Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A072206.8ON50950926450.0
TDEL0G046306.8ON5035279171e-118
NDAI0G00860singletonON5235429101e-116
SAKL0E00792g6.8ON5115319031e-115
KAFR0B065106.8ON5085259021e-115
KNAG0E027706.8ON5085248861e-113
Skud_16.56.8ON5155338521e-108
Smik_6.4806.8ON5165358431e-106
Kpol_1045.796.8ON5085278381e-106
CAGL0A01089g6.8ON5355498351e-105
YPL272C6.8ON5175368221e-103
Suva_16.336.8ON5185398151e-102
TPHA0M001806.8ON5035278011e-100
TPHA0J002606.8ON5155347108e-87
NCAS0D021806.8ON5155345922e-69
KLTH0C11572g6.8ON5185365433e-62
Kwal_56.223416.8ON5195434655e-51
Ecym_30116.8ON5095324583e-50
ACR018C6.8ON4784954354e-47
Kpol_1032.1singletonON2462542624e-25
Kpol_191.16.8ON1391381232e-07
SAKL0H19536g8.168ON1088178840.14
Ecym_24835.119ON461151820.19
KLTH0C02178g5.119ON464294820.19
Kpol_530.85.402ON374059742.4
CAGL0K00737g5.119ON45772732.4
Kpol_1072.528.611ON39828722.6
TBLA0H017105.398ON342117704.8
TPHA0H009605.119ON476403704.9
Suva_7.5065.119ON466404696.6
KNAG0G007005.119ON45654697.2
Smik_8.1775.402ON374466707.5
Kwal_27.98985.119ON460226689.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07220
         (509 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...  1023   0.0  
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...   357   e-118
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}              355   e-116
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...   352   e-115
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...   352   e-115
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...   345   e-113
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...   332   e-108
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...   329   e-106
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...   327   e-106
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...   326   e-105
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...   321   e-103
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...   318   e-102
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...   313   e-100
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...   278   8e-87
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8      232   2e-69
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...   213   3e-62
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...   183   5e-51
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...   181   3e-50
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...   172   4e-47
Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741...   105   4e-25
Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...    52   2e-07
SAKL0H19536g Chr8 complement(1721654..1724920) [3267 bp, 1088 aa...    37   0.14 
Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar t...    36   0.19 
KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {...    36   0.19 
Kpol_530.8 s530 complement(14877..17516,17519..26101) [11223 bp,...    33   2.4  
CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {O...    33   2.4  
Kpol_1072.52 s1072 (119728..120924) [1197 bp, 398 aa] {ON} (1197...    32   2.6  
TBLA0H01710 Chr8 complement(394015..395043) [1029 bp, 342 aa] {O...    32   4.8  
TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.1...    32   4.9  
Suva_7.506 Chr7 (873531..874931) [1401 bp, 466 aa] {ON} YGR212W ...    31   6.6  
KNAG0G00700 Chr7 complement(132337..133707) [1371 bp, 456 aa] {O...    31   7.2  
Smik_8.177 Chr8 (279199..290433) [11235 bp, 3744 aa] {ON} YHR099...    32   7.5  
Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W...    31   9.1  

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score = 1023 bits (2645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/509 (100%), Positives = 509/509 (100%)

Query: 1   MIYINNNNSKVLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDDATLLSSKDK 60
           MIYINNNNSKVLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDDATLLSSKDK
Sbjct: 1   MIYINNNNSKVLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDDATLLSSKDK 60

Query: 61  PLTISLVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHS 120
           PLTISLVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHS
Sbjct: 61  PLTISLVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHS 120

Query: 121 GAPPYLINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEII 180
           GAPPYLINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEII
Sbjct: 121 GAPPYLINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEII 180

Query: 181 NSLPYENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSI 240
           NSLPYENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSI
Sbjct: 181 NSLPYENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSI 240

Query: 241 YLNTFKKSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLL 300
           YLNTFKKSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLL
Sbjct: 241 YLNTFKKSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLL 300

Query: 301 KLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPE 360
           KLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPE
Sbjct: 301 KLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPE 360

Query: 361 DSANELGIIYKDIYVEVPLKLIEKIGNEDVVEEQFKIVCNYINESIQKRIKAWEKNGFND 420
           DSANELGIIYKDIYVEVPLKLIEKIGNEDVVEEQFKIVCNYINESIQKRIKAWEKNGFND
Sbjct: 361 DSANELGIIYKDIYVEVPLKLIEKIGNEDVVEEQFKIVCNYINESIQKRIKAWEKNGFND 420

Query: 421 DDIKRMKFGYEQVGNIIEVNDLTSLDLSCSKDSLFHIEDLSLTRNLKKNQILSLSFASNN 480
           DDIKRMKFGYEQVGNIIEVNDLTSLDLSCSKDSLFHIEDLSLTRNLKKNQILSLSFASNN
Sbjct: 421 DDIKRMKFGYEQVGNIIEVNDLTSLDLSCSKDSLFHIEDLSLTRNLKKNQILSLSFASNN 480

Query: 481 YNGLNLCINYSTEYKMKDFIDCFQSFMEN 509
           YNGLNLCINYSTEYKMKDFIDCFQSFMEN
Sbjct: 481 YNGLNLCINYSTEYKMKDFIDCFQSFMEN 509

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score =  357 bits (917), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 204/527 (38%), Positives = 306/527 (58%), Gaps = 56/527 (10%)

Query: 12  LRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDDATLLSSKDKPLTISLVSRAL 71
            R L   EK+ L  SLE   R+G V    + +   + SDDATLL+ KD  L +SL+SR L
Sbjct: 3   FRSLGGFEKKILSQSLEGH-RNGVVFGAMYSTTPEEWSDDATLLTYKDSRLNLSLLSRTL 61

Query: 72  KILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLINYIF 131
             +IS+H+E+FTTIN+  EF  + +I   +V++++ F + KDE VNC  GAPPYL+ +IF
Sbjct: 62  AKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHIF 121

Query: 132 SLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYENKEIQ 191
           +   FQP S   LWQ+++V+ +LVVF+G D LFDIF+ ANF K+  + +NS+     ++ 
Sbjct: 122 NQTTFQPGSGNVLWQIYVVDETLVVFHGHDVLFDIFSAANFHKIFLQTLNSISKSGSKLS 181

Query: 192 DDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTFKKSFDY 251
              IFKL          FPKSIYDN  L LPA   +LFNLQTQSFFKS+Y N  KK  DY
Sbjct: 182 --TIFKL---EKAVLPPFPKSIYDNAKLRLPAKAADLFNLQTQSFFKSLYFNAVKKPLDY 236

Query: 252 LNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLLKLIDAEKIDLK 311
           +N      +   R       Y +IL  ++ +    + G +  +R   L  +   + I LK
Sbjct: 237 INSNPPQQLKEYRTR-----YADILRTDNNLCGTTIFGRILPKRLESLDCIFKQQNICLK 291

Query: 312 SFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPEDSANELGIIYK 371
           SF C I ++CLK ++  + GSI F +P +LRS                 ++++E G+ YK
Sbjct: 292 SFVCGITMLCLKPIVKNYTGSITFCVPVDLRSSL---------------EASSEFGMFYK 336

Query: 372 DIYVEVPLKLIEKIG------------------------NEDVVEEQFKIVCNYINESIQ 407
           DI VE PL LI+                            E ++E QFK V +++  +++
Sbjct: 337 DIRVECPLSLIDDKNFNSLTVYNGYDSSAVKMPEKDPGYKEQLLEYQFKQVTDHVVAALR 396

Query: 408 KRIKAWEKNGFNDDDIKRMKFGYEQVGN---IIEVNDLTSLDLSCSKD--SLFHIEDLSL 462
           +R+KAWEK GFNDDDIKRMKFG +       +I++ND++ + +   +D    FH+ +L++
Sbjct: 397 QRMKAWEKFGFNDDDIKRMKFGSDDTATNTKLIQINDVSDIPVDAHEDISGKFHMRELNM 456

Query: 463 TRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFMEN 509
           T++LK  Q++SLS+ +++  GL++CI+Y   Y M+ F++CFQSF+E+
Sbjct: 457 TQSLKPGQLMSLSY-THSEKGLDICIHYPDGYNMESFVECFQSFIED 502

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score =  355 bits (910), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 218/542 (40%), Positives = 319/542 (58%), Gaps = 67/542 (12%)

Query: 12  LRPLSSVEKRFLGNSLESETRHGSVCSGKWVS---NSLD--ISDDATLLSSKDKPLTISL 66
           +R LSS EK+ L  +L+S+ R+G   + ++VS   +S D  +SD ATLL++KD  L I +
Sbjct: 3   IRALSSFEKKVLSQTLDSK-RNGISYTARYVSKVGSSSDSTLSDAATLLATKDIRLNIGI 61

Query: 67  VSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYL 126
           V+R L+ LI  HIE+++TIN+N EFQ+L KI   DV+  I F+  KDE +NCHSGAPPYL
Sbjct: 62  VTRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGAPPYL 121

Query: 127 INYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYE 186
           + +IF+   F+ +  KPLW+L+I++ ++++F+G D LFDIF+ ANF KL F+ +N     
Sbjct: 122 LRHIFNKEKFELN--KPLWKLYIIDETMIIFHGFDMLFDIFSAANFHKLFFDELNDYFLT 179

Query: 187 NKEIQD-----DIIFKLPNIRNISKIN-------FPKSIYDNPMLHLPATKPELFNLQTQ 234
           N   +      D++FK+    N+S  N       FP+SI+DNP LHLPA  P+LFNLQT+
Sbjct: 180 NTFSKSNSKPLDVVFKI----NVSDKNFVPNFEEFPRSIFDNPKLHLPAMTPDLFNLQTK 235

Query: 235 SFFKSIYLNTFKKSFDYLNFT---QQTPIILARNHNISKNYNEILHLNSIVKSELVTGNV 291
           SFFK+IY NT KK  D  N +    +  I        + NY ++L + S +    V G V
Sbjct: 236 SFFKTIYSNTIKKPIDLFNGSNSHTKNDITSQLKEYQTHNYLDMLGITSSLCGTTVFGTV 295

