N+T +L K    +M  RLK    M+   +
Sbjct: 428 VTLQVAKRPAVGTGSYNEKDQTIENLTQQLEKQHQLVM--RLKQRTSMTSSSH 478

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 68/123 (55%), Gaps = 12/123 (9%)

Query: 58  AHMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGD 117
           +H  +  +T D+VF  + +   +++  + P+ +  ++G+N T+  YGMT +GKT+TMTG 
Sbjct: 105 SHDEAGEFTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGT 164

Query: 118 EKLYDGELSDSAGIIP---RVLF-KLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVD 173
           E        D AG+IP     LF K+ E        Y +  S++E+YNE + DLLD   +
Sbjct: 165 E--------DEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEKIYDLLDCESE 216

Query: 174 NTY 176
           N +
Sbjct: 217 NKF 219

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 103/193 (53%), Gaps = 29/193 (15%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLY-KEH 387
           D+   + +  L +   + + + +  + KG ++RK + T+ N  SSRSH I  I L  K+ 
Sbjct: 264 DSECGVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDI 323

Query: 388 NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA-------- 439
             G   +  ++L DLAGSE   +   Q++R KE   IN+SLL LG VI+ L+        
Sbjct: 324 RTGEQNIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHH 380

Query: 440 -------DKSI----------HIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDET 482
                   +S+          HIP+R+SKLTRLLQ +L G++  V + TI  A  +  ET
Sbjct: 381 TGRAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSET 440

Query: 483 SSTLEYASKAKNI 495
            +TL +AS++KN+
Sbjct: 441 LNTLRFASRSKNV 453

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 69/132 (52%), Gaps = 16/132 (12%)

Query: 56  IAAHMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMT 115
           + +H +   +T D VF    S   ++ +  +PL +  I+GYN TI  YGMT +GKT+TM+
Sbjct: 124 VISHNDIGDFTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMS 183

Query: 116 GDEKLYDGELSDSAGIIPRVLFKLF----ESPEILNDDYIIKCSFVELYNEDLKDLLD-- 169
           G E        +  G+IP  +  LF    E     N+   +  S++E+YNE + DLLD  
Sbjct: 184 GTE--------EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNEKINDLLDVA 235

Query: 170 --DSVDNTYKKL 179
              +V NT  +L
Sbjct: 236 SGSNVQNTPSRL 247

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 87/149 (58%), Gaps = 13/149 (8%)

Query: 352 KLLQKGLRHRKVASTKMNDVSSRSHTIFTITLY------KEHNGGLYRVSKMNLVDLAGS 405
           +L++ G   R   ST MN+ SSRSH++F + +       +EH+ G     ++NLVDLAGS
Sbjct: 526 QLIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQEHSTG-----RLNLVDLAGS 580

Query: 406 ENINKSG--AQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESKLTRLLQDSLGGN 463
           E + +       +  KE  SIN+SL  L  VI+S+  +  +IPFR SKLT LL++SL   
Sbjct: 581 ERLQQQEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYLLKNSLINK 640

Query: 464 TKTVLISTISPAKINVDETSSTLEYASKA 492
           +KT++   ISP   ++ ET ++L  A K 
Sbjct: 641 SKTLMYVNISPNINSIRETINSLRLARKV 669

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 79/169 (46%), Gaps = 18/169 (10%)

Query: 5   HTSGEELNITVAVRCRGRNEREVQAKSS----VVVSVPDIMGSNEVSINTSDEVGIAAHM 60
           H   +EL   + V CR R   + +A +S     +   P    + +  I  +D   + A  
Sbjct: 326 HNKIQELRGNIRVYCRLRPYIKDEAATSNSDGYIFIKPFDANAGQQRIIVNDLKQLHA-- 383

Query: 61  NSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKL 120
               +T DK+FG       +F +I + L +  + GYN  I  YG T +GKTYTM  ++  
Sbjct: 384 ----FTFDKIFGMQDDNYEVFDDI-KNLVQSSLDGYNVCIFTYGQTGSGKTYTMLNEK-- 436

