Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A071906.5ON79479436700.0
Kpol_1045.836.5ON74864722880.0
TDEL0G046606.5ON73968322830.0
TPHA0J002206.5ON74062622820.0
NCAS0D022106.5ON77365822740.0
NDAI0I027306.5ON83261222530.0
ZYRO0F00396g6.5ON73265422400.0
CAGL0A01133g6.5ON80161722460.0
YPL270W (MDL2)6.5ON77359222010.0
Suva_16.356.5ON76762721990.0
Smik_6.4786.5ON77359021950.0
Skud_16.76.5ON77359221750.0
Kwal_56.223296.5ON77661321250.0
SAKL0E00748g6.5ON77460021230.0
KLTH0C11616g6.5ON74060720790.0
KLLA0D00748g6.5ON78960320490.0
ACR022W6.5ON75462320370.0
Ecym_30076.5ON76967420120.0
KNAG0E028006.5ON74166719830.0
KAFR0B064806.5ON75170418560.0
TPHA0B046201.67ON72061913391e-174
Kpol_2000.791.67ON70758113271e-172
KLLA0C01991g1.67ON70661513181e-171
SAKL0C02244g1.67ON71261813141e-170
YLR188W (MDL1)1.67ON69560813111e-170
TDEL0C063501.67ON69356912991e-168
Skud_12.2531.67ON69261112961e-168
Smik_12.2481.67ON69660912901e-167
Suva_10.2841.67ON69361012821e-166
Ecym_10721.67ON68360512791e-166
NDAI0A005601.67ON71457812801e-165
NCAS0B087001.67ON71560312801e-165
ZYRO0F17050g1.67ON71459912621e-163
AFR683C1.67ON67760512571e-162
KLTH0F02024g1.67ON73459712271e-157
Kwal_33.133081.67ON70657612211e-157
TBLA0A053001.67ON70757911801e-150
CAGL0E00385g1.67ON60857011511e-147
SAKL0H00968g5.20ON7005535379e-58
KAFR0I025805.20ON7093895105e-54
KLLA0A10131g5.20ON7203315062e-53
Kwal_26.94805.20ON7195715053e-53
Smik_13.5185.20ON6873875008e-53
Skud_13.4755.20ON6915834982e-52
Suva_13.4915.20ON6933834963e-52
KNAG0E013205.20ON6953714945e-52
YMR301C (ATM1)5.20ON6903874911e-51
KLTH0B09482g5.20ON6943954893e-51
NCAS0D024305.20ON7023324884e-51
YKL209C (STE6)1.527ON12905274966e-51
Kpol_513.235.20ON7083854868e-51
TBLA0B100701.527ON12965264903e-50
TBLA0C070005.20ON7253284823e-50
Ecym_56495.20ON6963164796e-50
KAFR0E002301.527ON12705094869e-50
Kpol_1018.1851.527ON12765174861e-49
TDEL0F003401.527ON12575234823e-49
KNAG0G001901.527ON12755194814e-49
Suva_11.111.527ON12905284771e-48
TDEL0G004305.20ON6964234654e-48
NDAI0D015401.527ON12934564701e-47
TPHA0L022705.20ON7113914612e-47
NDAI0I024405.20ON7303334594e-47
SAKL0A10208g1.527ON13105194556e-46
AGL335W5.20ON6913054477e-46
CAGL0M13739g5.20ON7273784488e-46
Skud_11.111.527ON12955104531e-45
TPHA0O001601.527ON12535264512e-45
KLLA0B14256g1.527ON12715254502e-45
ZYRO0G02244g1.527ON12734914494e-45
ZYRO0D07106g5.20ON7093974336e-44
AFR432W1.527ON12844974381e-43
NCAS0G035101.527ON12885334343e-43
Ecym_36121.527ON13154994228e-42
Smik_11.141.527ON13165264192e-41
KLTH0B01100g1.527ON12984264156e-41
Kwal_33.155611.527ON12975184059e-40
KNAG0E011204.6ON17175704014e-39
CAGL0K00363g1.527ON12274323942e-38
Ecym_42658.303ON15055313943e-38
TPHA0C009608.303ON15235623863e-37
NCAS0C059304.6ON16575113853e-37
TDEL0E056104.52ON15355593853e-37
CAGL0E03355g4.52ON15355563811e-36
YLL048C (YBT1)4.6ON16615573801e-36
KLLA0E00529g4.6ON16505423773e-36
ZYRO0G07612g4.6ON16954953774e-36
YHL035C (VMR1)4.6ON15925893747e-36
NCAS0B034708.303ON15125393731e-35
Suva_10.234.6ON16615453721e-35
NCAS0J00160singletonON16545113721e-35
KNAG0J027304.52ON15375413702e-35
NDAI0J011508.303ON15174843693e-35
SAKL0H26026g4.6ON16534993659e-35
KAFR0L001904.6ON16535003651e-34
Ecym_84184.6ON16784853641e-34
Smik_12.484.52ON15575263632e-34
CAGL0E03982g4.6ON16595113622e-34
KLTH0H16038g4.6ON16495043613e-34
NDAI0B006405.10ON14915523613e-34
Smik_12.114.6ON16615453595e-34
Skud_12.224.6ON16615183586e-34
Kwal_34.157704.6ON14365453577e-34
Suva_10.594.52ON15615383552e-33
TBLA0G007104.6ON16915463552e-33
Smik_8.64.6ON15855833542e-33
TDEL0G018504.6ON16424873542e-33
KAFR0B056308.303ON15155873533e-33
Skud_12.524.52ON15615443523e-33
CAGL0C03289g4.6ON16485613523e-33
YDR135C (YCF1)8.303ON15155683524e-33
Suva_10.60singletonON9905383488e-33
Smik_4.3808.303ON15165493481e-32
SAKL0H16016g8.303ON14994843481e-32
Skud_4.3958.303ON15164813443e-32
NDAI0H001904.6ON16825033444e-32
KLTH0C09240gna 1ON15465383434e-32
Suva_2.2978.303ON15165683416e-32
KNAG0K001705.10ON14425473391e-31
KAFR0I013004.52ON15365423382e-31
Kpol_311.34.6ON16574923382e-31
AGR047W8.303ON14924743372e-31
Skud_7.6145.10ON14775363363e-31
YLL015W (BPT1)4.52ON15595393363e-31
KLTH0G12716g8.303ON15003943354e-31
Kwal_56.22747na 1ON15385543337e-31
ZYRO0G22176g4.52ON15705323337e-31
Kwal_56.238448.303ON14944633311e-30
TPHA0F001804.6ON16465023311e-30
YGR281W (YOR1)5.10ON14775453301e-30
KNAG0I009908.303ON15355053292e-30
TPHA0A056205.10ON14775463292e-30
Suva_8.164.6ON15995423282e-30
NCAS0E041605.10ON15065433283e-30
ZYRO0D06160g8.303ON15254743255e-30
KAFR0C065105.10ON14575013256e-30
CAGL0G00242g5.10ON14775423231e-29
Skud_8.94.6ON15875163231e-29
TPHA0K023104.6ON16494793221e-29
Smik_16.275.10ON14775403222e-29
Kpol_1033.288.303ON15315023212e-29
Suva_7.5775.10ON14785393203e-29
CAGL0L06402g8.303ON15354623185e-29
ACL072C4.6ON16274993176e-29
TPHA0F004104.52ON15705653151e-28
SAKL0H00704g5.10ON14395333141e-28
KLLA0C14234g5.10ON14545333122e-28
KLLA0F20075g8.303ON15164683103e-28
SAKL0H23958g4.52ON15585103095e-28
KLLA0D04059g4.52ON15685203087e-28
TDEL0F043008.303ON15144603052e-27
YKR104WsingletonON3062622863e-27
Kpol_1060.75.10ON14605623014e-27
Kwal_26.95325.10ON14715323015e-27
Zrou_YGOB_Anc_5.105.10ON9924982971e-26
Kpol_YGOB_1041.454.52ON15685282962e-26
Kpol_1041.45singletonOFF15965282962e-26
Skud_18.2singletonON15805482935e-26
KLTH0B09724g5.10ON14865522925e-26
TDEL0G003305.10ON14655432909e-26
Smik_11.367na 2ON15955572882e-25
TBLA0C06400singletonON13775362863e-25
KLTH0B00396gsingletonON15072292829e-25
TBLA0A06840singletonON10582722764e-24
TBLA0A038008.303ON15464022756e-24
TBLA0C071005.10ON14855802702e-23
AGL346W5.10ON14002362327e-19
Kpol_175.1singletonON13772842167e-17
Ecym_56605.10ON15362162014e-15
YKR103W (NFT1)na 2ON12181661996e-15
Ecym_24108.661ON8282581782e-12
ACR128C8.661ON8271911772e-12
SAKL0H21010gsingletonON14472491745e-12
Kwal_26.87308.661ON8312111729e-12
TBLA0D017805.500ON15952391692e-11
KNAG0B038705.500ON15132421692e-11
KLTH0D10890g8.661ON8302101683e-11
TBLA0D01820singletonON15512421693e-11
KAFR0C05210na 3ON14932451683e-11
KAFR0C052205.500ON14992521683e-11
AGL142CsingletonON14972421674e-11
TPHA0D011708.661ON9152071621e-10
KAFR0A037908.661ON8762031621e-10
ZYRO0B05588g3.133ON12702411621e-10
Skud_14.404na 4ON14242331622e-10
TPHA0D04700singletonON15102391622e-10
ZYRO0D11880g5.500ON14982381612e-10
Ecym_11943.534ON6092871592e-10
Smik_15.3335.500ON15102421593e-10
YOR153W (PDR5)5.500ON15112421593e-10
Kpol_1053.483.133ON12882661594e-10
SAKL0H06908g8.661ON8361951584e-10
Smik_6.3448.661ON8701961584e-10
NDAI0E012408.661ON8972781584e-10
TDEL0B057601.427ON10362441584e-10
YPL147W (PXA1)8.661ON8702351575e-10
ZYRO0D11858gna 3ON15032401585e-10
TBLA0A024405.500ON16212411576e-10
KAFR0J027003.534ON6081941557e-10
NCAS0A120605.500ON15432341567e-10
KLLA0F11484g8.661ON8452381558e-10
KAFR0C00820na 5ON15172071569e-10
Smik_14.399na 4ON14212191559e-10
CAGL0K10472g1.366ON7522401541e-09
KLTH0A01914g3.220ON14992351551e-09
Suva_16.1638.661ON8701951541e-09
TBLA0D043501.427ON11192491541e-09
ZYRO0D17710gsingletonON14862351541e-09
ZYRO0E04092g1.427ON10622411532e-09
TPHA0A058903.534ON6101941522e-09
KNAG0I005301.427ON10472441532e-09
Skud_4.6805.500ON14452431532e-09
Skud_4.681na 3ON14452431532e-09
SAKL0D10208g1.366ON7522371512e-09
SAKL0F01606g3.534ON6082711512e-09
ABR125C3.220ON14882091522e-09
YOL075C3.133ON12942331522e-09
KLLA0D03432g3.220ON14832681522e-09
KNAG0A029808.661ON8711971513e-09
KAFR0C045401.366ON7522501503e-09
YFR009W (GCN20)1.366ON7522401503e-09
TBLA0C017808.661ON8882071503e-09
NCAS0E01640na 5ON15022331513e-09
NDAI0A042005.500ON15512381513e-09
ZYRO0F07018g8.661ON8612011504e-09
ABR126Wna 5ON15122401504e-09
TDEL0A036405.500ON15092351504e-09
KNAG0C045005.500ON15552341504e-09
Kwal_27.9666singletonON14742671504e-09
SAKL0C11616g3.220ON14842681504e-09
Kpol_1049.234.6ON110731354e-09
ZYRO0E08800g3.534ON6102421484e-09
NCAS0E004803.534ON6102211485e-09
NDAI0C012205.500ON15092391495e-09
KNAG0K013503.220ON15012361495e-09
TDEL0D060203.534ON6101941476e-09
Suva_8.2045.500ON15112381486e-09
NCAS0H024205.500ON15202351486e-09
Skud_16.1358.661ON8701951486e-09
ZYRO0G01144g1.366ON7522401477e-09
NCAS0B015308.661ON8682441477e-09
AFR232C3.534ON6072741477e-09
CAGL0C02343g3.534ON7201971477e-09
CAGL0M01760gsingletonON14992381487e-09
Skud_15.3175.500ON15122381487e-09
Smik_15.508na 6ON15662381487e-09
YOR328W (PDR10)na 6ON15642321488e-09
ZYRO0A04114g3.220ON15182411488e-09
Kwal_47.191163.534ON6071841468e-09
SAKL0C11704gna 5ON15102411478e-09
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07190
         (794 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...  1418   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   885   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   884   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   883   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      880   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   872   0.0  
ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...   867   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   869   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...   852   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...   851   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...   850   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)   842   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   823   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   822   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   805   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   793   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   789   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   779   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   768   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   719   0.0  
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   520   e-174
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   515   e-172
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   512   e-171
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   510   e-170
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   509   e-170
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   504   e-168
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   503   e-168
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   501   e-167
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   498   e-166
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   497   e-166
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   497   e-165
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   497   e-165
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   490   e-163
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   488   e-162
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   477   e-157
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   474   e-157
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   459   e-150
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   447   e-147
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   211   9e-58
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   201   5e-54
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   199   2e-53
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   199   3e-53
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   197   8e-53
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   196   2e-52
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   195   3e-52
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   194   5e-52
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   193   1e-51
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   192   3e-51
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     192   4e-51
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   195   6e-51
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   191   8e-51
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   193   3e-50
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   190   3e-50
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   189   6e-50
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   191   9e-50
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   191   1e-49
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   190   3e-49
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   189   4e-49
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   188   1e-48
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   183   4e-48
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   185   1e-47
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   182   2e-47
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   181   4e-47
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   179   6e-46
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   176   7e-46
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   177   8e-46
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   179   1e-45
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   178   2e-45
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   177   2e-45
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   177   4e-45
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   171   6e-44
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   173   1e-43
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   171   3e-43
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   167   8e-42
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   166   2e-41
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   164   6e-41
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   160   9e-40
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   159   4e-39
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   156   2e-38
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   156   3e-38
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   153   3e-37
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   152   3e-37
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   152   3e-37
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   151   1e-36
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   150   1e-36
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   149   3e-36
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   149   4e-36
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   148   7e-36
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   148   1e-35
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   147   1e-35
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   147   1e-35
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   147   2e-35
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   146   3e-35
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   145   9e-35
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   145   1e-34
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   144   1e-34
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   144   2e-34
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   144   2e-34
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   143   3e-34
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    143   3e-34
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   142   5e-34
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   142   6e-34
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   142   7e-34
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   141   2e-33
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   141   2e-33
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   140   2e-33
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   140   2e-33
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   140   3e-33
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   140   3e-33
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   140   3e-33
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   140   4e-33
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   138   8e-33
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   138   1e-32
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   138   1e-32
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   137   3e-32
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   137   4e-32
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   136   4e-32
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   135   6e-32
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   135   1e-31
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   134   2e-31
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   134   2e-31
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   134   2e-31
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   134   3e-31
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   134   3e-31
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   133   4e-31
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   132   7e-31
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   132   7e-31
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   132   1e-30
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   132   1e-30
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   131   1e-30
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   131   2e-30
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   131   2e-30
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   130   2e-30
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    130   3e-30
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   129   5e-30
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   129   6e-30
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   129   1e-29
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   129   1e-29
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   128   1e-29
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   128   2e-29
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   128   2e-29
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   127   3e-29
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   127   5e-29
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   126   6e-29
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   125   1e-28
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   125   1e-28
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   124   2e-28
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   124   3e-28
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   123   5e-28
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   123   7e-28
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   122   2e-27
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   114   3e-27
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   120   4e-27
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   120   5e-27
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   119   1e-26
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   118   2e-26
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   118   2e-26
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   117   5e-26
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   117   5e-26
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   116   9e-26
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   115   2e-25
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   114   3e-25
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   113   9e-25
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   110   4e-24
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   110   6e-24
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           108   2e-23
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...    94   7e-19
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    88   7e-17
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    82   4e-15
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    81   6e-15
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    73   2e-12
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    73   2e-12
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    72   5e-12
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    71   9e-12
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    70   2e-11
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    70   2e-11
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    69   3e-11
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              70   3e-11
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            69   3e-11
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    69   3e-11
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    69   4e-11
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    67   1e-10
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    67   1e-10
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    67   1e-10
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    67   2e-10
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            67   2e-10
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    67   2e-10
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    66   2e-10
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    66   3e-10
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    66   3e-10
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    66   4e-10
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    65   4e-10
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    65   4e-10
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     65   4e-10
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    65   4e-10
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    65   5e-10
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    65   5e-10