Query: 292 SMERYLQLLKLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKE 351
           S  RY  L  ++  ++I L+SF C I+++CLK  I  + G+IIF IP NLR+        
Sbjct: 296 SPTRYNYLKGMMKQDEICLRSFICGIVMICLKPSIKNYSGNIIFSIPINLRNYI------ 349

Query: 352 NHNSSSGPEDSANELGIIYKDIYVEVPLKLIEKIG-------------------NEDVVE 392
                    D A   G+ YKD+ ++ PL LI+                      NE ++E
Sbjct: 350 ---------DGAKNFGLFYKDVKIDCPLSLIDDRNFKYNGYKDSSIPDENDLEFNEKLLE 400

Query: 393 EQFKIVCNYINESIQKRIKAWEKNGFNDDDIKRMKFGYEQV----GNIIEVNDLTSLDLS 448
            QFK V  +I   I +R+K WEK  FNDDDIKRMKF +++V      II++ND T + L 
Sbjct: 401 YQFKQVTEFIENVILERLKIWEKFNFNDDDIKRMKFDHDEVLGQNSKIIQINDTTEIMLG 460

Query: 449 CSKDS--LFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSF 506
            + ++   F + + + TR L  N+ +S+SFA     GLN+CI+Y   Y M+ F++CFQ+F
Sbjct: 461 ENDNNNKAFTLTNPNFTRTLSGNEFMSVSFAICEETGLNVCIHYPDGYSMETFVECFQTF 520

Query: 507 ME 508
           +E
Sbjct: 521 IE 522

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score =  352 bits (903), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 214/531 (40%), Positives = 313/531 (58%), Gaps = 61/531 (11%)

Query: 10  KVLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLD----ISDDATLLSSKDKPLTIS 65
           K  R LSSVEK+    +L ++ R+G + +  + S   D     SD+ATLL+ KD+ L+ S
Sbjct: 5   KSFRSLSSVEKKLFSQNLNNK-RNGLMFAAVY-STCFDKEETWSDNATLLTVKDQRLSNS 62

Query: 66  LVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPY 125
           LVSRALK +I+N++E++TTIN N EFQ +  I   DV+  + F++ KDELVNCH G PPY
Sbjct: 63  LVSRALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPY 122

Query: 126 LINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPY 185
           L+ +IF    F+    KPLWQ+ IV+ ++V+F+G D LFDIFA ANF KL  + +N LP 
Sbjct: 123 LLRHIFDKNKFETAKHKPLWQILIVDETMVIFHGHDVLFDIFAAANFHKLFQQALNQLPK 182

Query: 186 ENKEIQDDIIFKLPNIRNISKIN-FPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNT 244
           +   ++   +FK     N SK + FPKSIY+N  L LPA   +LF LQTQSFFKS+Y  T
Sbjct: 183 DGPTLE--CLFK-----NDSKASFFPKSIYENHKLRLPAIATDLFQLQTQSFFKSVYNWT 235

Query: 245 FKKSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLLKLID 304
            KK  D++N    + +   ++      Y +IL   + +    V GN+S ER   L K++ 
Sbjct: 236 IKKPLDFINTNPNSGLKYYQSC-----YTDILLGANNLCGTTVFGNISAERVCALKKIMK 290

Query: 305 AEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPEDSAN 364
            E I L SF C+I ++CLK ++  F  S+ F IP +LR             S+ P+  A+
Sbjct: 291 QENICLSSFVCAIALLCLKPLVNNFGSSVTFSIPVDLR-------------STIPQ--AS 335

Query: 365 ELGIIYKDIYVEVPLKLIE------------------KIGNED------VVEEQFKIVCN 400
             G+ YK++ VE PL LI+                  K  N+D      ++E QF+  C 
Sbjct: 336 RFGLCYKNVLVECPLTLIDDKVFQGLNVYNGYDIRNTKPTNKDPNYEESLLEYQFREACT 395

Query: 401 YINESIQKRIKAWEKNGFNDDDIKRMKFGYEQVG---NIIEVNDLTSLDLSCSKDSLFHI 457
           +++ ++++R +AWE++GFNDDDIKRMKFG  + G    IIEVN++T        ++ F+I
Sbjct: 396 HVDNTLKQRWRAWERSGFNDDDIKRMKFGKTEQGKSKRIIEVNNVTEFQFHVDDNATFNI 455

Query: 458 EDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFME 508
           +D+  T++      +SLS A +  +GLN+CI+Y   Y M  F++CFQSFME
Sbjct: 456 KDVCFTKSQNLETFMSLSCAFSERSGLNVCIHYPDGYNMDVFVECFQSFME 506

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score =  352 bits (902), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 207/525 (39%), Positives = 315/525 (60%), Gaps = 45/525 (8%)

Query: 11  VLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDDATLLSSKDKPLTISLVSRA 70
            LR LSS E++ L  ++  E R+G + +  + ++S +  DD TLL+ KD   TI+++++A
Sbjct: 2   TLRTLSSYERKILDETIRRE-RNGVIFTASYSASSEEWGDDTTLLTLKDSRPTIAILTKA 60

Query: 71  LKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLINYI 130
           ++ LIS H+E+FTTIN+N EF++L  I   D+L+ + F++ KDE +NCH+G PPYL+ +I
Sbjct: 61  IQRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLRHI 120

Query: 131 FSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFE---IINSLPYEN 187
           F    F P SKKPLW L I++ SLV+F+G D LFDIF+ ANF KLL +   I+ + P ++
Sbjct: 121 FDNNRFVPGSKKPLWSLHIIDESLVIFHGQDMLFDIFSAANFHKLLLKETNIVANEPLDS 180

Query: 188 KEIQDDIIFKLPN-IRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTFK 246
            E   DIIF L N I+ I+ +   KSIYDNP +HLPAT P+LFNLQTQSFFKS++ +T K
Sbjct: 181 SE--SDIIFSLENSIKKINNLKLSKSIYDNPRIHLPATSPDLFNLQTQSFFKSVFHSTVK 238

Query: 247 KSFDYLNFTQQTPII-----LARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLLK 301
           K   YL    +T  +     L+R   + K Y +I   N+ + +  V G ++ +RY  L  
Sbjct: 239 KPIHYLVANVRTKEVTSDNTLSRVTTVQK-YTDIFDYNTTLNNTTVFGKITRQRYEYLNS 297

Query: 302 LIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPED 361
           LI  ++I  KSF   II++CLK  I  F+GS+ F I  NLR                 ++
Sbjct: 298 LITNQRICFKSFMVGIIMLCLKPSIENFEGSMKFSIVINLRPFL--------------KE 343

Query: 362 SANELGIIYKDIYVEVPLKLIEKIG----------------NEDVVEEQFKIVCNYINES 405
           S  E G+ YKD+ ++VPL LI+                    E ++E QFK V + + + 
Sbjct: 344 SNIEFGLFYKDVLIDVPLSLIDDNAVMLSGYRDFSDNDPDLTEKILEFQFKRVTSLVKDL 403

Query: 406 IQKRIKAWEKNGFNDDDIKRMKFGY-EQVGNIIEVNDLTSLDLSCSK-DSLFHIEDLSLT 463
           I++RI  +   GFNDDDI++MK+G   +   II + D + + L   K D  + + + + T
Sbjct: 404 IERRISKFSTMGFNDDDIRQMKYGKPAEDTKIIRLFDTSEVSLGSGKRDGKYILHNTNFT 463

Query: 464 RNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFME 508
           ++L+KN   S+S+   + +GLNLC+ +  +  M+ F++CFQSF+E
Sbjct: 464 KSLRKNDFFSVSYTLCDNSGLNLCLQFPDDCDMEAFVECFQSFIE 508

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score =  345 bits (886), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 208/524 (39%), Positives = 311/524 (59%), Gaps = 49/524 (9%)

Query: 12  LRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDD-ATLLSSKDKPLTISLVSRA 70
           +R LSS EK+ L  S++   ++G+    ++ +     SD+ ATLL+ KD  L + L+++A
Sbjct: 4   VRALSSFEKKLLLQSVDG-LKNGTTFGAEYSTFKEGWSDEEATLLTVKDSRLCLGLLTKA 62

Query: 71  LKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLINYI 130
           L+ LI  HIE+F TIN+  EF++L KI TSDV+ +I F++ KDE +NC  GAPPYL+ +I
Sbjct: 63  LENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPYLLRHI 122

Query: 131 FSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIIN---SLPYEN 187
           F+   F P S KPLW+L++++ SL  F+G D LFD+F+ ANF +LL + +N   S P + 
Sbjct: 123 FNHDRFVPGSGKPLWKLYLLDDSLAFFHGQDCLFDVFSTANFHRLLLKEVNLLSSRPQKW 182

Query: 188 KEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTFKK 247
           K++  D +FK            PKSIYDNP L++P   P+LFNLQTQSFFKSIY+NT KK
Sbjct: 183 KKL--DYVFKFGPDSMSEVKQLPKSIYDNPKLYIPTLNPDLFNLQTQSFFKSIYVNTVKK 240

Query: 248 SFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLLKLIDAEK 307
             ++L  T  +   L+ N N+   YN+IL +NS +    V G VS ER+  L  +I+ E 
Sbjct: 241 PIEFLTNTDVS--FLSLNSNMK--YNDILDINSKLCGNTVFGCVSNERFKYLNTIINQEG 296

Query: 308 IDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPEDSANELG 367
           + LKSF   I ++CLK M+    G++ F IP +LRS                 D   + G
Sbjct: 297 LCLKSFIVGIAMLCLKPMVKNLSGTVTFSIPVDLRSFV---------------DEPRDFG 341