Query: 121 YDGELSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLD 169
            DG +  +   I      L +    L  +Y ++  F+E+YNE ++DLL+
Sbjct: 437 -DGIIMQTIEYIVHFAGNLHK----LGWEYELEVEFIEIYNETIRDLLN 480

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 96/199 (48%), Gaps = 35/199 (17%)

Query: 329 DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK-EH 387
           D    + +  L E    ++ + +K +  G + RK+  T  N  SSRSH I  I L   + 
Sbjct: 298 DTQYGVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTSTDL 357

Query: 388 NGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSL-ADK----- 441
             G  R S ++L DLAGSE   ++  Q +R KE   IN+SLL LG VI+ L ADK     
Sbjct: 358 ESGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINPTG 414

Query: 442 -SIHIP------------------------FRESKLTRLLQDSLGGNTKTVLISTISPAK 476
            +IH                          +R+SKLTRLLQ +L G++    I T+    
Sbjct: 415 SNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRN 474

Query: 477 INVDETSSTLEYASKAKNI 495
               ET +TL +AS+AKN+
Sbjct: 475 DAAAETINTLRFASRAKNV 493

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 69/118 (58%), Gaps = 12/118 (10%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  D VF    +   +++  ++P+ +  + G+N TI  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 125 LSDSAGIIPRVLFKLFESP-EI-LNDD--YIIKCSFVELYNEDLKDLLDDSVDNTYKK 178
           L    G+IP  +  LF +  E+ +N D  + +  S++E+YNE + DLL+  ++ +  +
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLESGLEESLSR 272

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 104/199 (52%), Gaps = 28/199 (14%)

Query: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN-GGLY 392
           I I+NL+  Y+ +  + +   +KG   R +AS       SRS  I  IT+ +  N   ++
Sbjct: 189 ISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQRDNVKEVF 238

Query: 393 RVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLA--DKSI------- 443
           +     LVDL  S+ I+K        +    INQS++TL  V  SLA  ++S+       
Sbjct: 239 KTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNGRPRS 298

Query: 444 ---HIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIK---- 496
              +IP++ES LT+LLQ+++GGN KT L+   S AK + +ET +TL + +  K +K    
Sbjct: 299 GNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVKNLFQ 358

Query: 497 -NKPHLGSFIMKDVLLKNI 514
            NK    S  M D+L+K+ 
Sbjct: 359 QNKAGTNSKAMLDLLMKDF 377

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 63/128 (49%), Gaps = 13/128 (10%)

Query: 58  AHMNSKTYTVDKVFGPSA-SQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTG 116
           A  N K + VD++F P A ++D     I + + + F  GYN  I+ YG T +GKT TM G
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQLF-NGYNVAIMAYGQTDSGKTSTMFG 122

Query: 117 DEKLYDGELSDSAGIIPRVLFKLFESPEIL---NDDYIIKCSFVELYNEDLKDLLDDSVD 173
             K          G+I  V  ++F + E     N DY I  S +E+  E ++DLL    +
Sbjct: 123 YNK--------GDGVINGVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLLAPLSE 174

Query: 174 NTYKKLRI 181
               KLR+
Sbjct: 175 QKPLKLRL 182

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/172 (32%), Positives = 81/172 (47%), Gaps = 19/172 (11%)

Query: 2   QKTHTSGEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMN 61
           +K H   +EL   + V CR R   + + + S  +S+     S+E   N +  + I     
Sbjct: 350 RKLHNELQELRGNIRVFCRLRPHLDNEKEDSSSISIDGF--SDE---NGTQCITIKREAK 404

Query: 62  SKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLY 121
              +T D+ FG   S   +F EI + L +  + GYN  I  YG T +GKTYTM       
Sbjct: 405 YHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM------- 456

Query: 122 DGELSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLLDD 170
              L+   GIIP  L  +F   E L +    Y I   F+E+YNE++KDL  D
Sbjct: 457 ---LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKD 505

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/172 (32%), Positives = 81/172 (47%), Gaps = 19/172 (11%)

Query: 2   QKTHTSGEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMN 61
           +K H   +EL   + V CR R   + + + S  +S+     S+E   N +  + I     
Sbjct: 350 RKLHNELQELRGNIRVFCRLRPHLDNEKEDSSSISIDGF--SDE---NGTQCITIKREAK 404