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    65   6e-10
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    64   7e-10
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    65   7e-10
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    64   8e-10
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              65   9e-10
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    64   9e-10
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    64   1e-09
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    64   1e-09
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    64   1e-09
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    64   1e-09
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    64   1e-09
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    64   2e-09
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    63   2e-09
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    64   2e-09
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    64   2e-09
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    64   2e-09
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    63   2e-09
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    63   2e-09
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    63   2e-09
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    63   2e-09
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    63   2e-09
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    63   3e-09
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    62   3e-09
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    62   3e-09
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    62   3e-09
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    63   3e-09
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    63   3e-09
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    62   4e-09
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    62   4e-09
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    62   4e-09
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    62   4e-09
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    62   4e-09
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    62   4e-09
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    57   4e-09
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    62   4e-09
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 62   5e-09
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    62   5e-09
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    62   5e-09
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    61   6e-09
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    62   6e-09
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    62   6e-09
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    62   6e-09
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    61   7e-09
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    61   7e-09
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    61   7e-09
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    61   7e-09
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    62   7e-09
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    62   7e-09
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    62   7e-09
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    62   8e-09
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    62   8e-09
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    61   8e-09
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    61   8e-09
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    61   8e-09
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    61   8e-09
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    61   8e-09
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    61   9e-09
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    61   9e-09
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    61   9e-09
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    61   1e-08
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    61   1e-08
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    61   1e-08
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    61   1e-08
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                61   1e-08
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    61   1e-08
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    60   1e-08
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    60   1e-08
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    60   1e-08
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    60   2e-08
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    60   2e-08
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    60   2e-08
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    60   2e-08
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    60   2e-08
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    60   2e-08
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    60   2e-08
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    60   2e-08
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             60   3e-08
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    60   3e-08
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    60   3e-08
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    60   3e-08
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    60   3e-08
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    60   3e-08
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    59   3e-08
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    59   3e-08
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    60   3e-08
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    59   3e-08
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    59   3e-08
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    60   3e-08
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    59   3e-08
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    59   4e-08
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    59   4e-08
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    59   4e-08
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    59   4e-08
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    59   4e-08
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    59   5e-08
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    59   5e-08
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    59   5e-08
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    59   5e-08
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    59   6e-08
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    58   6e-08
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    59   7e-08
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    59   7e-08
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    58   7e-08
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    58   8e-08
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    58   1e-07
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    58   1e-07
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    57   1e-07
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    57   1e-07
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    57   1e-07
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    57   1e-07
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    57   1e-07
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    57   1e-07
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    57   1e-07
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    57   1e-07
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    57   2e-07
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    57   2e-07
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    57   2e-07
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    57   2e-07
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    57   2e-07
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    57   2e-07
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    57   3e-07
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    56   3e-07
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    56   3e-07
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    56   3e-07
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    56   3e-07
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    56   3e-07
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    56   4e-07
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    56   4e-07
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    56   4e-07
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    56   4e-07
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    56   4e-07
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    56   4e-07
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    55   5e-07
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    55   5e-07
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    55   5e-07
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    55   6e-07
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    55   6e-07
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    55   6e-07
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    54   7e-07
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    55   7e-07
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    55   8e-07
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    55   9e-07
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    54   1e-06
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    54   1e-06
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    54   1e-06
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    54   1e-06
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    54   1e-06
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    54   1e-06
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    54   1e-06
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    54   1e-06
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    54   1e-06
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    54   2e-06
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    54   2e-06
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    54   2e-06
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    53   2e-06
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    54   2e-06
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    54   2e-06
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    53   3e-06
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    52   4e-06
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    53   4e-06
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    52   4e-06
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    52   5e-06
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    52   5e-06
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    52   6e-06
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    51   6e-06
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    52   7e-06
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    52   7e-06
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    51   7e-06
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    50   8e-06
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    51   9e-06
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    52   9e-06
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    51   9e-06
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    51   9e-06
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    51   9e-06
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    50   1e-05
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    51   1e-05
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    51   1e-05
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    50   1e-05
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    51   1e-05
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    51   1e-05
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    51   1e-05
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    50   1e-05
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    50   1e-05
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    51   1e-05
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    50   2e-05
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    49   2e-05
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    49   2e-05
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    50   2e-05
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    50   2e-05
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    50   3e-05
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    49   3e-05
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    49   4e-05
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    48   4e-05
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    49   5e-05
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    49   5e-05
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    49   5e-05
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       49   5e-05
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    49   7e-05
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    48   7e-05
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    48   8e-05
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    47   8e-05
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    48   8e-05
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    48   1e-04
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    48   1e-04
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    47   1e-04
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    47   1e-04
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    47   1e-04
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    47   2e-04
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    46   2e-04
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    47   2e-04
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    47   2e-04
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    47   2e-04
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    47   2e-04
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    47   2e-04
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    45   3e-04
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    47   3e-04
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    47   3e-04
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    47   3e-04
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    46   3e-04
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     46   3e-04
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    46   4e-04
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    46   4e-04
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    45   4e-04
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    46   4e-04
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    46   5e-04
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    46   5e-04
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    45   5e-04
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    45   5e-04
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    45   5e-04
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    45   6e-04
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    45   6e-04
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     45   7e-04
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    45   7e-04
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    45   8e-04
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    45   9e-04
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    45   0.001
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    45   0.001
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    45   0.001
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    45   0.001
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    44   0.001
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    44   0.002
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    44   0.002
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    44   0.002
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    43   0.002
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    44   0.002
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    43   0.002
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    44   0.002
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    44   0.002
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    44   0.002
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    44   0.002
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    44   0.003
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    42   0.003
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    43   0.003
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    43   0.003
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    43   0.003
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    43   0.003
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    43   0.003
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    43   0.003
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    43   0.003
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    43   0.004
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    43   0.004
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    42   0.004
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    43   0.004
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    43   0.004
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    43   0.004
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    42   0.005
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    42   0.006
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    42   0.006
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    42   0.006
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    42   0.006
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    42   0.007
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              42   0.008
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    42   0.008
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    41   0.008
Suva_51.1 Chr51 (3..968) [966 bp, 322 aa] {ON} YDR011W (REAL)          41   0.009
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    42   0.009
Kwal_26.6702 s26 complement(29426..31279) [1854 bp, 617 aa] {ON}...    41   0.010
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    42   0.010
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    42   0.010
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    42   0.010
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    41   0.012
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    41   0.012
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    40   0.012
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    41   0.013
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    41   0.013
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    41   0.013
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    41   0.014
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    41   0.017
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    40   0.018
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    40   0.018
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    40   0.019
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    40   0.021
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    40   0.021
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    40   0.021
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    40   0.022
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    40   0.022
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    40   0.035
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    39   0.037
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    39   0.051
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    39   0.076
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    38   0.12 
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    38   0.14 
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    37   0.16 
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    37   0.19 
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    37   0.25 
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    37   0.26 
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    37   0.29 
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    36   0.30 
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    36   0.34 
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    36   0.37 
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    36   0.40 
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    35   0.95 
KAFR0C03280 Chr3 complement(666612..667646) [1035 bp, 344 aa] {O...    33   2.5  
Kwal_27.12817 s27 (1386470..1389226) [2757 bp, 919 aa] {ON} YDR4...    33   2.9  
Skud_6.83 Chr6 (155917..156978) [1062 bp, 353 aa] {ON} YFR007W (...    33   2.9  
KNAG0M01630 Chr13 (289388..291340) [1953 bp, 650 aa] {ON} Anc_5....    33   2.9  
YFR007W Chr6 (159299..160360) [1062 bp, 353 aa] {ON}  YFH7Putati...    32   4.3  
NDAI0A03440 Chr1 (789010..790836) [1827 bp, 608 aa] {ON} Anc_8.2...    33   4.5  
Suva_6.73 Chr6 (124236..125297) [1062 bp, 353 aa] {ON} YFR007W (...    32   5.7  