Query: 368 IIYKDIYVEVPLKLI---------------EKIGNEDVVEEQFKIVCNYINESIQKRIKA 412
           + YKDI VE PL LI               E+  +E ++E QFK +  ++   +++R+  
Sbjct: 342 LYYKDIRVECPLSLIDDDKSKDCMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLTR 401

Query: 413 WEKNGFNDDDIKRMKF-------GYEQVGNIIEVNDLTSLDLS-CSKDSLFHIEDLSLTR 464
           + K GFNDDDI+RMKF       G    G  I++ D + ++++   + + F I   +LT+
Sbjct: 402 FSKTGFNDDDIRRMKFDDKNTLGGSSNNGTFIQIYDTSLINVNEFGEPNSFMIRACNLTK 461

Query: 465 NLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFME 508
           +L   +++SLS+     NGLN+CI+Y   YKM+ F++CFQSF+E
Sbjct: 462 SLNSEELMSLSYTYCEENGLNICIHYPENYKMESFVECFQSFLE 505

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score =  332 bits (852), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 199/533 (37%), Positives = 309/533 (57%), Gaps = 55/533 (10%)

Query: 11  VLRPLSSVEKRFLGNSLESETRHGSVCSGKWV-----SNSLDISDDATLL----SSKDKP 61
             RPLSS EK+ L  SL ++ R+G++ S  +       N  D + D   L    S  D  
Sbjct: 3   TFRPLSSFEKKLLTQSL-NDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSR 61

Query: 62  LTISLVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSG 121
           LT+  ++  LK LI +   +F T+N+  EF+ L ++ TSD+++ I FE  KD+ VNCH G
Sbjct: 62  LTLPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWG 121

Query: 122 APP-YLINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEII 180
            PP YL+ + F+   F P S KPLW L++++ +L+VF+G D LFDIF+ ANF KL  + +
Sbjct: 122 VPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKEL 181

Query: 181 NSLPYENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSI 240
           N++  E     D ++F + ++ NIS +NFPKSIYD+  LHLPA  P++F+ QTQSFFKSI
Sbjct: 182 NNISLEAHS-DDRVLFDISDV-NISNLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKSI 239

Query: 241 YLNTFKKSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLL 300
           + NT K+ F YL  T QT +  + +    K YN+IL+ +S +    V G V+ +R+  L 
Sbjct: 240 FYNTLKRPFGYL--TNQTSLGPSTSTTQLKKYNDILNAHSSLCGTTVFGIVNNQRFNYLK 297

Query: 301 KLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPE 360
            +++ E I L+SF C I ++CLK ++  F G+I+F IP +LR  +NL             
Sbjct: 298 SIVNQEHICLRSFICGIAMICLKPLVKDFTGAIVFSIPIDLR--KNL------------- 342

Query: 361 DSANELGIIYKDIYVEVPLKLI------------------EKIGNEDVVEEQFKIVCNYI 402
           D    LG+ +K++ +E PL LI                  +   NE ++E QF  V  ++
Sbjct: 343 DLGESLGLFFKELRIECPLSLIDDELSADEFLANRNDKEDDDEFNEKLMEYQFNKVTKHV 402

Query: 403 NESIQKRIKAWEKNGFNDDDIKRMKFGYEQV------GNIIEVNDLTSLDLSCSKDS-LF 455
           ++ I  ++K+WEKNGFNDDDI+RMK+  +          +I++ND++ + LS + D   F
Sbjct: 403 SDFIMAKLKSWEKNGFNDDDIRRMKYDNDDCHIQNSKTKLIQINDVSDISLSMNNDEKAF 462

Query: 456 HIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFME 508
            I     T ++ +  ++SLS+      GLN+CI+Y   Y ++ F++CF+SF+E
Sbjct: 463 KIISSGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 515

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score =  329 bits (843), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 202/535 (37%), Positives = 307/535 (57%), Gaps = 58/535 (10%)

Query: 11  VLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDDA----------TLLSSKDK 60
             RPLSS EK+ L  SL  + R+G++ S  + S SL   +DA          T  S  D 
Sbjct: 3   TFRPLSSFEKKLLTQSLNDQ-RNGTIFSSTY-SKSLGKENDADWHSDEVTLGTNSSKDDS 60

Query: 61  PLTISLVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHS 120
            LT+ L++  LK LI +   +F TIN+  EF+ L+++ TSD+++ I FE  KD+ VNCH 
Sbjct: 61  RLTLPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHW 120

Query: 121 GAPP-YLINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEI 179
           G PP YL+ + F+   F P S +PLW L++++ +L+VF+G D LFDIF+ ANF KL  + 
Sbjct: 121 GVPPPYLLRHAFNKTRFIPGSNRPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 180 INSLPYENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKS 239
           +N++       +D I+F + N+ +IS +NFPKSIYD+  LHLPA  P++F+ QTQSFFKS
Sbjct: 181 LNNIS-SVTHYEDRILFDINNV-SISDLNFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKS 238

Query: 240 IYLNTFKKSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQL 299
           I+ NT K+ F YL  T QT I    +    K YN+IL+ +S +    V G VS +R+  L
Sbjct: 239 IFYNTLKRPFGYL--TNQTSISSPASATQLKKYNDILNAHSSLCGTTVFGIVSNQRFNYL 296

Query: 300 LKLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGP 359
             +++ E I L+SF C I ++CLK ++  F G+I+F IP +LR    L            
Sbjct: 297 KSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLGL------------ 344

Query: 360 EDSANELGIIYKDIYVEVPLKLI-------EKIGNE-----------DVVEEQFKIVCNY 401
                 LG+ +K++ +  PL LI       E + N             ++E QF  V  +
Sbjct: 345 ---GESLGLFFKELRIACPLSLIDDELSVNEFLANSNDNEEDEEFDEKLMEYQFNNVTKH 401

Query: 402 INESIQKRIKAWEKNGFNDDDIKRMKFGYEQVGNI-------IEVNDLTSLDLSCSK-DS 453
           ++  I  ++K+WEKNGFNDDDI+RMK+  +   +I       +++ND++ + LS +  D 
Sbjct: 402 VSSFIMAKLKSWEKNGFNDDDIRRMKYDNDDEFHIQNSKTKLVQINDVSDISLSMNNDDK 461

Query: 454 LFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFME 508
            F I     T ++ +  +LSLS+      GLN+CI+Y   Y ++ F++CF+SF+E
Sbjct: 462 SFKIVSSGFTSSINRPTLLSLSYTYCQEMGLNICIHYPDSYNLESFVECFESFIE 516

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score =  327 bits (838), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/527 (36%), Positives = 310/527 (58%), Gaps = 53/527 (10%)

Query: 12  LRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLD-ISDDATLLSSKDKPLTISLVSRA 70
            R L + EK+ +G +L  ++ +G + S K++SN+ D ++DDATLL++ +  L  S +  A
Sbjct: 4   FRQLGTYEKKLVGQALAGQS-NGIIFSAKYISNAQDGLTDDATLLTNSEPLLLDSRLVNA 62

Query: 71  LKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLINYI 130
           L+ ++  H E+ TT+N+  EF+ + +I TSD++ S+ F++ KDE VNCH GAPPYL+ +I
Sbjct: 63  LQKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLRHI 122

Query: 131 FSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYENKEI 190
           F+   F P S KPLW+L +++ SLV+F+G D LFDIFA ANF KL  E +NS+  +++ I
Sbjct: 123 FNRNKFTPGSGKPLWELCVIDDSLVMFHGQDVLFDIFAAANFHKLFLETLNSM--DDEHI 180

Query: 191 QD-DIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTFKKSF 249
            D + I++    ++   I+FP++IY+NP L +P    +L NLQTQSFFKS Y+N  KK  
Sbjct: 181 TDLEYIYRYDATKSNRSISFPRTIYENPKLRIPGKTIDLVNLQTQSFFKSFYVNAIKKPL 240

Query: 250 DYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLLKLIDAEKID 309
           D + F  + P+   + + I     + ++  S +    V G+++ +R+  L  +   E + 
Sbjct: 241 DIITFNSE-PMKYIKPNEI-----DFMNEASALCGTTVFGHITTDRFEYLNSIARHENVC 294

Query: 310 LKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPEDSANELGII 369
           ++SF C I ++CLK MI  F GSI F IP NLR            S  GP D     G+ 
Sbjct: 295 IRSFICGIALLCLKSMIKDFTGSITFSIPVNLRE-----------SIEGPSD----FGLF 339

Query: 370 YKDIYVEVPLKLIE------------------KIGNEDV------VEEQFKIVCNYINES 405
           YK I VE PL LI+                  K+   D       +E QFK + + ++ +
Sbjct: 340 YKTILVECPLSLIDDQVYNNINVYNGYDNSNVKVPETDPTFEEKKLEYQFKQISDLVSTT 399

Query: 406 IQKRIKAWEKNGFNDDDIKRMKFGYEQVGN---IIEVNDLTSLDLSCSKDSLFHIEDLSL 462
           +++R++AW +NGFNDDDIK+MKF  +   +   II++ND++   ++ SK S   I++L+ 
Sbjct: 400 MKERMRAWRRNGFNDDDIKKMKFTSDDKASNTKIIQINDVSEFKINSSKSSKVSIKELNF 459

Query: 463 TRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFMEN 509
           T ++  +  +SLS+      G N+CI+Y   Y M+ F++ FQSF+ +
Sbjct: 460 THSISNSDFMSLSYTYCKETGSNICIHYPDAYDMEKFVERFQSFVAD 506

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score =  326 bits (835), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 207/549 (37%), Positives = 307/549 (55%), Gaps = 71/549 (12%)

Query: 13  RPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDD-----------ATLLSSKD-- 59
           R LSS E++ L   LE+  ++G+V    ++ +    +D+           AT + S+   
Sbjct: 3   RSLSSYERKLLSEILEN-NKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRSTK 61

Query: 60  KP---LTISLVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELV 116
           KP   LT+ LV+RALK LI  + EM+TT+N   EF  L +I T DV+  + F+N+KDE V
Sbjct: 62  KPALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEKV 121