Query: 62  SKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLY 121
              +T D+ FG   S   +F EI + L +  + GYN  I  YG T +GKTYTM       
Sbjct: 405 YHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM------- 456

Query: 122 DGELSDSAGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLLDD 170
              L+   GIIP  L  +F   E L +    Y I   F+E+YNE++KDL  D
Sbjct: 457 ---LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKD 505

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 85/168 (50%), Gaps = 22/168 (13%)

Query: 351 IKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHN-GGLYRVSKMNLVDLAGSENIN 409
           I LL +  RH        N++  RSHTI  +++ K +       +S + +VDLAGS+ I 
Sbjct: 215 ICLLNQKERH--------NNLIQRSHTIMEVSIEKRNKLDESITMSSLYIVDLAGSDPIG 266

Query: 410 KSGAQHQRAKEAGSINQSLLTLGRVINSLA----------DKS--IH-IPFRESKLTRLL 456
           K+ +     ++A  IN  + ++  VIN L           D S  +H +P++ S LTRLL
Sbjct: 267 KNSSSGITTEDAKKINHQIKSVNDVINGLVVMNREGGIMTDISTLMHKVPYKSSILTRLL 326

Query: 457 QDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSF 504
            D LGGN KT  + T S  K + +ET STL++    K+    P +  F
Sbjct: 327 LDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGYNCKSANTNPRINRF 374

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 68/126 (53%), Gaps = 18/126 (14%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           Y  DKVF  S    +  +E  E   E  ++GYN +I+ YG + TGK++ + G+++     
Sbjct: 73  YKFDKVFA-SNDTGVEHQEFIESNLESLLQGYNTSIVTYGQSGTGKSFELYGEQQ----- 126

Query: 125 LSDSAGIIPRVLFKLFE--SPEILNDD----YIIKCSFVELYNEDLKDLLDDSVDNTYKK 178
                G+I ++L KLF     E+ N++    Y +K SF+E+Y E + DL+D    +  K 
Sbjct: 127 ----DGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFLEVYQEKMFDLMDSP--SVKKH 180

Query: 179 LRIFDS 184
           L+I DS
Sbjct: 181 LKINDS 186

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 58/109 (53%), Gaps = 12/109 (11%)

Query: 64  TYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDG 123
           T+  DKVF  +A+Q+ + K +  P+  D + GYN T++ YG + +GK+Y++ G +     
Sbjct: 74  TFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIGSK----- 128

Query: 124 ELSDSAGIIPRVLFKLFES----PEILNDDYIIKCSFVELYNEDLKDLL 168
              +S GI+P +   LF++     E   D + +     E+Y E   DLL
Sbjct: 129 ---ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYMEKTYDLL 174

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 59/180 (32%), Positives = 85/180 (47%), Gaps = 28/180 (15%)

Query: 373 SRSHTIFTITL-YKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTL 431
           SRSH +F + +  +     + + S + LVDL G+E  +K             +NQS+  L
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEAL 292

Query: 432 GRVINSL----------ADKSIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDE 481
              + SL          A  S    +RES+LT +L+DSLGGN KT +I T   +  NV  
Sbjct: 293 KNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLS--NVPT 350

Query: 482 TSSTLEYASKAKNIKNKPHLGSFIMKDVLLKNITTELN-KIKSDLM--STRLKDGVYMSQ 538
           T STLE+    + I NK            + + TT LN K K DL     ++KD  Y++Q
Sbjct: 351 TLSTLEFGDSIRQINNK------------VTDNTTGLNLKKKMDLFIQDMKIKDDNYVAQ 398

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 61.2 bits (147), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 66/119 (55%), Gaps = 16/119 (13%)

Query: 55  GIAAHMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTM 114
           G+  H   +T+++DKVF PSASQ  +   +  P+ ++   G N  +   G + TGKT+TM
Sbjct: 36  GVDPH--ERTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTM 93