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score = 1418 bits (3670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 713/794 (89%), Positives = 713/794 (89%)

Query: 1   MLRFRTTCLPIKNTLSPTNLLFPSVFKSSSNYKSIAKLPYTRLYQTNVSNISLKLPISIP 60
           MLRFRTTCLPIKNTLSPTNLLFPSVFKSSSNYKSIAKLPYTRLYQTNVSNISLKLPISIP
Sbjct: 1   MLRFRTTCLPIKNTLSPTNLLFPSVFKSSSNYKSIAKLPYTRLYQTNVSNISLKLPISIP 60

Query: 61  LRFQQLTYPFLGSKRCYSTEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTDKXX 120
           LRFQQLTYPFLGSKRCYSTEG                                  TDK  
Sbjct: 61  LRFQQLTYPFLGSKRCYSTEGNNSNNNNNDSTSPLNINESSLNKKKLEEPLNEELTDKIN 120

Query: 121 XXXXXXXXXXKTNYSPRAEDEKKGRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIP 180
                     KTNYSPRAEDEKKGRSELARLVLMTLRDWK           SCSIGMAIP
Sbjct: 121 PSSIRSPPPNKTNYSPRAEDEKKGRSELARLVLMTLRDWKLLLLAITLLTISCSIGMAIP 180

Query: 181 KVIGLVLDALKNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILL 240
           KVIGLVLDALKNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILL
Sbjct: 181 KVIGLVLDALKNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILL 240

Query: 241 RLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKA 300
           RLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKA
Sbjct: 241 RLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKA 300

Query: 301 ILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEE 360
           ILC            PQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEE
Sbjct: 301 ILCGGAGIGMMISISPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEE 360

Query: 361 QLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAY 420
           QLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAY
Sbjct: 361 QLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAY 420

Query: 421 GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIR 480
           GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIR
Sbjct: 421 GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIR 480

Query: 481 PTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIAL 540
           PTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIAL
Sbjct: 481 PTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIAL 540

Query: 541 LLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATP 600
           LLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATP
Sbjct: 541 LLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATP 600

Query: 601 DEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEA 660
           DEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEA
Sbjct: 601 DEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEA 660

Query: 661 TSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKE 720
           TSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKE
Sbjct: 661 TSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKE 720

Query: 721 LYADPTSELSKLLNEKQSRANKKEAPLPPQSXXXXXXXXXXXXTPASPPSLHNNLVTDVL 780
           LYADPTSELSKLLNEKQSRANKKEAPLPPQS            TPASPPSLHNNLVTDVL
Sbjct: 721 LYADPTSELSKLLNEKQSRANKKEAPLPPQSDGENGDDFEGNGTPASPPSLHNNLVTDVL 780

Query: 781 KEVSDDSSPLKIAP 794
           KEVSDDSSPLKIAP
Sbjct: 781 KEVSDDSSPLKIAP 794

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/647 (66%), Positives = 520/647 (80%), Gaps = 4/647 (0%)

Query: 146 SELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVMTDSPSSLETSD 205
           S+L RL  +  RDWK           SC IGM++PK+IG+VLD LK +M++   +++  D
Sbjct: 100 SDLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDFTVD--D 157

Query: 206 LPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAE 265
           +P IAFGL LY F+     +L++GT  NYGR ILLR+LSERVVARLR++VIKKT+HQDAE
Sbjct: 158 VPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAE 217

Query: 266 FFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIF 325
           FFD NKVGDLISRL SDAYVVSRSLTQKVSDGFKA+LC            PQLS+FL+  
Sbjct: 218 FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277

Query: 326 APAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAI 385
            P V++SAS FG+ IR+ S  LQEATG LT+V+EEQ +G+KTVQSFVAEQKEI+RYN+AI
Sbjct: 278 TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAI 337

Query: 386 RDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYT 445
           R I+N+GK SA +N+KF + T+V+GDMSFLVVLAYGSYLVLHGSL+IGDLTA+M+YT+YT
Sbjct: 338 RHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYT 397

Query: 446 ANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPT 505
            +SIFGLS FYSEIMQG GAA RLF+LTDRIP+I PT+G+KF+P  G IEF+N+ F+YPT
Sbjct: 398 GSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPT 457

Query: 506 RPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP 565
           R  NQ+FKNL+FKI+ G++VCIVGPSGRGKSTIA LLLRYYNP++GQI +D QDI K++ 
Sbjct: 458 RASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSS 517

Query: 566 KSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYET 625
           KSLR++M IVQQEPVLMSG+IRDNITYGL  + T DE+R ++K+CFCHNFITKFP++Y+T
Sbjct: 518 KSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDT 577

Query: 626 IIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSV 685
           I+GPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFGKLMKSKS+
Sbjct: 578 ILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSI 637

Query: 686 TIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEA 745
           TI+SIAHRLSTIRRSE +IVLGNDGSV E GKFKELYADP SELSKLL+EK +R+ +++ 
Sbjct: 638 TIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQN 697

Query: 746 PLPPQSXXXXXXXXXXXXTPAS--PPSLHNNLVTDVLKEVSDDSSPL 790
               Q             TP S     L  N + + + +V+ D+ P+
Sbjct: 698 TAEDQEIDPEETINIENSTPESDITQELLENPIKEAIMDVAADNKPI 744

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/683 (63%), Positives = 530/683 (77%), Gaps = 48/683 (7%)

Query: 135 SPRAEDEKKGRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALK--- 191
           SP+  ++K G  ++ RL+++   DWK           SC IGM IPKVIG++LD LK   
Sbjct: 81  SPKEAEQKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGL 140

Query: 192 --NVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVA 249
             N   D P S+  +D+PPI  G ++Y FLG FA  +V G + NYGR +LLR+LSERVVA
Sbjct: 141 ETNEGKDGPISM--ADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVA 198

Query: 250 RLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXX 309
           RLR++VIKKT+HQD+EFFD++KVGDLISRLGSDAYVVSRS+TQKVSDGFKA++C      
Sbjct: 199 RLRANVIKKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGVG 258

Query: 310 XXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQ 369
                 PQLS  L++F P V+ SASIFG+KIRD ST LQEATGQLTRVSEEQL+GV+TVQ
Sbjct: 259 MMVSISPQLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQ 318

Query: 370 SFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGS 429
           SFVAEQKEI RY++AIRDI+N+GK +A +N++F T+TS +GD+SFLVVLAYGSYLVL G 
Sbjct: 319 SFVAEQKEIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGG 378

Query: 430 LTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIP 489
           LTIGDLTAFMLYT+YT +S+FGL++FYSE+MQGVGAA RLF+LTDR+P+I+PT G+KF+P
Sbjct: 379 LTIGDLTAFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVP 438

Query: 490 GDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
           G G I F+++ F+YPTRP N +F++++ KI  G++VC+VGPSGRGKSTIALLLLR+YNPS
Sbjct: 439 GKGEIVFKDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPS 498

Query: 550 SGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQ 609
           SGQI ID QDI KLN KSLR+++G+VQQEPVLMSG++RDNITYGL    + +EIR V+KQ
Sbjct: 499 SGQIFIDGQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQ 558

Query: 610 CFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESE 669
           CFCHNFI KFP  Y+T+IGP G LLSGGQKQRIAIARALIKKP IL+LDEATSALDVESE
Sbjct: 559 CFCHNFIVKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESE 618

Query: 670 GAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSEL 729
           GAINYTFG+LMKSKSVTIVSIAHRLSTIRRSE IIVLGNDGSVVETGKFKEL+ADP+SEL
Sbjct: 619 GAINYTFGQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPSSEL 678

Query: 730 SKLLNEK-------------------QSRANKKEAPLPPQSXXXXXXXXXXXXTPASPPS 770
           SKLLNEK                   +  AN+K A                      P  
Sbjct: 679 SKLLNEKSSRSENSSSSYSPNASEQPEDEANQKNA----------------------PEE 716

Query: 771 LHNNLVTDVLKEVSDDSSPLKIA 793
            H++ V ++LK+V+ +  P+KI+
Sbjct: 717 AHDDSVEEILKDVTAEGKPIKIS 739

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  883 bits (2282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/626 (68%), Positives = 509/626 (81%), Gaps = 12/626 (1%)

Query: 137 RAEDEKKGRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVMTD 196
           R    +   +++ RL+ +  +DWK           SC+IGM++PKVIG+VLD LKN ++ 
Sbjct: 66  RVPKSRNDGNDIKRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISK 125

Query: 197 SPS--------SLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVV 248
           S          S+E+S+LPPIAFGL+LY FLG    AL+IGT  N+GR +LLR+LSERVV
Sbjct: 126 SEDAELGSADLSIESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGRVVLLRVLSERVV 185

Query: 249 ARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXX 308
           ARLRS VIKKT+HQDAEFFD NKVGDLISRLGSDAYVVSRS+TQKVSDGFKA+LC     
Sbjct: 186 ARLRSQVIKKTIHQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCGGVGV 245

Query: 309 XXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTV 368
                  P+LS+FL+ F P V++S+  FG+ IRD S  LQEATGQLTRVSEEQ +GVKTV
Sbjct: 246 GMMVSISPELSAFLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTV 305

Query: 369 QSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHG 428
           Q+FVAEQ+EI+RYNN I+D+YN+GK SA +N+K  T TS +GDMSFL+VLAYGSYLVLHG
Sbjct: 306 QAFVAEQREIKRYNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHG 365

Query: 429 SLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFI 488
            L+IGDLTA+M+YT+ T +++FGLS+FYSEIMQGVGAA RLF+LTDRIP I PT G+K+I
Sbjct: 366 GLSIGDLTAYMMYTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYI 425

Query: 489 PGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNP 548
           PG G IEF+N+ FAYPTRP +Q+FK+LNFKIEPG++VCIVGPSGRGKSTIA LLL+YY P
Sbjct: 426 PGKGEIEFKNVSFAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKP 485

Query: 549 SSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSK 608
           ++G I +D QDI KLN KSLR+++GIVQQEP+LMSGSIRDNITYGL  EAT +EIR V+K
Sbjct: 486 TAGTITVDGQDISKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTK 545

Query: 609 QCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
           QCFCHNFITKFPD Y+TI+GP+GTLLSGGQKQRIAIARAL+KKP +LILDEATSALDVES
Sbjct: 546 QCFCHNFITKFPDQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVES 605

Query: 669 EGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSE 728
           E AINYTFGKLMK K VTI+SIAHRLSTIRRSE +IVLGNDGSVVE GKFK L+ +P SE
Sbjct: 606 ESAINYTFGKLMKKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSE 665

Query: 729 LSKLLNEK----QSRANKKEAPLPPQ 750
           LS+LLNEK    +   N+K A  P Q
Sbjct: 666 LSQLLNEKSTINERNPNEKPAETPEQ 691

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  880 bits (2274), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/658 (66%), Positives = 524/658 (79%), Gaps = 8/658 (1%)