Query: 117 NCHSGA-PPYLINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKL 175
           NCHSG  PPYLI +I     FQP S KPLW L++++ S +VF+  D LFDIF+ ANF KL
Sbjct: 122 NCHSGGPPPYLIRHILKNDVFQPGSNKPLWNLYLIDESQLVFHCQDILFDIFSAANFHKL 181

Query: 176 LFE--IINSLPYENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQT 233
             +  I    P ++ E   + +FKL      +  + PKSIYDN  LHLPAT+PEL NLQT
Sbjct: 182 FLKELIAVCRPQQSYEKPLEYLFKLQKSFE-NNYSVPKSIYDNLKLHLPATRPELLNLQT 240

Query: 234 QSFFKSIYLNTFKKSFDYLNF-----------TQQTPIILARNHNISK----NYNEILHL 278
           QSFFKSI+ N  KK  D++             +  +  ++++  N  K     Y  IL  
Sbjct: 241 QSFFKSIFCNAVKKPLDFIQMPITSITNSSSNSDNSTTVISQEGNQLKLFRTRYTNILTS 300

Query: 279 NSIVKSELVTGNVSMERYLQLLKLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIP 338
            +      + G+VS ER+  L  ++  EKI L+SF  +I ++CLK M+  F+G++IF +P
Sbjct: 301 ATSNCGHTIFGSVSNERFNYLNSVVKNEKICLRSFIAAITMLCLKPMVKSFNGTLIFSMP 360

Query: 339 YNLR-SMQNLRDKENHNSSSGPEDSANELGIIYKDIYVEVPLKLIEKIG----------- 386
            NLR SM   RD                 G++YKDI VE PL +I+              
Sbjct: 361 MNLRDSMNEKRD----------------FGLVYKDIRVECPLSMIDDKQCSVPGLNESDP 404

Query: 387 --NEDVVEEQFKIVCNYINESIQKRIKAWEKNGFNDDDIKRMKFG-----YEQVGNIIEV 439
             NE ++E QF+ +  Y+ ESI++R+  W+K G+ND+D+KRMKF      +     +I++
Sbjct: 405 EYNEKLLEIQFQQIATYVTESIEQRMSTWKKYGYNDNDMKRMKFTKYDEKFAPNTRLIKI 464

Query: 440 NDLTSLDLSCSKDSLFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDF 499
           ND++ +    +     HI+    T +L +N ++SLS+     +GLN+CI+Y   Y M++F
Sbjct: 465 NDVSEVSFDDNDIRFPHIKSPGFTTSLSQNTLMSLSYTHCEEDGLNICIHYPDGYNMENF 524

Query: 500 IDCFQSFME 508
           +DCF+SFME
Sbjct: 525 VDCFESFME 533

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score =  321 bits (822), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 203/536 (37%), Positives = 307/536 (57%), Gaps = 59/536 (11%)

Query: 11  VLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDDA----------TLLSSKDK 60
             RPLSS EK+ L  SL  + R+G++ S  + S SL   +DA          T  S  D 
Sbjct: 3   TFRPLSSFEKKILTQSLNDQ-RNGTIFSSTY-SKSLSRENDADWHSDEVTLGTNSSKDDS 60

Query: 61  PLTISLVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHS 120
            LT+ L++  LK LI +   +F T+N+  EF+ L ++ TSD+++ I FE  KD+ VNCH 
Sbjct: 61  RLTLPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHW 120

Query: 121 GAPP-YLINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEI 179
           G PP YL+ + F+   F P S KPLW L++++ +L+VF+G D LFDIF+ ANF KL  + 
Sbjct: 121 GVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDEALLVFHGHDVLFDIFSAANFHKLFLKE 180

Query: 180 INSLPYENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKS 239
           +N +       +D I+F + +I N+S++ FPKSIYD+  LHLPA  P++F+ QTQSFFKS
Sbjct: 181 LNEISTVTHS-EDRILFDVNDI-NLSELKFPKSIYDSAKLHLPAMTPQIFHKQTQSFFKS 238

Query: 240 IYLNTFKKSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQL 299
           IY NT K+ F YL  T QT +  + +    K YN+IL+ ++ +    V G V+ +R+  L
Sbjct: 239 IYYNTLKRPFGYL--TNQTSLSSSVSATQLKKYNDILNAHTSLCGTTVFGIVNNQRFNYL 296

Query: 300 LKLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGP 359
             +++ E I L+SF C I ++CLK ++  F G+I+F IP NLR         NH      
Sbjct: 297 KSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFTIPINLR---------NHLG---- 343

Query: 360 EDSANELGIIYKDIYVEVPLKLI--EKIGNE-----------------DVVEEQFKIVCN 400
                 LG+ +K++ VE PL LI  E   NE                  ++E QF  V  
Sbjct: 344 --LGGSLGLFFKELRVECPLSLIDDELSANEFLTNSNDNEDNDDEFNERLMEYQFNKVTK 401

Query: 401 YINESIQKRIKAWEKNGFNDDDIKRMKFGYEQVGNI-------IEVNDLTSLDLSC-SKD 452
           +++  I  ++++WEKNGFNDDDI+RMK+  +   +I       I++ND++ + LS    D
Sbjct: 402 HVSGFIMAKLRSWEKNGFNDDDIRRMKYDNDDDFHIQNSRTKLIQINDVSDISLSMNGDD 461

Query: 453 SLFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFME 508
             F I     T ++ +  ++SLS+      GLN+CI+Y   Y ++ F++CF+SF+E
Sbjct: 462 KSFKIVSTGFTSSINRPTLMSLSYTYCEEMGLNICIHYPDSYNLESFVECFESFIE 517

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score =  318 bits (815), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/539 (35%), Positives = 305/539 (56%), Gaps = 64/539 (11%)

Query: 11  VLRPLSSVEKRFLGNSLESETRHGSV------------CSGKWVSNSLDISDDATLLSSK 58
             RPLSS EK+ L  SL  + R+G++                W S+ + +  ++   S  
Sbjct: 3   TFRPLSSFEKKLLTQSLNDQ-RNGTIFSSTYSKSSSKEADADWHSDEVTLGTNS---SKD 58

Query: 59  DKPLTISLVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNC 118
           D  LT+ L++  LK LI +   +F T+N++ E+  L ++ TSD+++ I FE  KD+ VNC
Sbjct: 59  DSRLTLPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNC 118

Query: 119 HSGAPP-YLINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLF 177
           H G PP YL+ + F+   F P S KPLW L++++ +L+VF+G D LFDIF+ ANF KL  
Sbjct: 119 HWGVPPPYLLRHAFNKTRFVPGSNKPLWTLYVIDETLLVFHGHDVLFDIFSAANFHKLFL 178

Query: 178 EIINSLPYENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFF 237
           + +NS+   ++   D ++F + ++ N ++++FPKSIYD+  L LPA  P++ + QTQSFF
Sbjct: 179 KELNSITSVSRS-DDRVLFDINDV-NFAELSFPKSIYDSAKLRLPAMTPQILHKQTQSFF 236

Query: 238 KSIYLNTFKKSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYL 297
           KSI+ NT K+ F YL  T QT        +  K YN+IL+ NS +    V G V+ +R+ 
Sbjct: 237 KSIFYNTLKRPFGYL--TNQTSFSSPAPTSQLKRYNDILNTNSSLCGTTVFGIVNNQRFS 294

Query: 298 QLLKLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSS 357
            L  +++ E I L+SF C I ++CLK ++  F G+I+F IP +LR   NL          
Sbjct: 295 YLKSIVNQEHICLRSFICGIAMICLKPLVKDFSGTIVFSIPIDLRKHLNL---------- 344

Query: 358 GPEDSANELGIIYKDIYVEVPLKLIE--------------------KIGNEDVVEEQFKI 397
                   LG+ +K++ +E PL LI+                       NE ++E QF  
Sbjct: 345 -----GESLGLFFKELRIECPLSLIDDELSINEFLVNSNDNENNDNDEFNEKLMEYQFNK 399

Query: 398 VCNYINESIQKRIKAWEKNGFNDDDIKRMKFGYE---QVGN----IIEVNDLTSLDLSCS 450
           V  +++  I  ++K+WE+NGFNDDDI+RMK+  +    V N    +I++ND++ + LS S
Sbjct: 400 VTKHVSNYIMTKLKSWERNGFNDDDIRRMKYDNDDDFHVQNSKTKLIQINDVSDISLSMS 459

Query: 451 -KDSLFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFME 508
             D  F I     T ++ +  ++SLS+      GLN+CI+Y   Y ++ F++CF+SF+E
Sbjct: 460 NDDKSFKIVSSGFTNSINRPTLMSLSYTYCEDMGLNICIHYPDSYNLESFVECFESFIE 518

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score =  313 bits (801), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 196/527 (37%), Positives = 305/527 (57%), Gaps = 55/527 (10%)

Query: 12  LRPLSSVEKRFLGNSLESETRHGSVCSGKWVSN--SLDISDD-ATLLSSK--DKPLTISL 66
            R L   EK+ L  ++E   R+G V S +   N  S + +DD ATL + +  ++    S+
Sbjct: 3   FRALGGYEKKVLAQTIEGR-RNGVVFSSQITFNKKSDEFADDNATLYTGRSVNEVSLKSV 61

Query: 67  VSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYL 126
           +  AL+ +I NH+E++TTIN    F  + +I T+DV+ +I ++  KD+ +         L
Sbjct: 62  LCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSKDKAL-MKDQISDKL 120

Query: 127 INYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYE 186
           + +IF+   F+P++ KPLWQ  I N S ++F+G D LFDIF+ ANF K L + +N +   
Sbjct: 121 LRHIFNKCDFKPNNGKPLWQFSIANDSTMIFHGHDVLFDIFSTANFEKYLLKEMNDVLNS 180

Query: 187 NKEIQD-DIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTF 245
           N++++    +FK    R+++  N+P+SIY+NP LHLPA   +L NLQTQSFFK+IY NT 
Sbjct: 181 NQKLKTVKTLFKFDAERSLT--NYPRSIYENPKLHLPALTSDLLNLQTQSFFKTIYQNTL 238