Query: 115 TGDEKLYDGELSDSAGIIPRVLFKLFESPEILNDDYIIKCSF----VELYNEDLKDLLD 169
            G + +       S G++ R+L K+F   +++N++  +   +    VEL N+ + DLL+
Sbjct: 94  LGQQGV-------SQGLLQRILTKVF---QLMNENEGVTVQYSLSAVELVNDKVYDLLN 142

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 85/169 (50%), Gaps = 18/169 (10%)

Query: 330 NNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEH-N 388
           NN+ + I+NL++ Y+ +  +    L +G  +R      M  ++SRS+ +  I L +    
Sbjct: 233 NNSSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKINLEQVFLE 287

Query: 389 GGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 448
             L + S + L+D+A S+ I+K+ +    AKEA  +N  + +    IN LA+     P+ 
Sbjct: 288 DQLMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAETGTS-PYD 346

Query: 449 E-----------SKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTL 486
           +           S L  ++   +GGN KT+ ISTISP   N +ET  TL
Sbjct: 347 QQINGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITL 395

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 65  YTVDKVFGPSASQ-DLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKL 120
           + VDKVF     Q DL+  +I +    +   G+N +I+ +G + TGK++TM G+  L
Sbjct: 51  FQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQSGTGKSFTMFGNNSL 107

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 12/109 (11%)

Query: 64  TYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDG 123
           T+  DKVF  +A+Q  +   + +P   D + GYN TIL YG + +GK+Y++ G +     
Sbjct: 75  TFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFSGKSYSLIGPQ----- 129

Query: 124 ELSDSAGIIPRVLFKLFESPEIL----NDDYIIKCSFVELYNEDLKDLL 168
              D  GI+P +   LF + E       +++ +     E+Y E   DLL
Sbjct: 130 ---DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKTYDLL 175

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 86/177 (48%), Gaps = 22/177 (12%)

Query: 373 SRSHTIFTITL-YKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTL 431
           SRSH +F + +  +     + + S + L+DL G+E  +K             +NQS+  L
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEAL 293

Query: 432 GRVINSLADKSI----------HIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDE 481
              + SL  KS+             +RES+LT +L+DSLGGN KT +I T   +  NV  
Sbjct: 294 KNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLS--NVPT 351

Query: 482 TSSTLEYASKAKNIKNKPHLGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQ 538
           T STL++    + I N+      +M +    N+  +++    D+   ++KD  Y+SQ
Sbjct: 352 TLSTLKFGDSIRQINNR------VMDNTSGLNLRKKMDLFVQDM---KIKDDNYISQ 399

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 62/129 (48%), Gaps = 12/129 (9%)

Query: 44  NEVSINTSDEVGIAAHMNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVY 103
           N V   TS  +  A      T+  DKVF  +A+Q  +   +  P  +D + GYN TIL Y
Sbjct: 54  NTVLFRTSKPLHNATGSPHSTFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTY 113

Query: 104 GMTSTGKTYTMTGDEKLYDGELSDSAGIIPRVLFKLFES----PEILNDDYIIKCSFVEL 159
           G + +GK+Y++ G +  Y+       G++P +   LFE+     E    ++ +     E+
Sbjct: 114 GPSFSGKSYSLLGSQ--YN------EGVLPNICQVLFETLEENEETKGTNFCVSVLAFEI 165

Query: 160 YNEDLKDLL 168
           Y E   DLL
Sbjct: 166 YMEKSYDLL 174

 Score = 55.1 bits (131), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 100/215 (46%), Gaps = 33/215 (15%)

Query: 373 SRSHTIFTITL-YKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTL 431
           S+SH +F + +  +     + + S + L+DL G+E   K             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKKLNQSIEAL 292

Query: 432 GRVINSLADK----------SIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDE 481
             ++  LA K          S    +RES+LT +L+DSLGGN K  +I T   +  NV  
Sbjct: 293 KNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLS--NVPT 350

Query: 482 TSSTLEYASKAKNIKNKPHLGSFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQ--- 538
           T STLE+    + I NK      +M      N+  +++    D+   ++KD  Y+SQ   
Sbjct: 351 TISTLEFGDNIRQIINK------VMSSTTGLNMKKKMDLFVQDM---KIKDDNYVSQINI 401