Query: 138 AEDEKKGRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVMTDS 197
           +E+ K   S++ RL L+   DWK           SC IGM IPKVIG++LD+LK V T +
Sbjct: 117 SEEPKSNFSDVIRLFLLVKTDWKLLLVALTLLTISCVIGMMIPKVIGIILDSLK-VQTAT 175

Query: 198 PSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIK 257
            S  E +  P + FGLT+Y FLG F+ AL+ G M N+GR ILLR+LSER+VARLRS VIK
Sbjct: 176 QSEGEEAPPPIMMFGLTIYEFLGGFSIALLAGCMANFGRLILLRILSERLVARLRSTVIK 235

Query: 258 KTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQ 317
           +T+HQDA+F+D +K GDLISRLG+DAY+VSRS+TQK+SDGFK+++C              
Sbjct: 236 RTIHQDAQFYDIHKTGDLISRLGADAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLD 295

Query: 318 LSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKE 377
           LS+ L +    VVISASIFGK+IR  S  LQ+ATGQLTRVSEEQLNGVKTVQSFVAEQ+E
Sbjct: 296 LSAVLGVLIIPVVISASIFGKQIRINSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQRE 355

Query: 378 IRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTA 437
           I+R+N AIR+I+++GK SA +N+KF TSTS++GD+SFL VL YGSYLVLHGSLTIGDLTA
Sbjct: 356 IKRFNEAIRNIFHVGKRSAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTA 415

Query: 438 FMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFR 497
           FMLYT+YT NSIFGLS FYSEIMQG GAA RLF+LTD +P IRPT+G+ ++PG G IEF+
Sbjct: 416 FMLYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFK 475

Query: 498 NLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDN 557
           N+ F+YPTRP+NQ+FKNLNFKIEPG++VCIVGPSG+GKSTIALLLL YYNP+SGQILID 
Sbjct: 476 NVSFSYPTRPQNQIFKNLNFKIEPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDG 535

Query: 558 QDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFIT 617
           QDI K+N KSLR+ +GIVQQEPVLMSGSIRDNITYGL    T +EIR+V+KQCFCHNFIT
Sbjct: 536 QDITKMNSKSLRRKLGIVQQEPVLMSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFIT 595

Query: 618 KFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFG 677
           KFP  Y+T IGP GTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFG
Sbjct: 596 KFPHTYDTQIGPSGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFG 655

Query: 678 KLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQ 737
           +LMK+KS+TIVSIAHRLSTIRRSE +IVLGNDGSV+E GKFKEL++DP+SELSKLLNEK 
Sbjct: 656 QLMKTKSMTIVSIAHRLSTIRRSENVIVLGNDGSVIEMGKFKELFSDPSSELSKLLNEKS 715

Query: 738 SRANKKEAPL--PPQSXXXXXXXXXXXXTPASPPSLHNNLVTDVLKEVSDDSSPLKIA 793
           SR   K  P+   P+              PA   +LH+     VL +V+ +S P+K++
Sbjct: 716 SRKKTKSDPISSAPEVDADATGEPVEPIDPAIEDALHS-----VLNDVTSESKPIKMS 768

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  872 bits (2253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/612 (70%), Positives = 502/612 (82%), Gaps = 5/612 (0%)

Query: 131 KTNYSPRAEDEKKGRS---ELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVL 187
           K +  P   +  +G S   ++ RL L+  +D+K           SC+IGM IPK+IGL+L
Sbjct: 143 KASTEPNEIEPDQGESNFKDVFRLFLLVKKDYKLLIVSLTLLTISCTIGMMIPKIIGLIL 202

Query: 188 DALKNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERV 247
           DALK+V T       +S  P I FGLTLY FLG F+ AL IG   NYGR ILLR+LSER+
Sbjct: 203 DALKSVATTPDGG--SSPPPTIMFGLTLYEFLGGFSVALFIGCAANYGRLILLRILSERL 260

Query: 248 VARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXX 307
           VARLRS V+K TLHQD+EFFD +KVGDLISRLG+D+Y+VSRS+TQK+SDG K+++C    
Sbjct: 261 VARLRSVVMKHTLHQDSEFFDVHKVGDLISRLGADSYIVSRSITQKISDGVKSLICGGVG 320

Query: 308 XXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKT 367
                     LSS LV F   VV+SASIFGK+IR  S  LQ+ATGQLTRVSEEQLNGV+T
Sbjct: 321 IGMMLELSMDLSSVLVCFVIPVVLSASIFGKQIRINSRELQDATGQLTRVSEEQLNGVRT 380

Query: 368 VQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH 427
           VQSFVAEQ+EI+R+N++IR+I+++GK +A +N+KF TSTS++GD+SFL VL YGSYLVLH
Sbjct: 381 VQSFVAEQREIKRFNHSIREIFDVGKRAAFINAKFFTSTSLVGDLSFLTVLVYGSYLVLH 440

Query: 428 GSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKF 487
           GSLTIGDLTAFMLYT+YT N+IFGLS FYSEIMQG GAA RLF+LTDR+P IRPT+G+ +
Sbjct: 441 GSLTIGDLTAFMLYTEYTGNAIFGLSTFYSEIMQGAGAASRLFELTDRVPTIRPTLGKTY 500

Query: 488 IPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYN 547
            PG G IEF+N+ FAYPTRP NQ+FK+LNFKI+PG++VCIVGPSG+GKSTIALLLL YYN
Sbjct: 501 TPGKGEIEFKNVSFAYPTRPSNQIFKSLNFKIKPGSNVCIVGPSGKGKSTIALLLLHYYN 560

Query: 548 PSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVS 607
           P+SGQILID QDI KLN KSLR+ + +VQQEPVLMSG+IRDNITYGL  E T +EIR V+
Sbjct: 561 PTSGQILIDGQDITKLNSKSLRRQIAVVQQEPVLMSGTIRDNITYGLTEEPTKEEIRTVA 620

Query: 608 KQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE 667
           KQCFCHNFI KFP  Y+T IGPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVE
Sbjct: 621 KQCFCHNFIVKFPYTYDTYIGPHGTLLSGGQKQRIAIARALIKKPNILILDEATSALDVE 680

Query: 668 SEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTS 727
           SEGAINYTFG+LMKSKS+TIVSIAHRLSTIRRSE IIVLGNDGSVVE GKFKEL+ADPTS
Sbjct: 681 SEGAINYTFGQLMKSKSMTIVSIAHRLSTIRRSENIIVLGNDGSVVEMGKFKELFADPTS 740

Query: 728 ELSKLLNEKQSR 739
           ELSKLLNEK SR
Sbjct: 741 ELSKLLNEKSSR 752

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score =  867 bits (2240), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/654 (64%), Positives = 514/654 (78%), Gaps = 6/654 (0%)

Query: 147 ELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDAL-KNVMTDSPSSLETSD 205
           +  RL  +  RDW+           SC IGM+IPKVIGLVLD L K +      ++   D
Sbjct: 79  DAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDD 138

Query: 206 LPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAE 265
           L PIAFGLT+Y FLG FAG L++GT  N+ R ++LR+LSERVVARLRS V+ KTLHQD+E
Sbjct: 139 LGPIAFGLTIYQFLGVFAGLLLVGTAANFARIVMLRILSERVVARLRSGVMNKTLHQDSE 198

Query: 266 FFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIF 325
           F+D +KVGDLISRLGSDAYVVSRS+TQKVSDGFKA++C            P+LS  L+ F
Sbjct: 199 FYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFF 258

Query: 326 APAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAI 385
           AP ++ SAS+FGKKIR  S  LQEATGQLTRV+EEQL+GVKTVQSFVAEQ+E+ RYN AI
Sbjct: 259 APPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAI 318

Query: 386 RDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYT 445
           R IYN+G+ +A +N++F TST+++GDMSF+VVL YGSYLVL GSLTIGDLTAFMLYT+YT
Sbjct: 319 RGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYT 378

Query: 446 ANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPT 505
            +S+FGL+ FYSE+MQGVGAA RLFDLTD I +I PT G+K+IPG G IEF+N+ F+YPT
Sbjct: 379 GSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPT 438

Query: 506 RPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP 565
           RPENQ+FK++N K+ PG++VCIVGPSGRGKSTIALLLLRYYNP++GQIL+D QDI K+N 
Sbjct: 439 RPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNC 498

Query: 566 KSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYET 625
           K+LR+++G+VQQEP+LMSG+IRDNITYGL   AT +EIR V+KQCFCHNFITKFPD Y+T
Sbjct: 499 KTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDT 558

Query: 626 IIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSV 685
           +IG  G LLSGGQ+QRIAIARALIKKP IL+LDEATSALDVESEGAINYTFG+LMKS S+
Sbjct: 559 MIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSM 618

Query: 686 TIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEA 745
           TIVSIAHRLSTI+RSE +IVLG DGSV+E GKFKEL+A+P SEL KLL EK SR++  ++
Sbjct: 619 TIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDS 678

Query: 746 --PLPPQSXXXXXXXXXXXXTPASPPSLHNN---LVTDVLKEVSDDSSPLKIAP 794
             P PP +                 P    +    V ++ K+VS +  P+KI P
Sbjct: 679 LPPPPPNATQDKVVEQIAEKILERFPEAGQSPDATVKEIFKDVSSEGKPIKITP 732

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  869 bits (2246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/617 (68%), Positives = 502/617 (81%), Gaps = 14/617 (2%)

Query: 134 YSPRAEDE----KKGRSE---LARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLV 186
           YS + ++E    K+  SE   + RL+L+  RDWK           SCSIGM IPKVIGL+
Sbjct: 99  YSKKEKEEQSETKENHSEFRDIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLI 158

Query: 187 LDALKNVMTDS-----PSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLR 241
           LD LKN +  +     P S++   LPPI FGL+ Y FLG FA AL++G   NYGR ILLR
Sbjct: 159 LDQLKNALAANSVDGQPVSID--KLPPIVFGLSFYEFLGGFALALLVGIAANYGRIILLR 216

Query: 242 LLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAI 301
           +LSER+VARLR+ VIKKT+HQDAEFFD +KVGDLISRLGSDAYVVSRS+TQKVSDGFKA+
Sbjct: 217 VLSERLVARLRATVIKKTIHQDAEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKAL 276

Query: 302 LCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQ 361
           +C            PQLS  L++F P V++SAS+FGK+I   S  LQEATG LT+V+EEQ
Sbjct: 277 ICGSVGIGMMLALSPQLSCLLLVFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQ 336

Query: 362 LNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYG 421
           L+G+KTVQSFVAEQ+EI RYN AIRDI+NIGK +AV+N+KF +STS +GD+SFL VL +G
Sbjct: 337 LSGIKTVQSFVAEQREINRYNFAIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFG 396

Query: 422 SYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRP 481
           SYLVL  SLTIGDLTAFM+YT+YT NSIFGLS FYSEIMQG GAA RLF+LTDR+P+I  
Sbjct: 397 SYLVLQNSLTIGDLTAFMMYTEYTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSIST 456

Query: 482 TIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALL 541
           T G K+ PG+G IEF+N+ FAYPTRP N +FKNLNFKIE G++VCIVGPSGRGKST+ALL
Sbjct: 457 TKGVKYKPGNGEIEFKNVSFAYPTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALL 516

Query: 542 LLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPD 601
           L +YY PSSG+ILID Q+I  LN KSLR+++G+VQQEP+LMSG+IRDNI YGL    T D
Sbjct: 517 LEKYYKPSSGEILIDGQNINDLNSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKD 576

Query: 602 EIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEAT 661
           EIR+V+KQCFCHNFIT+F  +Y+T+IGPHGTLLSGGQKQRIAIARALIKKP+ILILDEAT
Sbjct: 577 EIRQVAKQCFCHNFITRFQSSYDTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEAT 636