Query: 246 KKSFDYL-----NFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLL 300
           KK  D +     N   Q      RN +I    N +           V G +S+ERY  L 
Sbjct: 239 KKPIDLITSANSNNNNQLSEYRTRNTDILSGANSLC-------GRTVLGEISLERYQHLK 291

Query: 301 KLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPE 360
            L++ E I L+SF  +I ++CLK ++  FDGSIIF IP NLRS+  + D           
Sbjct: 292 MLVEQENISLRSFISAITMVCLKPIVKNFDGSIIFSIPVNLRSL--IAD----------- 338

Query: 361 DSANELGIIYKDIYVEVPLKLI------------EKIGNEDVVEEQFKIVCNYINESIQK 408
             +++ G+ YK+I VE PL+LI              + N  ++E QF+ +  ++++ I +
Sbjct: 339 --SSDFGLFYKNIKVECPLELINDEKYYTNPEVLHSMQNNSLLEIQFERISRHVSDVISQ 396

Query: 409 RIKAWEKNGFNDDDIKRMKFGYEQ---VGNIIEVNDLTSLDLSCSKDSL---FHIEDLSL 462
           R+KAWEK GFNDDDIKRMKF  ++   +  II++ND+T +      D++   F + +L+ 
Sbjct: 397 RMKAWEKFGFNDDDIKRMKFSNDEKTGIAPIIQINDVTEISFDFGNDNISYSFSVNNLNF 456

Query: 463 TRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFMEN 509
           T++L  N+ +SL ++ N   GLN+CI+Y   Y M+ F++CFQSF+EN
Sbjct: 457 TKSLSCNEFMSLFYSHNAQGGLNICIHYPDGYNMEAFVECFQSFIEN 503

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score =  278 bits (710), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 181/534 (33%), Positives = 290/534 (54%), Gaps = 60/534 (11%)

Query: 12  LRPLSSVEKRFLGNSLESETRHGSVCSGKWV---SNSLDISDDATLLSSKDKPLTISLVS 68
            RPL+S E+  L  S E++T +G++ S K+    +NS    D ATLL+  ++    S   
Sbjct: 3   FRPLASYERNVLIESYENQT-NGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRFI 61

Query: 69  RALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLIN 128
            AL  +I+ + E++TTIN   EF+ + +I T DV+ SI F + KDE VNC +GAPPYL+ 
Sbjct: 62  NALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLLR 121

Query: 129 YIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYENK 188
           +IF+   F P S KPLW L+IV+ S+V+F+G D LFDI++ A+F +  F  +      ++
Sbjct: 122 HIFNKDKFVPGSGKPLWNLYIVDDSIVIFHGQDVLFDIYSAASFHRKFFAALEGATPTSE 181

Query: 189 EIQDDIIFKLPNI-RNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTFKK 247
           ++    IF+L ++ ++     FPKSIYD+P+L LPA   +L +LQT+ F KS+   T  K
Sbjct: 182 KLT--TIFRLSDLSKSALTYPFPKSIYDSPLLMLPAKTIDLVSLQTRFFLKSVVSKTIVK 239

Query: 248 SFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLLKLIDAEK 307
             + + F  + P+    N +      +IL   S +    V GN+S ER+  L  + + E 
Sbjct: 240 PLNIIMFNDE-PMKSFTNSDPM----DILEKTSSLCGTTVFGNISNERFDYLQSIAEEEN 294

Query: 308 IDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPEDSANELG 367
           +  KS  C I ++CLK +I  F  +I F I  NLR                  + + E G
Sbjct: 295 VCTKSLVCGITMLCLKPLIKDFSSNITFSIAMNLRDSI---------------EESTEFG 339

Query: 368 IIYKDIYVEVPLKLIE--------------------KIGN----EDVVEEQFKIVCNYIN 403
           + YK++ +EVPL  I+                    K  N    E ++  QF  +  +I+
Sbjct: 340 LFYKNVRIEVPLSFIDDNVFKLKTSYNGYDASNSNIKETNPNYEEQLIAYQFNQIATFIS 399

Query: 404 ESIQKRIKAWEKNGFNDDDIKRMKFGYEQ---VGNIIEVNDLTSLDLSCSKD-----SLF 455
            ++++R++AW +NGFNDDDIK MKFG +       II++ND++ L   C  +     +  
Sbjct: 400 RNLKQRMRAWRRNGFNDDDIKMMKFGSKDKNTSAKIIQINDISDLSF-CPMNKNGELNSV 458

Query: 456 HIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFMEN 509
            ++DLS T +L  +Q +SLS+      G N+CI++   Y ++ F++ FQ+F++ 
Sbjct: 459 SLKDLSFTHSLVPDQFMSLSYTHCKSTGSNICIHFPEVYDLELFVEKFQNFIDG 512

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score =  232 bits (592), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 167/534 (31%), Positives = 285/534 (53%), Gaps = 61/534 (11%)

Query: 13  RPLSSVEKRFLGNSLESETRHGSVCSGKWVSN----SLDISDDATLLSSKDKPLTISLVS 68
           R LS  E + L  +L+ + R+G   + K+  N    SL  SD++TL+S KD+ LT+S+++
Sbjct: 4   RQLSEYEVKLLEQTLQGK-RNGVAFAAKYGRNYDDSSLSSSDESTLVSLKDRRLTLSVIT 62

Query: 69  RALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLIN 128
           R L+ILI  HIE++T I+++  + L+ +I   DV+  I F+++KDE +NCH G PPYL+ 
Sbjct: 63  RVLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYLLR 122

Query: 129 YIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIIN----SLP 184
           +IF+   F+   +KPLW+L+I++ + ++F+G D LFD F+ A F K     +N    S+ 
Sbjct: 123 HIFNKSDFKLGQQKPLWKLYIIDETTIIFHGFDMLFDSFSAAYFHKCFLAEVNSYMSSIV 182

Query: 185 YENKEIQDDIIFKLPNIRNISKI--NFPKSIYD---NPMLHLPATKPELFNLQTQSFFKS 239
              ++   D +F+L +  ++ KI    P+SIYD   +P   L A    +FN QT+SFFKS
Sbjct: 183 SSKQKKPLDYLFQLSSSADLIKIYDEIPRSIYDYDSSPFAPLTAV---MFNDQTKSFFKS 239

Query: 240 IYLNTFKKSFDYL-NFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQ 298
           +YLN  KK  +++ N + Q           ++ Y   + ++  +    + G +S  R+ +
Sbjct: 240 LYLNAVKKPIEFITNTSSQVKTYQQIKEAETEGYLNPMGIHRSLCGNTIFGTISSCRFNE 299

Query: 299 LLKLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSG 358
           L +    E+I LKS  C +I+M LK  +  F  +++F I  NLR                
Sbjct: 300 LTEKATREQISLKSLICGLIMMSLKPTLNDFSKNMVFSIRVNLRD--------------- 344

Query: 359 PEDSANELGIIYKDIYVEVPLKLI-----------EKIG--------NEDVVEEQFKIVC 399
               +   G+ Y+DI +E PL LI           + +G         E V E+QFK V 
Sbjct: 345 DVSKSKTFGLYYRDIIIECPLSLIDDRAIQFSGYRDHVGITAQELETYEKVYEQQFKDVT 404

Query: 400 NYINESIQKRIKAWEKNGFNDDDI---KRMKFGYEQVGNIIEVNDLTSLDL--SCSKDSL 454
            YI   + ++I  W+     D+DI   K M   ++    II++NDLT +D+  + S++  
Sbjct: 405 TYIQNVMNEKIGYWK----TDNDIKMMKMMDDMHQSKDEIIQINDLTEIDINENLSQNDP 460

Query: 455 FHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFME 508
           + ++  S+  +L K ++ S+S+     +GL + I+      M+ F++ FQ+F++
Sbjct: 461 YCVKSSSMVTSLSKKEMFSVSYTHCEASGLTISIHIPKMRSMESFVENFQAFLD 514

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score =  213 bits (543), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 154/536 (28%), Positives = 273/536 (50%), Gaps = 65/536 (12%)

Query: 10  KVLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSN--SLDISDDATLLSSKDKPLTISLV 67
           +V R L+  EK  L  +  +  ++G + S  +  N  + D+SD+ TL S  ++ L+ S++
Sbjct: 6   RVYRNLTPTEKTILCET-ATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLSDSMI 64

Query: 68  SRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLI 127
            +AL  +I  H E+   +++N EF+ +DKI+  DV+  I F+   DE VNC++G PPYL+
Sbjct: 65  WKALLKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLL 124

Query: 128 NYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYEN 187
            +IF   +F    K+PLWQLF+++ ++VVF+G D LFD FA ANF KL  + +NSL    
Sbjct: 125 RHIFDKCHFTLGQKQPLWQLFVIDGTMVVFHGHDVLFDTFAAANFHKLFLQALNSLSESC 184

Query: 188 KEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTFKK 247
              +   +FK   I        P++++        ++  + F  Q+Q+  +S+Y    KK
Sbjct: 185 TSPRP--VFKGGKILP----TLPRALFQKQEPQAASSITDAFYSQSQAILRSLYNLAIKK 238

Query: 248 SFDYLNFTQQTPIILARNHNISKNYN--EILHLNSIVKSELVTGNVSMERYLQLLKLIDA 305
               L F +   I     H+  ++    E L+  + +   +V G +S  R+  L  +++ 
Sbjct: 239 P---LRFIESGRI----EHSTEQHSGTPEPLNYPNHLCGTVVFGTISTPRFKILKGILND 291

Query: 306 EKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPEDSANE 365
            KI +K+F  S  + CL+ ++   +  I F +P NLR +                  ++ 
Sbjct: 292 HKISMKTFIISATLFCLQPVLDSSEDKITFSLPINLRDLIPW---------------SSP 336