Query: 539 -----QHYKELNND---LESYKTEVQESKRANERL 565
                   K+L+N+    E  KTE++  ++ N +L
Sbjct: 402 LKSELDSLKDLSNESSSREDMKTELENYEKENVKL 436

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 69/137 (50%), Gaps = 13/137 (9%)

Query: 373 SRSHTIFTITL-YKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTL 431
           S+SH +F + +  +  N  + R S + L+DL G+E  +K             +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEAL 292

Query: 432 GRVINSLADK----------SIHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDE 481
             ++  L+ K          S    +RES+LT +L+DSLGGN KT +I T   +  NV  
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLS--NVST 350

Query: 482 TSSTLEYASKAKNIKNK 498
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGECIRQITNK 367

 Score = 58.5 bits (140), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 59/109 (54%), Gaps = 12/109 (11%)

Query: 64  TYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDG 123
           T+  DKVF  +A+Q+ +   +  P  +D + GYN TI+ YG + +GK+Y++ G +   +G
Sbjct: 74  TFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYGPSFSGKSYSLLGSQ---EG 130

Query: 124 ELSDSAGIIPRVLFKLFES----PEILNDDYIIKCSFVELYNEDLKDLL 168
           E     GI+P +   LFE+     E   +++ +     E++ E   DLL
Sbjct: 131 E-----GILPNICKVLFETLEKNKETKGNNFSVSVLAFEIFMEKTYDLL 174

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/191 (26%), Positives = 90/191 (47%), Gaps = 28/191 (14%)

Query: 329 DNNNQIYIQNLQE--FYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK- 385
           DN  Q+++ + +E  +Y N A               V ++K ++   R++TIF I + K 
Sbjct: 212 DNLRQVHVASFKETLYYFNQAM-------------SVLNSKHDNSFPRTNTIFNINIEKL 258

Query: 386 EHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIH- 444
           +        S + LVDLAGS+ I++  +    +++   IN S+ ++  +I SL+  S   
Sbjct: 259 DKLDESTTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSD 318

Query: 445 -----------IPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAK 493
                      +P+  SKL +LL++ LGGN KT  + TIS      D+    L+  +  +
Sbjct: 319 YKNYEFSLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQ 378

Query: 494 NIKNKPHLGSF 504
           + K  P +  F
Sbjct: 379 DSKTVPQINKF 389

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 57/106 (53%), Gaps = 14/106 (13%)

Query: 70  VFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDSA 129
           +F   ++ DL+   I   + ++ ++GYN  ++ YG   +GKTY+      LY  ++ DS 
Sbjct: 89  IFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGNDVDDSF 142

Query: 130 GIIPRVLFK-LFESPEILNDD------YIIKCSFVELYNEDLKDLL 168
           G + +++FK LF        D      +I+K SF+E++ + + DLL
Sbjct: 143 G-LGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLL 187

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 110/235 (46%), Gaps = 26/235 (11%)

Query: 335 YIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEH---NGGL 391
           +++NL    I +  D  K  + G +              RS++I    ++ E       L
Sbjct: 205 HVKNLSHIQIASLDDLQKWFKIGCQRSSAIINAGTAKEKRSNSIIISKIHLEQVNPKDQL 264

Query: 392 YRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPF---- 447
           Y++S ++ +DL G +   K   Q     E   +N  + +   +I +L+D    +P+    
Sbjct: 265 YKLSTLSFIDLYGIDKFTKKDIQLTN-DEMKKLNTLMSSFQNLITTLSDPK-SLPYTSSL 322

Query: 448 -RESKLTRLLQDSLGGNTKTVLISTI-SPAKINVDETSSTLEYASKAKNIKNKPHLGSF- 504
            ++S L ++LQD +GGN+KT  I    SP+ I  +E    L++A   K+IKN   +  F 
Sbjct: 323 YKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKSIKNPLIMNVFG 382

Query: 505 --IMKDVLL---------KNITTELNKIKSDL-MSTRLKDGVYMSQQHYKELNND 547
             + K +LL         +N  T++N ++S+L +  +L + V  +  H++E  ND
Sbjct: 383 LNLQKQMLLFIKSSKLREENCQTKINYLQSELALKNKLLEPV--ATDHHEENYND 435