Query: 662 SALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
           SALDVESEGAINYTFG+LMK K +TIVSIAHRLSTIRRSE +IVLG+DGSVVE GKFKEL
Sbjct: 637 SALDVESEGAINYTFGQLMKKKEMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKEL 696

Query: 722 YADPTSELSKLLNEKQS 738
           + DPTSELS+LLNEK +
Sbjct: 697 WDDPTSELSQLLNEKST 713

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score =  852 bits (2201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/592 (70%), Positives = 485/592 (81%), Gaps = 5/592 (0%)

Query: 147 ELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVMTDSPSSLETSDL 206
           ++ RL ++  RDWK           SCSIGM+IPKVIG+VLD LK     + S  +  DL
Sbjct: 104 DIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLK-----TSSGSDFFDL 158

Query: 207 PPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEF 266
               F L LY FL  F  AL+IG   N+GR+ILLR+LSERVVARLR++VIKKTLHQDAEF
Sbjct: 159 KIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIKKTLHQDAEF 218

Query: 267 FDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFA 326
           FD +KVGDLISRLGSDAYVVSRS+TQKVSDG KA++C            PQLS  L+ F 
Sbjct: 219 FDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFT 278

Query: 327 PAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIR 386
           P V+ SAS+FGK+IR+ S  LQEATGQLTRV+EEQL+G+KTVQSFVAE  E+ RYN AIR
Sbjct: 279 PPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338

Query: 387 DIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTA 446
           DI+ +GK +A  N+KF T+TS++GD+SFL VLAYGSYLVL   L+IGDLTAFMLYT+YT 
Sbjct: 339 DIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398

Query: 447 NSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTR 506
           N++FGLS FYSEIMQG GAA RLF+LTDR P+I PT+G K+ P  G IEF+++ F+YPTR
Sbjct: 399 NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFKDVSFSYPTR 458

Query: 507 PENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPK 566
           P  Q+FKNLNFKI PG+SVCIVGPSGRGKSTIALLLLRYYNP++G I IDNQDI KLN K
Sbjct: 459 PSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDNQDISKLNCK 518

Query: 567 SLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETI 626
           SLR+++GIVQQEPVLMSG+IRDNITYGL    T +EIR V+KQCFCHNFITKFP+ Y+T+
Sbjct: 519 SLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTV 578

Query: 627 IGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVT 686
           IGPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFG+LMKSKS+T
Sbjct: 579 IGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMT 638

Query: 687 IVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQS 738
           IVSIAHRLSTIRRSE +IVLG+DGSVVE GKFKELYA+PTS LS+LLNEK +
Sbjct: 639 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKAA 690

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/627 (67%), Positives = 500/627 (79%), Gaps = 20/627 (3%)

Query: 131 KTNYSPRAEDEKKGRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDAL 190
           K  Y  +++D K    ++ RL ++  RDWK           SCSIGM+IPKVIG+VLD L
Sbjct: 89  KPAYQSKSDDYK----DIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTL 144

Query: 191 KNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVAR 250
           K     + S  +  DL    F L LY FL  F  AL+IG + N+GR+ILLR+LSERVVAR
Sbjct: 145 K-----TSSGSDFFDLKIPIFSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVAR 199

Query: 251 LRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXX 310
           LR+HVIKKTLHQDAEFFD +KVGDLISRLGSDAYVVSRS+TQKVSDG KA++C       
Sbjct: 200 LRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGM 259

Query: 311 XXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQS 370
                PQLS  L+ F P V+ SAS+FGK+IR+ S  LQEATGQLTRV+EEQL+G+KTVQS
Sbjct: 260 MCSLSPQLSVLLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQS 319

Query: 371 FVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSL 430
           FVAE  E+ RYN AIRDI+ +GK +A  N+KF T+TS++GD+SFL VLAYGSYLVL   L
Sbjct: 320 FVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQL 379

Query: 431 TIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPG 490
           +IGDLTAFMLYT+YT N++FGLS FYSEIMQG GAA RLF+LTDR P+I PT+G K+ P 
Sbjct: 380 SIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPD 439

Query: 491 DGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSS 550
            G IEF+++ F+YPTRP  Q+FK+LNFKI PG+SVCIVGPSGRGKSTIALLLLRYYNP++
Sbjct: 440 RGVIEFKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTT 499

Query: 551 GQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQC 610
           G I+IDNQDI K+N KSLR+++GIVQQEPVLMSG+IRDNITYGL    T +EIR V+KQC
Sbjct: 500 GTIMIDNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQC 559

Query: 611 FCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEG 670
           FCHNFITKFP+ Y+T+IGP+GTLLSGGQKQRIAIARALIKKP +LILDEATSALDVESEG
Sbjct: 560 FCHNFITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEG 619

Query: 671 AINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELS 730
           AINYTFG+LMKSKS+TIVSIAHRLSTIRRSE +IVLG+DGSVVE GKFKELY++PTS LS
Sbjct: 620 AINYTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALS 679

Query: 731 KLLNEKQS-----------RANKKEAP 746
           +LLNE+ +           + N+KE P
Sbjct: 680 QLLNERTAPVPSEQQQQVEKDNEKEEP 706

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/590 (70%), Positives = 483/590 (81%), Gaps = 5/590 (0%)

Query: 147 ELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVMTDSPSSLETSDL 206
           ++ RL ++  RDWK           SCSIGM+IPKVIG+VLD LK     + S  +  DL
Sbjct: 104 DIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLK-----TSSGSDFFDL 158

Query: 207 PPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEF 266
               F L LY FL  F  AL+IG   N+GR+ILLR+LSERVVARLR+HVIKKTLHQDAEF
Sbjct: 159 KIPIFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEF 218

Query: 267 FDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFA 326
           FD +KVGDLISRLGSDAYVVSRS+TQKVSDG KA++C            PQLS  L+ F 
Sbjct: 219 FDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQLSILLLFFT 278

Query: 327 PAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIR 386
           P V+ SAS+FGK+IR+ S  LQEATGQLTRV+EEQL+G+KTVQSFVAE  E+ RYN AIR
Sbjct: 279 PPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338

Query: 387 DIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTA 446
           DI+ +GK +A  N+KF T+TS++GD+SFL VLAYGSYLVL   L+IGDLTAFMLYT+YT 
Sbjct: 339 DIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398

Query: 447 NSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTR 506
           N++FGLS FYSEIMQG GAA RLF+LTDR P+I PT+G K+ P  G IEF+++ F+YPTR
Sbjct: 399 NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFKDVSFSYPTR 458

Query: 507 PENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPK 566
           P  Q+FK+LNFKI PG+SVCIVGPSGRGKSTIALLLLRYYNP++G I+IDNQDI KLN K
Sbjct: 459 PSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDNQDITKLNCK 518

Query: 567 SLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETI 626
           SLR+ +GIVQQEPVLMSG+IRDNITYGL    T +EIR V+KQCFCHNFITKFP+ Y+T+
Sbjct: 519 SLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTV 578

Query: 627 IGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVT 686
           IGPHGTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFG+LMKSKS+T
Sbjct: 579 IGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGQLMKSKSMT 638

Query: 687 IVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEK 736
           IVSIAHRLSTIRRSE +IVLG+DGSVVE GKFKELYA+ TS LS+LLNE+
Sbjct: 639 IVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNER 688

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score =  842 bits (2175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/592 (69%), Positives = 482/592 (81%), Gaps = 5/592 (0%)

Query: 147 ELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVMTDSPSSLETSDL 206
           ++ RL ++  RDWK           SCSIGM+IPKVIG+VLD LK   T S S      +
Sbjct: 104 DIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLK---TSSGSDFFELKI 160

Query: 207 PPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEF 266
           P   F L LY FL  F  AL+IG   N+GR+ILLR+LSERVVARLR+HVIKKTLHQDAEF
Sbjct: 161 P--IFSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIKKTLHQDAEF 218

Query: 267 FDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFA 326
           FD +KVGDLISRLGSDAYVVSRS+TQKVSDG KA++C            PQLS  L+ F 
Sbjct: 219 FDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQLSILLLFFT 278

Query: 327 PAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIR 386
           P V+ SAS+FGK+IR+ S  LQEATGQLTRV+EEQL+G+KTVQSFVAE  E+ RYN AIR
Sbjct: 279 PPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNELSRYNVAIR 338

Query: 387 DIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTA 446
           DI+ +GK +A  N+KF T+TS++GD+SFL VLAYGSYLVL   L+IGDLTAFMLYT+YT 
Sbjct: 339 DIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTAFMLYTEYTG 398

Query: 447 NSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTR 506
           N++FGLS FYSEIMQG GAA RLF+LTDR P+I PT G K+ P  G +EF+++ F+YPTR
Sbjct: 399 NAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKPHRGVVEFKDVSFSYPTR 458

Query: 507 PENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPK 566
           P  Q+FKNLNFKI PG+SVCIVGPSGRGKSTIALLLLRYYNPS+G I+ID+QDI K+N K
Sbjct: 459 PSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPSTGTIMIDDQDITKMNCK 518

Query: 567 SLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETI 626
           SLR+++GIVQQEPVLMSG+IRDNITYGL    T +EIR V+KQCFCHNFITKFP+ Y+T+
Sbjct: 519 SLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITKFPNTYDTV 578

Query: 627 IGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVT 686
           IG  GTLLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYTFG LMKSKS+T
Sbjct: 579 IGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGHLMKSKSMT 638

Query: 687 IVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQS 738
           I+SIAHRLSTIRRSE +IVLG+DGSVVE GKFK+LYA+PTS LS+LLNE+ +
Sbjct: 639 IISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSALSQLLNERAA 690

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/613 (65%), Positives = 490/613 (79%), Gaps = 8/613 (1%)

Query: 139 EDEKK---GRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVMT 195
           EDE+    G  E+ RL  +   DWK           S  IGM+IPKVIG+VLDA+KN  +
Sbjct: 130 EDEESPNMGYKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAIKNTYS 189

Query: 196 DSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHV 255
            +   +   DLPPI   L++Y FLG FAGALVIGT+ N+GR +LLR+L E++VARLRS+V
Sbjct: 190 SATGPVGLDDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNV 249

Query: 256 IKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXX 315
           I+K +HQDAEFFD+NKVGDLISRL SDAYVVSRS+TQ VSDGFKAI+C            
Sbjct: 250 IRKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMVNIS 309

Query: 316 PQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQ 375
             L+S L++FAP ++I A I+GK+IR IS  LQE+TG LTRVSEEQL+GVKT+QSFVAE 
Sbjct: 310 ISLTSALLMFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEG 369

Query: 376 KEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDL 435
           KE++RYN AIR ++  GK  A+ N+ F +ST+V+GD+SFL+VLAYGS+LVL G LT+GDL
Sbjct: 370 KELQRYNTAIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDL 429

Query: 436 TAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIE 495
           TAFMLYT+YT +++FGLSNFYSE+M+G GAA RLF++TD  P+I+PT G+ ++PG G I 
Sbjct: 430 TAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKIS 489

Query: 496 FRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILI 555
           F+++ F+YPTRP NQ+F  LNF IEPG++VCIVGPSGRGKSTI  LLLRYYNPSSGQI I
Sbjct: 490 FKDVSFSYPTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITI 549

Query: 556 DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNF 615
           D+QDI +L+ KSLR+++G+VQQEP+LMSGSI+ N+TYGL+ E + DEIR V+K+CFCH F
Sbjct: 550 DDQDISRLSCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGF 609

Query: 616 ITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYT 675
           +TKFP+ Y+TIIGP G  LSGGQKQRIAIARAL+KKPKILILDEATSALDVESEGAINYT
Sbjct: 610 VTKFPNGYDTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYT 669

Query: 676 FGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNE 735
            GKLMKSK +TI+SIAHRLSTIRRSE +IVLGNDGSVVE GKFK+LYAD  SEL KLLN+
Sbjct: 670 LGKLMKSKELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLND 729