Query: 366 LGIIYKDIYVEVPL------------------KLIEKIGNEDV---------VEEQFKIV 398
           LGI ++++ +E PL                  +L+E +   D           E  F+  
Sbjct: 337 LGIYHRNVLIECPLGTAGRNSNCSAGSYVSNPELLEGMTLSDANQTNADQADPESLFERT 396

Query: 399 CNYINESIQKRIKAWEKNGFNDDDIKRM----KFGYEQVGN-IIEVNDLTSLDLSCSKDS 453
             +++  ++K ++  E   F D D+ +M    KF     G+ IIE+NDL+ +DLS    S
Sbjct: 397 VTHVSNELKKALQDLETGKFKDMDMMKMEQEAKFYAAASGSKIIEINDLSEIDLSNVNPS 456

Query: 454 LFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFMEN 509
            + +ED+  T++   N  +S+S++ ++  GLNL I+YS + +M  F++ F++F+EN
Sbjct: 457 QYVVEDICATKSRCNNTFMSISYSFSSTCGLNLGIHYSEDCEMNYFVESFEAFLEN 512

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score =  183 bits (465), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 147/543 (27%), Positives = 266/543 (48%), Gaps = 78/543 (14%)

Query: 10  KVLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLDISDDATLLS--SKDKPLTISLV 67
           KV R L++ EK  +  +  +  ++G + S  +     ++ + +  +S     K L  +++
Sbjct: 6   KVYRNLTATEKTIICET-AAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGKGLPDAIM 64

Query: 68  SRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLI 127
            +AL  +I  + E+ ++INK  +F+ +D I   DV+  I F+N  DE V+C++G PPYL+
Sbjct: 65  WQALSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLL 124

Query: 128 NYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYEN 187
            +IF   +F    +KPLWQ+F+++ S+VVF+G D LFD FA A F KL  E +NS  + N
Sbjct: 125 RHIFDKCHFSIGQQKPLWQVFVIDQSMVVFHGHDVLFDGFAAATFHKLFLEALNS--FRN 182

Query: 188 -KEIQDDIIFK-----LPNIRNISK---INFPKSIYDNPMLHLPATKPELFNLQTQSFFK 238
            K  + D+IFK     +P  ++++    ++   S+ D  + +            +Q+  K
Sbjct: 183 VKGQKSDLIFKTREDLIPLCQSLAAEHNVSLISSVKDQVLTY------------SQTALK 230

Query: 239 SIYLNTFKKSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQ 298
           ++Y    KK   ++   +     L  +   + N  ++      +   +V GNV+ ER   
Sbjct: 231 NLYSLAIKKPLRFIESGR-----LEHSGIPASNPYDLASYAGDLCGTVVFGNVNPERVRG 285

Query: 299 LLKLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSG 358
           L  L++  KI  +SF  S+ + CL  ++   +  IIF +P NLR              S 
Sbjct: 286 LRALMNESKISFRSFIISVTMFCLLPVLEPSEEKIIFSVPINLRE-------------SI 332

Query: 359 PEDSANELGIIYKDIYVEVPLKLIEK-----------------------IG--NEDVVEE 393
           P   A++LG+   ++  E PL LI+                        +G  NED  + 
Sbjct: 333 PW--ASDLGVFQNNVLFECPLDLIKHDIEPCSGISTFNQEFLEGSTLTDVGGVNEDQNDP 390

Query: 394 Q--FKIVCNYINESIQKRIKAWEKNGFNDDDIKRMK-----FGYEQVGNIIEVNDLTSLD 446
           Q  F+ +  ++   ++      EK+  + +D+ + +     F       I+E+NDL  +D
Sbjct: 391 QTVFRRILTHVTTELELAAMRLEKSHSSGEDLIKAEREARYFAASSRSKIVEINDLLEVD 450

Query: 447 LSCSKDSLFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSF 506
           LS    S + I D+  T + K +  +S+S+ S+  +GLNL I+YS  + M+ F++ F+ F
Sbjct: 451 LSSKIHSRYKIGDVCSTSSRKSDTFMSISYCSSEISGLNLGIHYSEGFNMEYFVESFEGF 510

Query: 507 MEN 509
           +++
Sbjct: 511 LDS 513

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score =  181 bits (458), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 151/532 (28%), Positives = 259/532 (48%), Gaps = 68/532 (12%)

Query: 12  LRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLD---ISDDATLLSSKDKPLTISLVS 68
           +R LSSVEK F    + +  R+G V +  + SN  +    SDD TL + +D  L    +S
Sbjct: 8   IRDLSSVEKIF-HKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRLFDGQIS 66

Query: 69  RALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLIN 128
            AL+ +I  ++E+  TI  + +F   + I   DV+  I F+  KDEL+ C +G PPY++ 
Sbjct: 67  NALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILR 126

Query: 129 YIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYENK 188
            I     F+    +PLW+L IV+ ++V+ +  + +FD+FA ANF     + ++  P +  
Sbjct: 127 NILENNKFE--FGRPLWELIIVDYTMVILHCHEVMFDLFAAANFHLKFQKALSQFPKDTH 184

Query: 189 EIQDDIIFKLP-NIRNISKINFP--KSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTF 245
            +  DI+F    N   +SK NF     I  +P+  LP        LQ  S  K  Y  T 
Sbjct: 185 AL--DILFVYEGNELQLSKTNFDGMSQISVSPVQSLP--------LQCISVLKGAYRTTV 234

Query: 246 KKSFDYL--NFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSMERYLQLLKLI 303
           KKS + +  NF     I    +   S  +  + + N++  +  V+G+++ ER   LL+L 
Sbjct: 235 KKSLNVIRRNFVANNQITTYESSK-SDVFKSMFNPNTLCGTT-VSGSLNAERLASLLELT 292

Query: 304 DAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIPYNLRSMQNLRDKENHNSSSGPEDSA 363
            +E + + S  C+I ++ LK +I  F+GSI F +P ++R    + D              
Sbjct: 293 SSENVCMTSVLCAITLLSLKPLIRKFNGSITFVVPIDIREKLEIFD-------------- 338

Query: 364 NELGIIYKDIYVEVPLKLIE--------KIGN---------------EDVVEEQFKIVCN 400
             LG+ Y ++ VE PL  I           GN               E ++E QFK + +
Sbjct: 339 --LGVSYTNLMVECPLSFINDKDFQHTVSDGNIKSLHKIDPNSPDYPEMLLEYQFKQLTS 396

Query: 401 YINESIQKRIKAWEKNGFNDDDIKRMKFGYEQ---VGNIIEVNDLTSLDLSCSKDSLFHI 457
           ++  S++++ +AW+K  F+   +K  K         G  IE+N    +D+  ++D  FH 
Sbjct: 397 HVMNSLKEKKQAWQKRRFDMSSLKGKKLRRSNKIIRGKFIEIN---LVDMGEAQDGQFHT 453

Query: 458 EDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFIDCFQSFMEN 509
           ++++ T +L    ++S+S A     G+N+ ++Y     M  F++CFQ  +E+
Sbjct: 454 KNVNFTSSLGSKCLISVSCAILRGVGMNIFMHYPESNDMDAFVECFQILLED 505

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score =  172 bits (435), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 139/495 (28%), Positives = 233/495 (47%), Gaps = 83/495 (16%)

Query: 49  SDDATLLSSKDKPLTISLVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICF 108
           SD +TL+SS+   L    +S AL+ +I  ++EM  T+    +F  + +I   DV+  I F
Sbjct: 29  SDSSTLMSSRCGCLREHQISSALRSMIRENVEMCVTVTDGPKFAPVSRIEYDDVVRVIEF 88

Query: 109 ENKKDELVNCHSGAPPYLINYIFSLPYFQPDSKKPLWQLFIVNSSLVVFYGDDTLFDIFA 168
           +  KDE + CH G PPY+  +I +   F+  + KPLW+++I + S+V+F+  + LFD+FA
Sbjct: 89  QTYKDEAIACHDGIPPYVARHILNKSKFE--AGKPLWEVYIADGSMVIFHCHNVLFDLFA 146

Query: 169 VANFIKLLFEIINSLPYENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPEL 228
             NF     + +     E  E  ++ +F                +Y+   L LP   P+ 
Sbjct: 147 AGNFHVRFQQALQRC--EKNEPHNETLF----------------VYEGGPLQLP-IDPDA 187

Query: 229 FNL-------QTQSFFKSIYLNTFK---KSFDYLNFTQQTPIILARNHNISKNYNEILHL 278
            +L          S F S   N  +   K F  L       + L R+    K +   L  
Sbjct: 188 CSLPGVDVPYPASSPFVSFVKNVCRYALKPFGALASAVTPSLRLNRSSLGRKPFLLTLDK 247

Query: 279 NSIVKSELVTGNVSMERYLQLLKLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIFKIP 338
            S+  +  V+G ++ ++   LLKLI  E++ ++SF C+I ++ LK +I  FDGSI F IP
Sbjct: 248 ESLYGTT-VSGYLNSKKLDSLLKLISKEEVCVRSFLCAITLLSLKPLIRNFDGSIAFSIP 306

Query: 339 YNLRSMQNLRDKENHNSSSGPEDSANELGIIYKDIYVEVPLKLI-----EKIGN------ 387
            +LR+       E+H ++          G   K I V+ PL LI     E + N      
Sbjct: 307 LDLRT-------ESHKTTP--------FGFQSKRILVDCPLALIDDRVFESLFNRPSKQR 351

Query: 388 ------------EDVVEEQFKIVCNYINESIQKRIKA-WE-KNGFNDDDIKRMKFGYEQV 433
                       E ++E QFK V  ++ +S+  +    W  K  ++   +++ K      
Sbjct: 352 KTKLDKNSPKFSEGLLEYQFKRVTTHVMKSLTAQTSGDWTGKRKYSKCQLRKKK------ 405