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 8/105 (7%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGD-EKLYDG 123
           Y  D +F   + +   +  I + L +D  KGYN TI+ YG TS+GK++ + GD +   DG
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 124 ELSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLL 168
            ++    I  R+LF   E     N   +   S  ELY + + DLL
Sbjct: 146 LINH---IADRLLFPQCED----NLKTLCSISMWELYIDKVYDLL 183

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 55/111 (49%), Gaps = 9/111 (8%)

Query: 393 RVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADK----SIHIPFR 448
           R S +  +DL GS+ + K  A    + +    NQ +  L  +I +L ++    S H  F+
Sbjct: 251 RCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH--FK 308

Query: 449 ESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKP 499
           +S L ++L D LGG+TK  L+  I     N       ++  +KAK IKN P
Sbjct: 309 DSSLNKILMDYLGGDTKMTLVVAIDG---NTGGYEDAVKLGAKAKLIKNYP 356

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 72/130 (55%), Gaps = 5/130 (3%)

Query: 374 RSHTIFTITLYK-EHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLG 432
           RS TI  I L + + +  L   S +  VDLAGS+  +K   +    + A   N+ + +L 
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 433 RVINSLAD-KSIHI---PFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEY 488
            ++ +LA+ +SI I    +R S LTR+L D L GN KT LI + S  K +  ET STL +
Sbjct: 325 SMVYTLANSESISINKSIYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGF 384

Query: 489 ASKAKNIKNK 498
           +S A ++ N+
Sbjct: 385 SSYASSMSNQ 394

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 83/206 (40%), Gaps = 54/206 (26%)

Query: 28  QAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVDKVFGPSASQDLMFKEIAEP 87
           Q+ S +   +  I     +++N+S  V   +   S  Y  DK+F P    D +   ++  
Sbjct: 23  QSSSPIPYELNTIDNGTIITLNSS--VNQGSLGGSNQYRFDKIFEPEKPDDEINSTLSFA 80

Query: 88  LFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSD-------------------- 127
              D  KGYN T + YG T TGKTYT+ G    ++   +D                    
Sbjct: 81  CINDLFKGYNSTYISYGQTGTGKTYTLYG--TAFNDTPTDLDSKNINTNKNVKNDSNISS 138

Query: 128 ---------------------SAGIIPRVLFKLFESPEILND-----DYIIKCSFVELYN 161
                                + G+I +V   LFE  + +        +++  SFVE+Y 
Sbjct: 139 NSNIQTSASSNKSANSILQKKNYGLISKVGNDLFEMIDQIRAIRKGITFLVNISFVEVYK 198

Query: 162 EDLKDLL--DDSVDNTYKKLRIFDSM 185
           E++ DLL  DD++ N  KKL +   M
Sbjct: 199 EEVYDLLQHDDTLSN--KKLSLHHDM 222

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 55/108 (50%), Gaps = 12/108 (11%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  +KV+     Q  + ++I      + + G+N +I+ +G   +GKTYTM G++      
Sbjct: 68  FRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGNDH----- 122

Query: 125 LSDSAGIIPRVLFKLFESPEILNDD----YIIKCSFVELYNEDLKDLL 168
                GI+ R+   +F+  + L++D      I  +F EL+ E++ DLL
Sbjct: 123 ---EEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLL 167

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 73/150 (48%), Gaps = 18/150 (12%)

Query: 395 SKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLAD--------KSIHIP 446
           S + L+DLA S+ ++K+        E  S N S+  L +V+  L++         S    
Sbjct: 247 SVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNLHQVVYGLSELESPSSKNHSSKHT 306

Query: 447 FRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKP-----HL 501
            R S+L + LQ ++GG++KT  +   S  K + + T  TL   S+ ++I N P      L
Sbjct: 307 HRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRENTVITLSLGSRLRSIHNFPVQNKMGL 366

Query: 502 GSFIMKDVLLKNITTELNKIKSDLMSTRLK 531
            S  + D+ LKN++T     + D   TR+K
Sbjct: 367 NSKALLDLRLKNMST-----REDSYLTRIK 391

