Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A072006.6ON65653342e-42
Kwal_56.223336.6ON62622092e-23
Kthe_YGOB_Anc_6.66.6ON62612083e-23
ZYRO0F00418g6.6ON62602056e-23
TDEL0G046506.6ON62621979e-22
NDAI0I027406.6ON66591971e-21
CAGL0A01111g6.6ON69611926e-21
Sklu_YGOB_Anc_6.66.6ON61621927e-21
Kpol_1045.826.6ON62621892e-20
KAFR0B064906.6ON66611796e-19
Skud_16.66.6ON62571771e-18
Suva_16.346.6ON62571771e-18
KNAG0E027906.6ON65631735e-18
Klac_YGOB_Anc_6.66.6ON61621726e-18
Smik_6.4796.6ON62571727e-18
YPL271W (ATP15)6.6ON62571727e-18
NCAS0D022006.6ON85581686e-17
TPHA0J002306.6ON62621641e-16
Ecym_30086.6ON61581381e-12
ACR021W6.6ON62531362e-12
Ecym_62638.758ON146327650.33
KAFR0A034201.251ON165943611.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07200
         (65 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...   133   2e-42
Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...    85   2e-23
Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...    85   3e-23
ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...    84   6e-23
TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...    80   9e-22
NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...    80   1e-21
CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...    79   6e-21
Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...    79   7e-21
Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...    77   2e-20
KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...    74   6e-19
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)       73   1e-18
Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)    73   1e-18
KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...    71   5e-18
Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...    71   6e-18
Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...    71   7e-18
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...    71   7e-18
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    69   6e-17
TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...    68   1e-16
Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...    58   1e-12
ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    57   2e-12
Ecym_6263 Chr6 (497029..501420) [4392 bp, 1463 aa] {ON} similar ...    30   0.33 
KAFR0A03420 Chr1 (697216..702195) [4980 bp, 1659 aa] {ON} Anc_1....    28   1.4  

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score =  133 bits (334), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 65/65 (100%), Positives = 65/65 (100%)

Query: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60
          MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL
Sbjct: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60

Query: 61 KELPN 65
          KELPN
Sbjct: 61 KELPN 65

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score = 85.1 bits (209), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 42/62 (67%), Positives = 49/62 (79%)

Query: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60
          MSAWRKAG+TYN Y+AIAA+TVR+ALK E QTA V+DRS TEARF KY  G+  A+   L
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60

Query: 61 KE 62
          KE
Sbjct: 61 KE 62

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score = 84.7 bits (208), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 42/61 (68%), Positives = 50/61 (81%)

Query: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60
          MSAWRKAG+TYN Y+AIAA+TVR+ALK +LQTA V+ RS TEARF KY KG+P A+   L
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60

Query: 61 K 61
          K
Sbjct: 61 K 61

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score = 83.6 bits (205), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 37/60 (61%), Positives = 49/60 (81%)

Query: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60
          MSAWRKAG+TYNAY+++AAKTVR+ALKPE QTAAV+ R   ++++TK+ KG P  +P  L
Sbjct: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score = 80.5 bits (197), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 49/62 (79%)

Query: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60
          M+AWRKAG+TYN Y+++AA+TVR ALKPELQ A V+ RS T+AR+ KY KGS  +D   L
Sbjct: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60

Query: 61 KE 62
          +E
Sbjct: 61 QE 62

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score = 80.5 bits (197), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 37/59 (62%), Positives = 49/59 (83%)

Query: 4  WRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALLKE 62
          WRKAGITY+AY++IAA+T+R ALKPELQTA V+ RS T+A FTKY  G+P ++P  L++
Sbjct: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESLQK 65

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score = 78.6 bits (192), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 50/61 (81%)

Query: 2  SAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALLK 61
          +AWRKAG++Y++++AIAA+TVR +LK ELQT AV+ R  T+A +TKY KGSP +DP  L+
Sbjct: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPLQ 68

Query: 62 E 62
          E
Sbjct: 69 E 69

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 78.6 bits (192), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 39/62 (62%), Positives = 49/62 (79%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60
          MSAWRKAG+TYN Y++IAAKTVR ALK E QTA V+ RS +EA+F K+  G+P +DP  L
Sbjct: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPL 59

Query: 61 KE 62
          K+
Sbjct: 60 KK 61

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score = 77.4 bits (189), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 46/62 (74%)

Query: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60
          MSAWRKAGITYN Y+ IAA+TVR ALK EL+T  V+ RS TEA+F  +  G+P  +P  +
Sbjct: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60