Query: 434 GNIIEVNDLTSLDLSCSKDSLFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTE 493
             IIE+N    +D+  S  + F I++++ T +L     +SLS A     G+N+C++Y   
Sbjct: 406 --IIEIN---VVDMGTSPSARFQIKNMNFTDSLGSETFMSLSCALMRGVGMNMCMHYLER 460

Query: 494 YKMKDFIDCFQSFME 508
             M  F+DCFQ+F++
Sbjct: 461 DSMDMFVDCFQTFLD 475

>Kpol_1032.1 s1032 (25..765) [741 bp, 246 aa] {ON} (25..765) [741
           nt, 247 aa]
          Length = 246

 Score =  105 bits (262), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 135/254 (53%), Gaps = 41/254 (16%)

Query: 276 LHLNSIVKSELVTGNVSMERYLQLLKLIDAEKIDLKSFFCSIIIMCLKFMITCFDGSIIF 335
           L  +S + + ++ G ++ ER+ +L  LI   +I L+S  C I+++C K  I  FDG+I F
Sbjct: 14  LRKDSYIYNRVLFGTIAAERFNRLKALIRKGRICLRSVICGIVMLCTKPNIQNFDGNIRF 73

Query: 336 KIPYNLRSMQNLRDKENHNSSSGPEDSANELGIIYKDIYVEVPLKLI----------EKI 385
            I  +++ +                D +++ GI+ K+I V+ PLKLI          E I
Sbjct: 74  SIGVDMKPIV---------------DDSSQFGILKKNIIVDCPLKLIDDKHYKDTDSESI 118

Query: 386 GNEDVVEEQFKIVCNYINESIQKRIKAWEKNGFNDDDIKR--MKFGYEQVGN------II 437
            N D++E QF+ V +++ E +  ++++  K+       KR    F +  + +      +I
Sbjct: 119 KNGDILEIQFRKVTDFVTEELSNKLQSMAKH------FKRNNCPFNFSSINSQISDSKVI 172

Query: 438 EVNDLTSLDLSCSKDS--LFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYK 495
           ++NDLT +  + ++ +   +   DL +T  L  N+ +SLS+ +N+ + +++ I+Y+    
Sbjct: 173 QINDLTDIPFTTTEQNPNGYSFHDLKVTEGLSPNESMSLSYITNSNSAMSISIHYTETKY 232

Query: 496 MKDFIDCFQSFMEN 509
           M  F++CF++F+EN
Sbjct: 233 MDSFVECFRTFIEN 246

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 76/138 (55%), Gaps = 2/138 (1%)

Query: 11  VLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLD-ISDDATLLSSKDKPLTISLVSR 69
           +LR L+  EK  L  + E  + +G + S K      D +SDDATL ++ +      L+ +
Sbjct: 1   MLRILNESEKSALKQTSEG-SMNGIIFSVKISKKCEDNLSDDATLHTTGESGNLQLLLLK 59

Query: 70  ALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLINY 129
           +LK+LI  + E+ TT+++N  F  LD++ T+DV+  I +  +K ++    SG    LIN 
Sbjct: 60  SLKLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINS 119

Query: 130 IFSLPYFQPDSKKPLWQL 147
           I+    FQP S KP  +L
Sbjct: 120 IYYHSNFQPGSGKPYGKL 137

>SAKL0H19536g Chr8 complement(1721654..1724920) [3267 bp, 1088 aa]
           {ON} similar to uniprot|P36775 Saccharomyces cerevisiae
           YBL022C PIM1 Mitochondrial ATP-dependent protease
           involved in intramitochondrial proteolysis involved in
           degradation of misfolded proteins in mitochondria
           required for bigenesis and maintenance of mitochondria
          Length = 1088

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/178 (20%), Positives = 75/178 (42%), Gaps = 22/178 (12%)

Query: 139 DSKKPLWQLFIVNSSLV---VFYGDDTLFDIFAVANFI--------KLLFEIINSLPYEN 187
           + ++P    F++  S +   V +  D ++D+   A           K   E + +L Y +
Sbjct: 202 ERQQPYIGAFLLKDSEIDTDVIHSADEVYDVGVFAQITSAFPSKDEKTGAETMTALLYPH 261

Query: 188 KEIQDDIIFKLPNIRNISKINFPKSI-YDNPMLHLPATKPELFNLQTQSFFKSIYLNTFK 246
           + I+ D +    N +  SK N    +  D  ++  P +KP   +++    F       F 
Sbjct: 262 RRIRIDELLPPSNGKKESKENVEAELPKDTEVIKTPESKPVEESIEESEDFDETNPTEFL 321

Query: 247 KSFDY----------LNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVSME 294
           K +D             F +++P+I A    I K + EI  LN++ + ++ T + S++
Sbjct: 322 KDYDVSLVNVSNLEDKEFDRKSPVINALTSEILKVFKEISQLNTMFREQIATFSASIQ 379

>Ecym_2483 Chr2 (946645..948030) [1386 bp, 461 aa] {ON} similar to
           Ashbya gossypii ACL138C
          Length = 461

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 64/151 (42%), Gaps = 14/151 (9%)

Query: 59  DKPLTISLVSRALKILISNHIEMFTTI-NKNSEFQLLDKINTSDVLHSICFENKKDELVN 117
           +KP+  S +   LK LI  H  ++  I  K+   +L+  +N    L  +  E   D L  
Sbjct: 30  NKPVDRSSLCCVLKELIPKHPHLYRNIFTKDGSKKLVRPLNVEIRLDDVLEETGFDSLDE 89

Query: 118 CHSGAPPYLINYIFSLPYFQPDSKKPLWQLFIVNSSL-VVFYGDDTLFDIFAVANFIKLL 176
             +       N I     FQ D ++PLW+L  + +    +F  D   FD  +   F    
Sbjct: 90  SAA-------NSILKNSTFQYDQQRPLWKLISLKAGTQFLFCFDHAFFDGMSAVIFWNDF 142

Query: 177 FEIINSLPYENKEIQD--DIIFKL---PNIR 202
              +NS+  EN+   D  ++++K    P IR
Sbjct: 143 ISALNSIKPENRRGMDLNEVLYKAAADPEIR 173

>KLTH0C02178g Chr3 complement(196605..197999) [1395 bp, 464 aa] {ON}
           weakly similar to uniprot|P53304 Saccharomyces
           cerevisiae YGR212W SLI1 N-acetyltransferase confers
           resistance to the sphingolipid biosynthesis inhibitor
           myriocin (ISP-1) by inactivating it co-operates with
           Ypk1p in mediating resistance to myriocin converts
           myriocin into N-acetyl-myriocin
          Length = 464

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 60/294 (20%), Positives = 124/294 (42%), Gaps = 30/294 (10%)

Query: 59  DKPLTISLVSRALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNC 118
           +K  T S + +A++ ++  + ++++ +   +   +L+ + ++ VL  +    + + L   
Sbjct: 30  NKSPTRSEIVQAVRAVVPEYPQLYSDVVTRNGSLVLEPLQSTLVLSDVVEFTEMESLDEE 89

Query: 119 HSGAPPYLINYIFSLPYFQPDSKKPLWQLFIV-NSSLVVFYGDDTLFDIFAVANFIKLLF 177
           HS       N IF    F   ++KPLW++ I+ +    V   D  + D  +   F     
Sbjct: 90  HS-------NKIFKEVTFVYGAEKPLWKVLILKDQRTFVLCSDHLILDGLSATVFWGSFM 142

Query: 178 EIINSLPYENKEIQDDIIFKL-PNIRNISKINF---PKSIYDNPMLHLPATKPELFNLQT 233
             +N+  + +    D+++FK  PNI ++ +  +   P SI    +L +      L +L  
Sbjct: 143 RSLNA-SHADSTFPDEVVFKPSPNIAHVPQHPYSRIPVSI-SGLLLRIVVRILVLISLLG 200

Query: 234 QSFFKSIYLNTF-KKSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVKSELVTGNVS 292
                 +++     + F +L++  + P  L  +    +N N  L +            V 
Sbjct: 201 IDLIGPVFVPELGSEDFKFLHY--RFPDGLLTSDGSVRNDNCQLKI-----------KVP 247

Query: 293 MERYLQLLKLIDAEKIDLKSFFCSIIIMCLKFMIT-CFDGSII-FKIPYNLRSM 344
                 LL+    +K+ L  F  ++I   LK + T C +GS I   +P N R +
Sbjct: 248 PNNLRALLRRCKEKKVSLSVFLLAVIAHSLKLVGTDCVEGSRIKASVPMNARPL 301

>Kpol_530.8 s530 complement(14877..17516,17519..26101) [11223 bp, 3740
            aa] {ON} complement(14877..17516,17519..26101) [11223 nt,
            3741 aa]
          Length = 3740

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 36/59 (61%)

Query: 432  QVGNIIEVNDLTSLDLSCSKDSLFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINY 490
            Q   ++++ D+ SL +S  +D+ F+I+ L  ++ ++K QI+ L +   +   +NL IN+
Sbjct: 1691 QKDMVLKLQDMLSLTISTIRDNEFYIDKLQFSQAIEKFQIIYLKYLELDGCDINLLINF 1749

>CAGL0K00737g Chr11 complement(81263..82636) [1374 bp, 457 aa] {ON}
           similar to uniprot|P53304 Saccharomyces cerevisiae
           YGR212w
          Length = 457

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 1/72 (1%)

Query: 127 INYIFSLPYFQPDSKKPLWQLFIV-NSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPY 185
           IN +F    F+    KPLW++ +V  ++ ++F  D   FD  A   F   L + +  L  
Sbjct: 92  INSVFRKYNFEYGVDKPLWKVIVVPKANKMIFATDHLFFDGIATVLFWTELLKSLEELKQ 151

Query: 186 ENKEIQDDIIFK 197
           +N    D+II++
Sbjct: 152 DNDLDVDEIIYR 163

>Kpol_1072.52 s1072 (119728..120924) [1197 bp, 398 aa] {ON}
           (119728..120924) [1197 nt, 399 aa]
          Length = 398