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/197 (23%), Positives = 91/197 (46%), Gaps = 27/197 (13%)

Query: 334 IYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYK-EHNGGLY 392
           +Y Q     YIN+  +  ++++    +++ +  KM+   S SH +   ++ + +   G  
Sbjct: 206 LYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSVEQLDRVHGTI 265

Query: 393 RVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINS-----------LADK 441
             S +   DL GS    K   Q    +    +N S+  L  V+NS           + +K
Sbjct: 266 TSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNHLYIENK 325

Query: 442 SI---------HIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKA 492
            +          +P+++S+LT L+Q++LGGN++T ++      K + +ET +TL +  + 
Sbjct: 326 LVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATLRFGVQL 385

Query: 493 KNIKNKPHLGSFIMKDV 509
           +NI N      F+  DV
Sbjct: 386 QNILN------FVRADV 396

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 53/113 (46%), Gaps = 12/113 (10%)

Query: 65  YTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGE 124
           +  +KV+        + K ++E + +D   GY+ +I+ YG   +GK++T+ G+E      
Sbjct: 87  FNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGSGKSFTLFGNE------ 140

Query: 125 LSDSAGIIPRVLFKLFESPEILNDD----YIIKCSFVELYNEDLKDLLDDSVD 173
             DS GII      + +    L  D      I+ S +E+  E + D+L  + D
Sbjct: 141 --DSDGIIALTFQDIIQKKRELEKDQNTIVNIQISALEISLEKVYDMLHSADD 191

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 101/209 (48%), Gaps = 22/209 (10%)

Query: 373 SRSHTIFTITLYKEH-NGGLYRVSKMNLVDLAGSENINKSG--AQHQRAKEAGSINQSLL 429
           S+SH I  I + + + N  + +   ++  DLA  + I+K    +    + E   +N    
Sbjct: 219 SKSHLITKINVEQRNLNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLEST 278

Query: 430 TLGRVINSLADKS----IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSST 485
           TL   I S+++ S      IP++ S LT+LL     GN KT +I T S  K N  ET  T
Sbjct: 279 TLKNSIISMSELSENPNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLET 338

Query: 486 LEYASKAKNIKNKPHLGSFIMK-----DVLLKNITTE----LNKIKSDLMSTRLKDGVYM 536
           L+   K ++I +  H+    +      D++++++ ++    +N+I+  L+ T L D    
Sbjct: 339 LKMGLKLESISSNVHMNKHALNSKKKLDLIVEDMKSKEANYMNRIR--LLETELND---- 392

Query: 537 SQQHYKELNNDLESYKTEVQESKRANERL 565
            +  Y E  ++  S+K E+ + +  N +L
Sbjct: 393 LRASYGEAISETSSFKEEMNKERAKNVKL 421

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 45/91 (49%), Gaps = 8/91 (8%)

Query: 80  MFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYDGELSDSAGIIPRVLFKL 139
           ++  I   L  +  +GY+  ++ YG   TGK+    G +  Y+G      G++   +  L
Sbjct: 75  LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG------GVVLMFVQDL 128

Query: 140 FESPEILNDD--YIIKCSFVELYNEDLKDLL 168
           ++  + + +D  + +  S +E++ E + DLL
Sbjct: 129 YDKIDSIGNDTHFTVSLSTIEIHLEKMYDLL 159

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 54/115 (46%), Gaps = 8/115 (6%)

Query: 60  MNSKTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEK 119
           +  ++++  KV    A++   F E+A  + +D + G NC +  YG      +  M G + 
Sbjct: 85  LGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGLAADSLVMFGPQS 144

Query: 120 LYDGELSDS---AGIIPRVLFKLFESPEILND---DYIIKCSFVELYNEDLKDLL 168
               E  DS   +G++ +    +F +  I +D   +Y +  S  E+Y + + DLL
Sbjct: 145 GNSKEEQDSSRCSGLLQQTCKHIFNA--IDSDSTSEYQVSLSLCEVYVDKVFDLL 197

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 58/127 (45%), Gaps = 15/127 (11%)