Query: 61 KE 62
          ++
Sbjct: 61 QQ 62

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score = 73.6 bits (179), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 44/61 (72%)

Query: 2  SAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALLK 61
          S WRKAG+TY +Y++IA+KT+R  LK E QTAAV  RS TEA  T Y  GSP +DP  L+
Sbjct: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPLQ 62

Query: 62 E 62
          +
Sbjct: 63 K 63

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score = 72.8 bits (177), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 47/57 (82%)

Query: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADP 57
          MSAWRKAGI+Y AY+ +AA+T+R++LK ELQTA+V+ RS T+A +TKY  G+  ++P
Sbjct: 1  MSAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEP 57

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score = 72.8 bits (177), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (80%)

Query: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADP 57
          MSAWRKAG++Y AY+ +AA+T+R++LK ELQTA V+ RS T+A +TKY  G+  ++P
Sbjct: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEP 57

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score = 71.2 bits (173), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 1/63 (1%)

Query: 1  MSA-WRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPAL 59
          MSA W+KAGITY  Y+ + AKT+R+ALK ELQT  V+ R  T+A +T Y KG+P ADP  
Sbjct: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60

Query: 60 LKE 62
          L+E
Sbjct: 61 LQE 63

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 70.9 bits (172), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 47/62 (75%), Gaps = 1/62 (1%)

Query: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60
          MS WRKAG+T+N Y+++AA TVR ALKPELQT +V+ RS +EA+F K+  G   ++P  L
Sbjct: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENGVA-SEPVPL 59

Query: 61 KE 62
          K+
Sbjct: 60 KK 61

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score = 70.9 bits (172), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 46/57 (80%)

Query: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADP 57
          MSAWRKAGI+Y AY+ +AAK +R++LK ELQTA+V+ RS T+A +T+Y  G+  ++P
Sbjct: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEP 57

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score = 70.9 bits (172), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 47/57 (82%)

Query: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADP 57
          MSAWRKAGI+Y AY+ +AA+ +R++LK ELQTA+V++RS T+A +T+Y  G+  ++P
Sbjct: 1  MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEP 57

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 69.3 bits (168), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 44/58 (75%)

Query: 4  WRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALLK 61
           RKAG+TY  Y+ +A++T+R +LK ELQT  V+ RS T+A +TKY KGSP ADPA L+
Sbjct: 24 LRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADPAPLQ 81

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score = 67.8 bits (164), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 47/62 (75%)

Query: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60
          MS WRKAG+TY+ Y+A+AAKTVR +LK +L+T +V+ RS T+ ++T + KG+  ++P  +
Sbjct: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60

Query: 61 KE 62
           +
Sbjct: 61 SD 62

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score = 57.8 bits (138), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (77%), Gaps = 1/58 (1%)

Query: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKG-SPDADP 57
          MSAWRKAG++YN Y+A+AA+ VR+ALKPEL+ AAV+ RS TEA+   Y  G + DA P
Sbjct: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDGAASDAVP 58

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 57.0 bits (136), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 45/53 (84%), Gaps = 1/53 (1%)

Query: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKY-TKGS 52
          MSAWRKAG+TYN+Y+A+AA+TVR ALK ELQ+ AV++RS TEA+   Y +KGS
Sbjct: 1  MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGS 53

>Ecym_6263 Chr6 (497029..501420) [4392 bp, 1463 aa] {ON} similar to
           Ashbya gossypii AFR567W
          Length = 1463

 Score = 29.6 bits (65), Expect = 0.33,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 28  PELQTAAVIDRSFTEARFTKYTKGSPD 54
           P+L+  +VI + F+E  F  +TKG+P+
Sbjct: 935 PQLRRMSVIVKPFSEKVFISFTKGAPE 961

>KAFR0A03420 Chr1 (697216..702195) [4980 bp, 1659 aa] {ON} Anc_1.251
            YKR031C
          Length = 1659

 Score = 28.1 bits (61), Expect = 1.4,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 7    AGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYT 49
            A + YN    IAAK+  +A K +  ++A+I+  F E    KY+
Sbjct: 1160 ASLNYNTLNTIAAKSADSASKKQRISSAMIEMGFREVFDCKYS 1202

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.127    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,279,208
Number of extensions: 161558
Number of successful extensions: 377
Number of sequences better than 10.0: 22
Number of HSP's gapped: 377
Number of HSP's successfully gapped: 22
Length of query: 65
Length of database: 53,481,399
Length adjustment: 38
Effective length of query: 27
Effective length of database: 49,124,091
Effective search space: 1326350457
Effective search space used: 1326350457
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)