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 403 NESIQKRIKAWEKNGFNDDDIKRMKFGY 430
           N  I +R+KAWE+ G + DD  R K+ +
Sbjct: 34  NMPINRRVKAWERAGEDKDDFFRRKYAH 61

>TBLA0H01710 Chr8 complement(394015..395043) [1029 bp, 342 aa] {ON}
           Anc_5.398 YDR347W
          Length = 342

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 56/117 (47%), Gaps = 19/117 (16%)

Query: 147 LFIVNSSLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYENKEIQDDIIFKLPNIRNISK 206
           LF+VN+     Y   T F+I  V +  ++  ++ N+   ENK  QD++   + +    S 
Sbjct: 217 LFVVNT-----YNAGTPFNIGKVGHLNEITSKLSNNKNMENKSQQDNLDMMVDSTS--SS 269

Query: 207 INFPKSI--------YDNPMLHLPA----TKPELFNLQTQSFFKSIYLNTFKKSFDY 251
           I++ KS+        +D+ + ++P     + P+ +     SF K +YLN    S D+
Sbjct: 270 ISYQKSVTEAQNYDRFDHNIHYIPILAIDSSPKAYLTDYGSFGKILYLNNIWNSIDW 326

>TPHA0H00960 Chr8 (201187..202617) [1431 bp, 476 aa] {ON} Anc_5.119
           YGR212W
          Length = 476

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 88/403 (21%), Positives = 154/403 (38%), Gaps = 65/403 (16%)

Query: 128 NYIFSLPYFQPDSKKPLWQLFIVNS-SLVVFYGDDTLFDIFAVANFIKLLFEIINSLPYE 186
           N +F    F+    KPLW+L I +  + +V   D T FD  +   F K L   ++S+  +
Sbjct: 97  NSVFQEINFKYGELKPLWKLIIASKINTIVLAMDHTFFDGSSATLFWKALLLELSSIDRD 156

Query: 187 NKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNTFK 246
             E   D++F   NI             DN +  L  +   L +    SF   I      
Sbjct: 157 QLE-DTDVVFSKANID------------DNYITALDISSNNLLDDCPISFASKIKRFIAS 203

Query: 247 KSFDYLNFTQQTPIILARNHNISKNYNEILHLNSIVK--------------SELVTGNVS 292
           K F Y  +T     I+A N  + + +++    +SI +              S     N+ 
Sbjct: 204 KIFQYFPYT-----IIAPNSELLQ-FDDYSFPSSIFEDGCDKPASYKLKNNSRRAIINIK 257

Query: 293 MERYLQLLKLIDAEKIDLKSFFCSII---IMCLKFMITCFDGSIIFKIPYNLRSMQNLRD 349
             +   +LK   ++ I L S+  ++I   +   K        +I  +IP NLR +  L++
Sbjct: 258 PAQISNVLKYCRSKNIALTSYLSALISYYVNIYKDKSVNHGSAIKVEIPINLRGI--LKE 315

Query: 350 KENHNSSSGPEDSANELGIIYKDIYVEVPLKLIEKIGNEDVVEEQFKIVCNYINESIQKR 409
           K          D A + G      Y+     +I+   N   +++        I+ S+++ 
Sbjct: 316 KLEM-------DIAPDFGC-----YISSTDLVIDSQLNGSTIDKLASTFQKQISNSVKEN 363

Query: 410 IKAWEKNGFNDDDIKRMKFGYEQV-----------GNIIEVNDLTSLDLSCSKDSLFHIE 458
           +    +N    + I   KF   +V           G   EV +L  +      D+ F +E
Sbjct: 364 VDETIENIKITEVIDSFKFFEYKVTPKPSEDKIFPGATFEVTNLGRVSFETKNDNFF-VE 422

Query: 459 DLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYKMKDFID 501
           D     +     I +    S ++ G+NL I YS    +KDF++
Sbjct: 423 DALFGGSQSLTTIFTCYVISTDFGGMNLAITYSDS--IKDFME 463

>Suva_7.506 Chr7 (873531..874931) [1401 bp, 466 aa] {ON} YGR212W
           (REAL)
          Length = 466

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 90/404 (22%), Positives = 157/404 (38%), Gaps = 93/404 (23%)

Query: 127 INYIFSLPYFQPDSKKPLWQLFIVNSS-LVVFYGDDTLFDIFAVANFIKLLFEIINSLPY 185
           INYIF    F  +   PLW++ I+ S   ++   D  L D  +  +  + L + +     
Sbjct: 95  INYIFQTYDFAYNEATPLWKILIIPSQNEMLLVADHVLMDGMSAVHVWETLMKGLQ---- 150

Query: 186 ENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFF---KSIYL 242
           +   I+DD     P + + S      S ++N    +P T   +  L +  F+   K+I  
Sbjct: 151 KEAPIEDDEAIYSP-LFSSSTDTISASPFEN--WPVPWTWRIIRQLASSLFYWSPKTIVT 207

Query: 243 N----------TFKKSFDYLNFTQQTPIILARNHNISKNYNEI-LHLNSIVKSELVTGNV 291
           N          +F ++F     T  T     RN N    +  +  HL S++ SE    NV
Sbjct: 208 NNKDLIQFANYSFPENFLEYEPTGDTSSYKVRNTNHQWEFRLLPAHLKSVL-SECKAHNV 266

Query: 292 SMERYLQLLKLIDAEKIDLKSFFCSIIIMCLKFMIT---CFDGSII-FKIPYNLR----- 342
           S+  +L  L                   +CL F  T    ++G+ +  ++P N R     
Sbjct: 267 SLTSFLGAL-------------------VCLSFKRTLKEVYNGTYLKMELPMNTRKICRE 307

Query: 343 SMQNLRDKENHNSSSGPEDSANELGIIYKDIYVEVPLKLIEKIGNEDVVEEQFKIVCNYI 402
           ++Q L D+E              L I      +E   KL + +G  D+  +         
Sbjct: 308 NLQFLSDEE--------------LVIGNFVAPIEYKHKLHQDLGLWDIASK--------- 344

Query: 403 NESIQKRIKAWEKNGFND--DDIKRMKFGYEQ--VGNIIEVN-------DLTSLDL---- 447
              IQK +K+  K+   D  +++K ++    Q  + N I +N       ++T+L      
Sbjct: 345 ---IQKAVKSSSKDKVIDTINNVKLLEVVSPQQFIKNKINLNNGPSSTFEVTNLGFQAFK 401

Query: 448 -SCSKDSLFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINY 490
            +C+ D  FH+ D         + I +L   S    GL+ C++Y
Sbjct: 402 DACNTDLPFHVMDAIFNVPQSMSDIFTLGVISTPVGGLHCCVSY 445

>KNAG0G00700 Chr7 complement(132337..133707) [1371 bp, 456 aa] {ON}
           Anc_5.119 YGR212W
          Length = 456

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 1/54 (1%)

Query: 126 LINYIFSLPYFQPDSKKPLWQLFIV-NSSLVVFYGDDTLFDIFAVANFIKLLFE 178
           L N IF    FQ   +KPLW++  +  SS  V   D  LFD  +  N  + L E
Sbjct: 92  LANEIFKEYNFQYTVEKPLWRILAMPKSSTFVLLVDHVLFDGMSTVNLWRCLLE 145

>Smik_8.177 Chr8 (279199..290433) [11235 bp, 3744 aa] {ON} YHR099W
            (REAL)
          Length = 3744

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 436  IIEVNDLTSLDLSCSKDSLFHIEDLSLTRNLKKNQILSLSFASNNYNGLNLCINYSTEYK 495
            I+++ D+ +L L   K++LF+I+ L L ++++K QIL L +   +    NL         
Sbjct: 1692 ILKLKDMLNLTLKTIKENLFYIDHLQLNQSIEKFQILYLRYTELSEKDQNLL-------- 1743

Query: 496  MKDFID 501
            + DFID
Sbjct: 1744 LLDFID 1749

>Kwal_27.9898 s27 (112396..113778) [1383 bp, 460 aa] {ON} YGR212W -
           Hypothetical ORF [contig 43] FULL
          Length = 460

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 95/226 (42%), Gaps = 26/226 (11%)

Query: 126 LINYIFSLPYFQPDSKKPLWQLFIVN-SSLVVFYGDDTLFDIFAVANFIKLLFEIINSLP 184
           + N IF    F   S KPLW++ ++N    +V   D  + D  +   F K     +N+  
Sbjct: 90  ICNKIFREVEFTYGSGKPLWKVLVLNDRRTLVLCTDHVILDGLSTVAFWKKFLGSLNAT- 148

Query: 185 YENKEIQDDIIFKLPNIRNISKINFPKSIYDNPMLHLPATKPELFNLQTQSFFKSIYLNT 244
             +  +  +++F+ P++ N      P+  YD     +P T    F    ++  + +    
Sbjct: 149 -ASTSLVSEVVFE-PSVHNSV---VPQHPYD----RIPVT---FFETMARALVQVLVFLA 196

Query: 245 FKKSFDYLNFTQQTPI----ILARNHNISKNYNEILHLNSIVKSE--LVTGNVSMERYLQ 298
           F K  D +      P+    +  +N+  +++Y   L  +  V+++  L+   +  ++   
Sbjct: 197 FLK-IDLITTLFVPPLQKQYLKFKNYQFTRDY---LAADGSVRNDNRLLKIVIPPQKLQN 252

Query: 299 LLKLIDAEKIDLKSFFCSIIIMCLKFMITC-FDGSII-FKIPYNLR 342
           LL L     + L S   +I+   LK + +  FDG+     IP N R
Sbjct: 253 LLALCKGHNVSLSSLILAIMANSLKHVDSSQFDGTRAKISIPMNTR 298

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,406,589
Number of extensions: 2977684
Number of successful extensions: 11108
Number of sequences better than 10.0: 98
Number of HSP's gapped: 11412
Number of HSP's successfully gapped: 99
Length of query: 509
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 395
Effective length of database: 40,409,475
Effective search space: 15961742625
Effective search space used: 15961742625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)