Query: 349 DGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKEHNGGLYRV---------SKMNL 399
           D I+LL    ++  V S  +N +   S T   + L +      +           S+  +
Sbjct: 372 DAIELLGSTFKNLSVRSYAVNRLKKASDTELELYLLQLVQAVCFENISTFSDKTNSEFTI 431

Query: 400 VDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHI---PFRESKLTRLL 456
           VD+ G++++ KS     +  E   +N SLLTLG+ IN+L    + I   P  E  + R L
Sbjct: 432 VDMNGTQHLGKSQNVMPKTTE---LNSSLLTLGKSINNLNLDEMPIVISPLAEFLIRRAL 488

Query: 457 QDSLGGN 463
           ++S  GN
Sbjct: 489 KNSRLGN 495

>Ecym_8127 Chr8 complement(264055..266598) [2544 bp, 847 aa] {ON}
           similar to Ashbya gossypii AEL147W
          Length = 847

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 8/63 (12%)

Query: 613 ILVELIRQLKNVGTSMQSTIENYRERDLEIEESTKKILE-----NEFKFLKNELSQILSN 667
           +  ++IR LK     MQS +E YR  D EI  S K + E      E K L ++LS++ + 
Sbjct: 100 VWAQVIRGLK---ADMQSKMEEYRTMDREITSSVKNMTELNGGWTELKQLHSQLSKVAAE 156

Query: 668 ING 670
           I  
Sbjct: 157 IEA 159

>TBLA0F00210 Chr6 complement(32816..34102) [1287 bp, 428 aa] {ON}
           Anc_6.374 YNR048W
          Length = 428

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 4/41 (9%)

Query: 759 ENLSDLSEEYNNFKEYLNNSFLQNNYELILKN---HLESGQ 796
           ENL DLSE +  F+ ++  + L   Y+LILKN   HL  GQ
Sbjct: 268 ENLPDLSE-WEEFQNWMRTAALPKFYKLILKNETGHLPKGQ 307

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 32.3 bits (72), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 46/106 (43%), Gaps = 18/106 (16%)

Query: 392 YRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESK 451
           +R   +  VDL   E++                 Q + +L  V+++  DK I     +S+
Sbjct: 212 FRKCCIEFVDLCAQEDVL----------------QLVCSLVAVLSNDNDKKIG--KEKSQ 253

Query: 452 LTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKN 497
             +LL +S+GGN KT  I   S  + N   +  TLE+  K   + N
Sbjct: 254 FCKLLSNSIGGNRKTTFILACSTLEQNEKISLETLEFGLKVSQVVN 299

>Suva_13.239 Chr13 (381069..382574) [1506 bp, 501 aa] {ON} YMR065W
           (REAL)
          Length = 501

 Score = 32.0 bits (71), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 81/167 (48%), Gaps = 19/167 (11%)

Query: 700 DIIENTTLKILKQVQEKSQHIYS--SCIERILSDIPNILNKFKIEINSIDFQYNDQFNKI 757
           D+  +T+ ++  Q+ EK+  + +  S I  I+SD+ + LNK     N I  + ND  ++ 
Sbjct: 225 DLFYDTSEQLEIQITEKNDQLLNEVSTIHHIMSDLVDELNK-----NDIKVKINDLKDEN 279

Query: 758 TENLSDLSEEYNNFKEYLNNSFLQNNYELI---LKNHLESGQSQIESFSXXXXXXINKQI 814
             NL DL E  ++ ++Y    + +NN EL+   L+N     ++Q+   S        + I
Sbjct: 280 INNLQDLVEMSHDVRKY----YSRNN-ELVNTELENFFMGLKTQLGGMSRDLSESQMEAI 334

Query: 815 NEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINST 861
           +  +  NS L +  L ++ NDIV + T       ++W     +I ST
Sbjct: 335 DLLQGFNSILRDSLLPSMTNDIVPEMTNFKNSILQEWT----VITST 377

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 109,908,967
Number of extensions: 5043112
Number of successful extensions: 24686
Number of sequences better than 10.0: 512
Number of HSP's gapped: 25361
Number of HSP's successfully gapped: 747
Length of query: 1097
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 977
Effective length of database: 39,721,479
Effective search space: 38807884983
Effective search space used: 38807884983
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)