Query: 736 KQSRANKKEAPLP 748
           K     K++ P P
Sbjct: 730 K-----KRDKPTP 737

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/600 (65%), Positives = 479/600 (79%)

Query: 144 GRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVMTDSPSSLET 203
           G  E+ RL  +   DWK           SCSIGMA+PKVIG+VLD  KN +T      + 
Sbjct: 123 GYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDVAKNAITSDEKPKDL 182

Query: 204 SDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQD 263
            DLPP+ +GL LY FL  FAGALV+ T  N+GR +LLR+L E++VARLRS+VIKKT+HQD
Sbjct: 183 RDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLVARLRSNVIKKTIHQD 242

Query: 264 AEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLV 323
           AEFFD+NKVGDLISRL SDAYVVSRS+TQ +SDGFKAI+C              L++ L 
Sbjct: 243 AEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGIGMMFHISSTLATALF 302

Query: 324 IFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNN 383
           +FAP +++ A+I+G+KIR IS  LQ++TG LT+V+EEQL+GVKTVQSFVAEQKEI+RYN+
Sbjct: 303 LFAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTVQSFVAEQKEIKRYNH 362

Query: 384 AIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTD 443
           AIR ++++GK  A+ N+ F +STSV+GD SFL+VLAYGS+LVL GSL+IGDLTAFMLYT+
Sbjct: 363 AIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQGSLSIGDLTAFMLYTE 422

Query: 444 YTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAY 503
           Y+ +++FGLSNFYSE+M+G GAA RLF+LTD  P+I  T G  ++PG G I+F N+ F+Y
Sbjct: 423 YSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYVPGKGEIKFENVSFSY 482

Query: 504 PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKL 563
           PTR  NQ+F NLNF I+ G++VC+VGPSGRGKSTIA LLL+YYNP+SG+I ID QDI K+
Sbjct: 483 PTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNPTSGRITIDGQDISKI 542

Query: 564 NPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAY 623
           + KSLR+++G+VQQEP+LMSGSIRDNITYG+    T DEIR VSK+CFCHNFITKF D Y
Sbjct: 543 SAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSKKCFCHNFITKFSDGY 602

Query: 624 ETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSK 683
           ET+IGP G LLSGGQKQRIAIARALIKKP ILILDEATSALDVESEGAINYT G+LMKS+
Sbjct: 603 ETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTLGQLMKSR 662

Query: 684 SVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKK 743
            +TI+SIAHRLSTIRRSE +IVLG+DGSVVE GKFKELYA   S+L KLLNEK      K
Sbjct: 663 DITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESKLYKLLNEKAKDTTSK 722

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  805 bits (2079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/607 (63%), Positives = 478/607 (78%)

Query: 131 KTNYSPRAEDEKKGRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDAL 190
           K N     E  K    E+ RL+ +   DWK           S ++GM IPKVIG+VLDA+
Sbjct: 92  KANNESTEEKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAV 151

Query: 191 KNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVAR 250
           KN        +   DLPPI +GL ++ FL  FAG LV GT+ N+GR +LLR+L E++VAR
Sbjct: 152 KNASGGFSGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVAR 211

Query: 251 LRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXX 310
           LRS+VIKK +HQDAEFFD+NKVGDLISRL SDAYVVSRS+TQ VSDGFKAI+C       
Sbjct: 212 LRSNVIKKIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGM 271

Query: 311 XXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQS 370
                  L+S L +FAP +++ A I+GKKIR IS  LQE+TG LT+VSEEQL+GVKT+Q+
Sbjct: 272 MINISASLTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQA 331

Query: 371 FVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSL 430
           FVAE KE+ RYNNAIR +++ GK  A+ N+ F +ST ++GD+SFL+VLAYGS+LVL G L
Sbjct: 332 FVAEGKELHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGL 391

Query: 431 TIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPG 490
           ++GDLTAFMLYT+YT +++FGLSNFYSE+M+G GAA RLF++TD    I+P+ G+ ++P 
Sbjct: 392 SVGDLTAFMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPS 451

Query: 491 DGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSS 550
            G I+F ++ F+YPTRP NQ+F  LNF IEPG++VC+VGPSGRGKSTIA LLLRYY+P+S
Sbjct: 452 WGEIKFEDVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNS 511

Query: 551 GQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQC 610
           G+I+ID Q+I KL+ KSLR+++G+VQQEP+LMSGSIR N+TYG+  E T DEIR V+K+C
Sbjct: 512 GRIMIDGQNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKC 571

Query: 611 FCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEG 670
           FCH FITKFP+ YET+IGP G  LSGGQKQRIAIARALIKKPKILILDEATSALDVESEG
Sbjct: 572 FCHGFITKFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEG 631

Query: 671 AINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELS 730
           AINYT G+LM+S+ +TI+SIAHRLSTIRRSE +IVLGNDGSVVE GKFKELYA+  SEL 
Sbjct: 632 AINYTLGRLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELF 691

Query: 731 KLLNEKQ 737
           KLLN+K+
Sbjct: 692 KLLNDKK 698

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  793 bits (2049), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/603 (62%), Positives = 475/603 (78%), Gaps = 11/603 (1%)

Query: 144 GRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVMT-------- 195
           G +++ RL  +   DWK           SC+IGMA+PKVIGLVLDA KN ++        
Sbjct: 111 GLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATKNALSGSNTNNGN 170

Query: 196 ---DSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLR 252
              +   SL   DLPPI   + LY F   F GAL+IGTM N+GR +LL++L ER+VARLR
Sbjct: 171 GGLEDSKSLTLDDLPPIVGDIQLYDFFLLFGGALLIGTMANFGRVVLLKILGERLVARLR 230

Query: 253 SHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXX 312
           S+VIKKT+H D EF+D+NKVGDL+SRLG+DAY+VSRS+TQ +SDGFKA++C         
Sbjct: 231 SNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKALICGGVGIGMMF 290

Query: 313 XXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFV 372
                L+S L +FAP +++ A+I+G KIR IS  LQ+A+G LT+V+EEQL+G+KTVQSFV
Sbjct: 291 HISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEEQLSGIKTVQSFV 350

Query: 373 AEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTI 432
           AE KE+ RYNNA+R ++N+GK  A  N+ F +ST+V+GD SFL+VLAYGS+LVL G+LTI
Sbjct: 351 AEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAYGSHLVLQGNLTI 410

Query: 433 GDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDG 492
           GDLTAFMLYT+YT +++FGLS FYSE+M+G GAA RLF+L D  P I+ T G+ F P +G
Sbjct: 411 GDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIKSTTGKAFKPLNG 470

Query: 493 CIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQ 552
            +EF+++ F+YPTR  NQ+FK+LNF IEPG++VCIVGPSGRGKSTIA LLLRYYNP+SG+
Sbjct: 471 KVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIASLLLRYYNPTSGK 530

Query: 553 ILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFC 612
           IL+D QDI KL+ KSLR+ +G+VQQEP+LMSG+IR+NITYG+ R+ + +EIR V+K+CFC
Sbjct: 531 ILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSMEEIRSVAKKCFC 590

Query: 613 HNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI 672
           H FI+KFP+ YETIIGP G LLSGGQKQRIAIARAL+ KPKILILDEATSALDVESEGAI
Sbjct: 591 HAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEATSALDVESEGAI 650

Query: 673 NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKL 732
           NYT G+LMKSK +TI+SIAHRLSTIRRSE +IVLG DGSVVE GKFK+LYA+  S L KL
Sbjct: 651 NYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKDLYANHDSALHKL 710

Query: 733 LNE 735
           L E
Sbjct: 711 LTE 713

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/623 (62%), Positives = 481/623 (77%), Gaps = 11/623 (1%)

Query: 137 RAEDEK-KGRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVM- 194
           RA+  K  G  E+ RL+ +   DWK           SCSIGMA+PKVIGLVLDA K+ + 
Sbjct: 94  RAQPAKPAGWHEVFRLLRLVKPDWKLLLAALGLLTISCSIGMAVPKVIGLVLDATKDAVA 153

Query: 195 ------TDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVV 248
                 T +P SL   D+P I    TL   L AFAGAL++G+  N+GR  LL++L ER+V
Sbjct: 154 QAEKNETGAPMSL--LDMPSIIGNFTLVDVLAAFAGALLVGSAANFGRMFLLKMLGERLV 211

Query: 249 ARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXX 308
           ARLR+ VIKKTLH DAEFFD+NKVGDLISRLGSDAY+VSRS+T  +SDG KA LC     
Sbjct: 212 ARLRAQVIKKTLHHDAEFFDRNKVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGV 271

Query: 309 XXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTV 368
                    L+S +++FAP ++I+A+I+GK+IR IS  LQ++TG LTRVSEEQ NG+KT+
Sbjct: 272 GMMFHISSTLTSAMIMFAPPLLIAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTI 331

Query: 369 QSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHG 428
           +SFVAE KE+RRYN A+R ++N+ K   + ++ F + T+V+GD+SFL+VLAYGS+LVL G
Sbjct: 332 KSFVAEGKEMRRYNTAVRRLFNVAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQG 391

Query: 429 SLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFI 488
            L++G LTAFMLYT+YT +S+FGLSNFYSE+M+G GAA RLF+LTD   ++  T+G+ F+
Sbjct: 392 ELSLGSLTAFMLYTEYTGSSVFGLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFV 451

Query: 489 PGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNP 548
           P DG IEF+++ F+YPTRP +Q+FK L   I PG++VCIVGPSGRGKSTIA LLLR+Y+ 
Sbjct: 452 PRDGRIEFKDVSFSYPTRPTSQIFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDA 511

Query: 549 SSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSK 608
           +SG ILID QDI K++ KSLR+++G+VQQEPVLMSG+IRDNITYGL    + DEIR V+K
Sbjct: 512 NSGTILIDGQDISKVSAKSLRKHLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAK 571

Query: 609 QCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
           +CFCHNFITKFPD Y+T+IGP G LLSGGQ+QRIAIARALIKKPKILILDEATSALDVES
Sbjct: 572 KCFCHNFITKFPDGYDTVIGPRGALLSGGQRQRIAIARALIKKPKILILDEATSALDVES 631

Query: 669 EGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSE 728
           EGAINYT G+LM+SK +TIVSIAHRLSTIRRSE I+VLGNDGSV+E GKF +LY D  SE
Sbjct: 632 EGAINYTLGRLMRSKEITIVSIAHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSE 691

Query: 729 LSKLLNEKQSRANKKEA-PLPPQ 750
           L KLLNE  S   K EA P P Q
Sbjct: 692 LFKLLNEHASEPAKPEASPAPAQ 714

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/674 (57%), Positives = 487/674 (72%), Gaps = 23/674 (3%)

Query: 144 GRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVMTDS----PS 199
           G  E+ RL  +   DWK           SC+IGMA+PKVIGLVLDA KN +  S      
Sbjct: 96  GWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKSSYEKGSQ 155

Query: 200 SLETSD----------------LPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLL 243
            LE  +                LPPI   L++  F+G FAGALV+G   N+GR +LL+++
Sbjct: 156 DLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGRVVLLKII 215

Query: 244 SERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILC 303
            ER+V+RLRS VIK+T+H D EFFD+NKVGDLISR GSDAYVVSRS+TQ VSDGFKAI+C
Sbjct: 216 GERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSDGFKAIIC 275

Query: 304 XXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLN 363
                         L+S +++FAP +++ A I+GKKI  IS  LQ+++G LTRV+EEQLN
Sbjct: 276 GGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTRVAEEQLN 335

Query: 364 GVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSY 423
           G++T++SFVAE+KEIRRYN+AIR ++ +GK  A  N+ F +ST+++GDMSF++VL YG+ 
Sbjct: 336 GIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREAFTNATFFSSTTILGDMSFVIVLLYGAN 395

Query: 424 LVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTI 483
           LVL G+L+IGDLTAFMLYT+YT +S+FGLS FYSE+M+G GAA RLF+L D   ++R  I
Sbjct: 396 LVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHKNSVRSNI 455

Query: 484 GEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLL 543
                P  G IEFR++ F+YPTRP NQ+FK+++F IEPG++VCIVGPSG+GKSTI  LLL
Sbjct: 456 SHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKSTITSLLL 515

Query: 544 RYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEI 603
           R+Y+P+ G ILIDN DI K   KSLR+++G+VQQEP LMSG+IRDNITYGL    T DEI
Sbjct: 516 RFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSYTPTMDEI 575

Query: 604 REVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSA 663
           R VSKQCFCH FITKFPD Y+T+IGP G  LSGGQ+QRIAIARALIKKPKILILDEATSA
Sbjct: 576 RVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILILDEATSA 635

Query: 664 LDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYA 723
           LDVESEGAINYT G LM+SK +TI+SIAHRLSTIRRSE IIV+GNDGSVVE GKF +LY 
Sbjct: 636 LDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVGKFDKLYR 695

Query: 724 DPTSELSKLLNEK-QSRANKKE--APLPPQSXXXXXXXXXXXXTPASPPSLHNNLVTDVL 780
           +  SEL KLLNEK     +K E  + +PP S                  S+++ +V +VL
Sbjct: 696 NEESELFKLLNEKDHDLVSKSENTSDIPPDSPKNDDASGLEHLVAEDVASINDKVVKNVL 755

Query: 781 KEVSDDSSPLKIAP 794
            +++ D +   + P
Sbjct: 756 NDITHDKNSSTLRP 769

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/667 (59%), Positives = 483/667 (72%), Gaps = 19/667 (2%)

Query: 136 PRAEDEKKGRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVMT 195
           P+ EDE   + ++ RL L+   DWK           SC IGM IPKVIG VLD+LK++  
Sbjct: 80  PKPEDEGTYK-DIWRLFLLVKSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSLKDIQG 138

Query: 196 DSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHV 255
              S L   D+       +L  F    +G L++G   NY R ILLR+LSE +VA+LR++V
Sbjct: 139 KEFSELMIWDM-------SLKHFFYGLSGLLLLGCGANYVRVILLRILSENLVAKLRANV 191

Query: 256 IKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXX 315
           IK  +HQDA+FFD  KVGDLISR+G+DA++VSRS+TQK+SDG KA+              
Sbjct: 192 IKHIIHQDAQFFDTYKVGDLISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMLSIS 251

Query: 316 PQLS-SFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAE 374
             LS S L++    +++SA +FGK+IRD S  LQE T  LTRVSEEQ NG+KT+QSFVAE
Sbjct: 252 IPLSCSILILMGSPLLLSAKVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAE 311

Query: 375 QKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGD 434
           Q E+ ++N +IR I+ +GK +A +N+KF T+ S+IGD+SFLVVL+YGS+LV    L++GD
Sbjct: 312 QSEMHKFNGSIRKIFAVGKEAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGD 371

Query: 435 LTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGC- 493
           LTAFMLYT+YT N+IF LS F+SEIMQG GAA R+F+LTD  P I PT G KFIP  G  
Sbjct: 372 LTAFMLYTEYTGNAIFNLSGFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGE 431

Query: 494 IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI 553
           IEF+N+ F YPTRP   +F+NLNFKIE G++VCIVGPSG+GKSTIA LLL YYNPS GQI
Sbjct: 432 IEFKNVSFNYPTRPTVPIFRNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQI 491

Query: 554 LIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCH 613
           LID QDI  L+ KSLR+++GIVQQEP+LMSG+IRDNITYGL    T +EIR V+KQCFCH
Sbjct: 492 LIDGQDISALSTKSLRRHIGIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCH 551

Query: 614 NFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAIN 673
           NFIT+FPD Y+T IGPHGTLLSGGQKQRIAIARALIKKP +LILDEATSALDVESEGAIN
Sbjct: 552 NFITRFPDTYDTAIGPHGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAIN 611

Query: 674 YTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLL 733
           YTFG+LMKSKS+TIVSIAHRLSTIRRSE +IVLGNDGSVVE GKFKEL+A+P SELSKLL
Sbjct: 612 YTFGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGNDGSVVEQGKFKELFANPASELSKLL 671

Query: 734 NEKQSRANKKEAPLPPQSXXXXXXXXXXXXTPASPPS--------LHNNLVTDVLKEVSD 785
            EK S  N     + PQ               A+P S             + +VLK++S 
Sbjct: 672 REKSS-GNNAAPEIQPQEISQTIEEDPSFSGEATPASSVTGFKAETEAETINEVLKDIST 730

Query: 786 DSSPLKI 792
           +  PLKI
Sbjct: 731 EGKPLKI 737

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/704 (54%), Positives = 482/704 (68%), Gaps = 47/704 (6%)

Query: 131 KTNYSPR---------------AEDEKKGRSELARLVLMTLRDWKXXXXXXXXXXXSCSI 175
           +TN+ PR               + D      +L RL ++  +D K           SCSI
Sbjct: 54  RTNFIPRTLPQFLVPHRTLKTASTDNGSSWRDLKRLTVLIKKDIKLLVLAIVLLTISCSI 113

Query: 176 GMAIPKVIGLVLDALKNVMTD--SPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCN 233
           GMAIPK+IG +LD L+N   +  S S ++  ++P       L  FL      L+ G   N
Sbjct: 114 GMAIPKIIGTILDTLRNNYENLTSLSQIKILNIP-------LSTFLMGVGITLIFGCFAN 166

Query: 234 YGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQK 293
           +GR ++LR++SER+V+RLRS V+K  +H+D EFFD  KVGDL+SR+G+DA+VVSRS+T K
Sbjct: 167 FGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSITHK 226

Query: 294 VSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQ 353
           V+DG ++                +L+  L    P ++   S+FGK+IR  S  LQ+ TG 
Sbjct: 227 VADGVRSGFIGIFGIGLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVTGD 286

Query: 354 LTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMS 413
           LTRV+EEQ NG++TVQ FVAE+ EI+R+NN +R+I+ +GK SA +N KF TS S+IGD+ 
Sbjct: 287 LTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGDLG 346

Query: 414 FLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLT 473
           FL+VL YGSYLV+HGS++IGDLTAFMLYT+YT N+IFGLS+FYSE+MQGVGAA R+F++ 
Sbjct: 347 FLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFEIN 406

Query: 474 DRIPAIRPTIGE-KFIPGD---GC-IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIV 528
           D+ P I+ T GE KF P +   GC IEF+N+ F YPTRP NQ+FKNLNFK+  G++VCIV
Sbjct: 407 DKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVCIV 466

Query: 529 GPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRD 588
           GPSGRGKSTIA LLL +YN  SGQILID QDI  LN KSLR+ +GIVQQEP+LMSG+IRD
Sbjct: 467 GPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTIRD 526

Query: 589 NITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGG--QKQRIAIAR 646
           NITYGL  E + +EIR V+KQCFCHNFITKFPD Y+T IG   +  S    QKQRIAIAR
Sbjct: 527 NITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDTTIGSGSSGTSLSGGQKQRIAIAR 586

Query: 647 ALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVL 706
           ALIKKP ILILDEATSALDVESEGAINYTFG++MKSKS+TIVSIAHRLSTIRR E +IVL
Sbjct: 587 ALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVIVL 646

Query: 707 GNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEAPLPP--------------QSX 752
           GNDGSVVE GKFKELY +PTSELSKLLNEK S       P+ P              ++ 
Sbjct: 647 GNDGSVVEMGKFKELYDNPTSELSKLLNEKSSTKEATPQPVNPPPFIDLQTNPEEKKEAD 706

Query: 753 XXXXXXXXXXXTPASPPSLHNNLVT--DVLKEVSDDSSPLKIAP 794
                            S+ +N+ +  D LKE  ++  P+KI P
Sbjct: 707 NASEENGAKLDDSKEDVSVPDNMTSSDDSLKEAVNEGGPIKITP 750

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  520 bits (1339), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 278/619 (44%), Positives = 388/619 (62%), Gaps = 37/619 (5%)

Query: 172 SCSIGMAIPKVIGLVLDALKNVMTDSPSSL---------ETSDLPPIAFGLTLYPFLGAF 222
           S ++ M +P VIG +LD   N   D              E  D   I +G T   F    
Sbjct: 120 SSTVSMVVPSVIGKLLDLSSNTSNDDTGDAKSKEKVDNKEDRDNNTI-YGFTHTQFFAGL 178

Query: 223 AGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSD 282
               VIG + N GR ++L++  E++VARLR+  +K  L QDA F D N+VGDLISRL SD
Sbjct: 179 GIVFVIGAIANTGRIVILKVTGEKLVARLRTRTMKAALDQDATFLDSNRVGDLISRLSSD 238

Query: 283 AYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRD 342
           A +V++S+T  VSDG +AIL              +L+S +V+  P + I A ++GKKIR+
Sbjct: 239 ASIVAKSVTMNVSDGTRAILQGFVGFSMMSYISFKLTSVMVLLIPPLGIMALVYGKKIRN 298

Query: 343 ISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKF 402
           +S  LQ A G LT+V+EEQLN  KT+Q++  E+KEIRRY + +RD++++G   A+ +  F
Sbjct: 299 LSRQLQTAVGGLTKVAEEQLNATKTIQAYGGEKKEIRRYASEVRDVFDVGLKEAITSGIF 358

Query: 403 STSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQG 462
             ST ++G+ + L +L  G+ ++  GSLT+GDL++FM+Y  YT +S+FGLS+FYSE+M+G
Sbjct: 359 FGSTGLVGNAALLSLLLVGTNMISSGSLTVGDLSSFMMYAVYTGSSLFGLSSFYSELMKG 418

Query: 463 VGAAKRLFDLTDRIPAIRPTIGEKFIPGDG-CIEFRNLGFAYPTRPENQVFKNLNFKIEP 521
            GAA R+F+L DR P I+PTIG+  +   G  I F+++ F YPTRP ++VF  ++FKIEP
Sbjct: 419 AGAAARVFELDDRKPLIKPTIGKDPVTLKGKAIIFQDVSFHYPTRPNHRVFNKISFKIEP 478

Query: 522 GTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVL 581
           G  +C VGPSG GKST++ LLLRYY+ + G ILI   +I  L+ +  R+ +G+VQQEP+L
Sbjct: 479 GEHICFVGPSGSGKSTVSQLLLRYYDATEGNILIGEDNIKSLSLRKYRKLLGVVQQEPML 538

Query: 582 MSGSIRDNITYGLKREATPDEIREVS-------KQCFCHNFITKFPDAYETIIGPHGTLL 634
            +G+I DNI Y +     PDEI           K+  C  F+  FPD   TI+GP GT L
Sbjct: 539 FNGTIIDNILYNV-----PDEIASQKNKVDLAIKKSNCTKFLANFPDGLNTIVGPRGTQL 593

Query: 635 SGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRL 694
           SGGQKQRIAIAR+ +  P IL+LDEATSALD +SE  I  T  K  +++ +T +SIAHRL
Sbjct: 594 SGGQKQRIAIARSFLLDPSILLLDEATSALDTQSEDIIAMTLKK-REAEGLTTISIAHRL 652

Query: 695 STIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEAPLPPQSXXX 754
           STI+ S  ++VL  +GSVVETGKF EL A+PTSEL+ LL+++        A +  +    
Sbjct: 653 STIKYSSRVVVLNKNGSVVETGKFTELIANPTSELNLLLSKEGQEPAYVAADVAAE---- 708

Query: 755 XXXXXXXXXTPASPPSLHN 773
                    TPA  PS  N
Sbjct: 709 ---------TPAEAPSTDN 718

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  515 bits (1327), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 264/581 (45%), Positives = 376/581 (64%), Gaps = 11/581 (1%)

Query: 172 SCSIGMAIPKVIGLVLDALKNVMTD-------SPSSLETSDLPPIAFGLTLYPFLGAFAG 224
           S ++ M +P VIG +LD  K    D       S    E  D     +GLT   F  A   
Sbjct: 124 SSAVSMVVPSVIGKLLDIAKPPSADEENGKGVSEKLKEKEDEDKKIYGLTALQFYTALGV 183

Query: 225 ALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAY 284
              +G + N GR I+L++  ER+VARLR+  +K  L Q+A F D NKVGDLISRL +DA 
Sbjct: 184 VFTVGALANTGRIIILKVTGERLVARLRTRTMKAALEQEAAFLDSNKVGDLISRLSTDAS 243

Query: 285 VVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDIS 344
           +V++S+TQ VSDG +AIL              QL+S +++  P +   A I+G+KIR++S
Sbjct: 244 IVAKSVTQNVSDGTRAILQGFVGFGMMSYISWQLTSVMLLLIPPLGAMAIIYGRKIRNLS 303

Query: 345 TILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFST 404
             LQ + G LT+V+EEQLN  +T+Q++  E+KEI RY   +R++++IG   AV +  F  
Sbjct: 304 RQLQTSVGGLTKVAEEQLNATRTIQAYGGEKKEIHRYATEVRNVFDIGYKEAVTSGLFFG 363

Query: 405 STSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVG 464
           ST ++G+ + L +L  G+ ++  G+LT+G+L++FM+Y  YT +S+FGLS FYSE+M+G G
Sbjct: 364 STGLVGNTALLSLLVVGTNMISSGALTVGELSSFMMYAVYTGSSLFGLSTFYSELMKGAG 423

Query: 465 AAKRLFDLTDRIPAIRPTIGEKFIPGDG-CIEFRNLGFAYPTRPENQVFKNLNFKIEPGT 523
           AA R+F+L+DR PAI+PTIG+  I   G  +EF+N+ F YPTRP+ Q+F++ + KIEPG 
Sbjct: 424 AAARVFELSDRKPAIKPTIGKDPITLFGKTVEFKNVSFWYPTRPKQQIFQDFSIKIEPGE 483

Query: 524 SVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMS 583
            VC VGPSG GKST++ LLLRYY+ + G IL+  +DI   + +  R+ +G+VQQEP+L +
Sbjct: 484 HVCFVGPSGSGKSTVSSLLLRYYDVAKGSILVGGEDIKNFSLRKYRRLLGVVQQEPMLFN 543

Query: 584 GSIRDNITYGLKREAT--PDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQR 641
           G+I +NI Y +  E    P  I    +   C  F+  FPD   T++GP GT LSGGQKQR
Sbjct: 544 GTILENILYSVPEEIANEPGRIERAIESANCSKFLNNFPDGLNTLVGPRGTQLSGGQKQR 603

Query: 642 IAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSE 701
           IA+AR  +  P ILILDEATSALD +SE  I     +    K  T +SIAHRLSTI+ S 
Sbjct: 604 IALARTFLLDPSILILDEATSALDSQSEDIIAQNL-QARNEKGQTTISIAHRLSTIKHSS 662

Query: 702 YIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANK 742
            ++VLG +G VVETG F+EL ++P+S L+ LL +++S AN+
Sbjct: 663 RVVVLGKNGCVVETGTFQELISNPSSGLNILLTQEESSANE 703

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  512 bits (1318), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 265/615 (43%), Positives = 393/615 (63%), Gaps = 11/615 (1%)

Query: 139 EDEKKGRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVMTDSP 198
           + +  G  ++ RL L+   + +           S ++ MA+P VIG +LD  +       
Sbjct: 77  DSKASGWQDIKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVIGKLLDIAREEHEQPE 136

Query: 199 SSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKK 258
           +  ET     + FGLT   F  A  G  V+G + N GR ++L++  ER+VARLR+  +K 
Sbjct: 137 TEKET-----MIFGLTSTQFYTALGGVFVVGALANVGRIVILKVTGERLVARLRTRTMKA 191

Query: 259 TLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQL 318
            L QDA F D N+VGDLISRL SDA +VS+S+TQ +SDG +A++              +L
Sbjct: 192 ALEQDATFLDHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFVGFGMMSFISWKL 251

Query: 319 SSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEI 378
           +  +++ AP + + A ++GK+IR++S  LQ + G+LT+VSEEQL+  KT+Q++  E+KEI
Sbjct: 252 TCVMMLLAPPLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATKTIQAYCGEKKEI 311

Query: 379 RRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAF 438
            RY + +R ++++G   A+ +  F   T  +G+++ L +L  G+ ++  G +T+GDL++F
Sbjct: 312 HRYADEVRKVFHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIKTGLMTVGDLSSF 371

Query: 439 MLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIP-GDGCIEFR 497
           M+Y  YT +S+FGLS+FYSE+M+G GAA R+F+L DR P I PTIG+  +   +  I F 
Sbjct: 372 MMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPVTLENKSIHFN 431

Query: 498 NLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDN 557
           ++ F+YPTRP++ +F++LNF + PG  VCIVGPSG GKST+A LLLRYY+  SG+I + N
Sbjct: 432 HVKFSYPTRPQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLGN 491

Query: 558 QDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSK---QCFCHN 614
            +I   N +  R+ +G+VQQEP+L SG+I DNITY + +E   DE R +S+   Q  C  
Sbjct: 492 DNIRDFNLRKYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDETR-ISRAIGQANCTK 550

Query: 615 FITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINY 674
           F+  FPD  +T +GP GT LSGGQKQRIA+ARA +  P ILILDEATSALD +SE  +  
Sbjct: 551 FLANFPDGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQ 610

Query: 675 TFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLN 734
           +  +   ++  T +SIAHR+STI+ S  +IVL   G+V ETG F +L A P S L+KLL+
Sbjct: 611 SLQQ-RSARGKTTISIAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAIPDSSLNKLLS 669

Query: 735 EKQSRANKKEAPLPP 749
           ++Q    +   P  P
Sbjct: 670 KEQEVEEESHEPHDP 684

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  510 bits (1314), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 272/618 (44%), Positives = 388/618 (62%), Gaps = 20/618 (3%)

Query: 139 EDEKKGRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVM---- 194
           + +  G  ++ RL L+   +             S ++ M IP VIG +LDA K       
Sbjct: 96  DSKASGFKDIKRLFLLAKPETNSMILALVFILISGAVSMTIPSVIGKLLDAAKEGHLAGV 155

Query: 195 ---------TDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSE 245
                    +DS  + E S    + +GLT   F  A     V+G   N GR +LL++  E
Sbjct: 156 SASGEGVGSSDSSDNQEDSS-DRLIYGLTFPQFYTALGTIFVVGAFANMGRIVLLKVTGE 214

Query: 246 RVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXX 305
           ++VARLR+  +K  L QDA F D N+VGDLISRL SDA +VS+S+TQ +SDG +A++   
Sbjct: 215 KLVARLRTRTMKAALQQDATFLDNNRVGDLISRLSSDASIVSKSVTQNLSDGARAVIQGA 274

Query: 306 XXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGV 365
                      +L+  + + AP + + A ++GKKIR++S  LQ + G LT+V+EEQL+  
Sbjct: 275 VGFGMMSFISWKLTCVMTLMAPPLAVMAMVYGKKIRNLSRQLQTSVGGLTKVAEEQLSAA 334

Query: 366 KTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLV 425
           +TVQ++  E++EIRRY   +R+++NIG   A+ +  F   T  +G+++ L +L  G+ ++
Sbjct: 335 RTVQAYGGEKQEIRRYAGEVRNVFNIGLKEALTSGVFFGVTGFVGNVALLALLLTGTSMI 394

Query: 426 LHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGE 485
             G++T+GDL++FM+Y  YT +S+FGLS+FYSE+M+G GAA R+F+L DR P I PT G 
Sbjct: 395 RSGAITVGDLSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTKGV 454

Query: 486 KFIPGDG-CIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLR 544
             +   G  IEFRN+ FAYPTR EN++F  L+  I+PG  VCIVGPSG GKSTIA LLLR
Sbjct: 455 DPVTLQGKTIEFRNVAFAYPTRRENRIFDGLSLDIQPGEHVCIVGPSGGGKSTIASLLLR 514

Query: 545 YYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIR 604
           YY+  +G+I I  QDI + N +  R+ +G+VQQEP+L +G+I DNITY +  E   D+ R
Sbjct: 515 YYDVDAGRIAIGGQDIRRFNLRKYRRLLGVVQQEPLLFNGTILDNITYAVPGELAGDDSR 574

Query: 605 EVSK---QCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEAT 661
            VS+   Q  C  F+  FPD  ET++GP G  +SGGQKQRIA+ARA +  P +LILDEAT
Sbjct: 575 -VSRAIGQANCTKFLANFPDGLETLVGPRGAQMSGGQKQRIALARAFLLDPAVLILDEAT 633

Query: 662 SALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
           SALD +SE  +  +  +    +  T VSIAHRLSTI+ S  +IVL   G V ETG F+EL
Sbjct: 634 SALDSQSEEVVAQSL-RSRSRRGKTTVSIAHRLSTIQHSSRVIVLDRHGGVGETGSFREL 692

Query: 722 YADPTSELSKLLNEKQSR 739
            +DP S L++LL +++ R
Sbjct: 693 ISDPDSHLTQLLLKEEER 710

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  509 bits (1311), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 269/608 (44%), Positives = 384/608 (63%), Gaps = 8/608 (1%)

Query: 138 AEDEKKGRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVMTDS 197
           A  +  G  ++ RL +++  + K           S S+ MA+P VIG +LD    + ++S
Sbjct: 79  ANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLD----LASES 134

Query: 198 PSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIK 257
               E        +G T   F  A     +IG + N  R I+L++  ER+VARLR+  +K
Sbjct: 135 DGEDEEGSKSNKLYGFTKKQFFTALGAVFIIGAVANASRIIILKVTGERLVARLRTRTMK 194

Query: 258 KTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQ 317
             L QDA F D N+VGDLISRL SDA +V++S+TQ VSDG +AI+              +
Sbjct: 195 AALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWK 254

Query: 318 LSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKE 377
           L+  ++I AP +   A I+G+KIR++S  LQ + G LT+V+EEQLN  +T+Q++  E+ E
Sbjct: 255 LTCVMMILAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNE 314

Query: 378 IRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTA 437
           +RRY   +R++++IG   AV +  F  ST ++G+ + L +L  G+ ++  GS+T+G+L++
Sbjct: 315 VRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSS 374

Query: 438 FMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIP-GDGCIEF 496
           FM+Y  YT +S+FGLS+FYSE+M+G GAA R+F+L DR P IRPTIG+  +      I F
Sbjct: 375 FMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKPIVF 434

Query: 497 RNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILID 556
           +N+ F YPTRP++Q+FK+LN  I+PG  VC VGPSG GKSTIA LLLRYY+ +SG I   
Sbjct: 435 KNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFG 494

Query: 557 NQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATP--DEIREVSKQCFCHN 614
           ++DI   N +  R+ +G VQQEP+L +G+I DNI Y +  E     D IR    +  C  
Sbjct: 495 DEDIRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRRAIGKANCTK 554

Query: 615 FITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINY 674
           F+  FPD  +T++G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +  
Sbjct: 555 FLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAK 614

Query: 675 TFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLN 734
              + ++ +  T +SIAHRLSTI+ S  +IVLG  GSVVETG F++L A P SEL+ LL 
Sbjct: 615 NLQRRVE-RGFTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDLIAIPNSELNALLA 673

Query: 735 EKQSRANK 742
           E+Q    K
Sbjct: 674 EQQDEEGK 681

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  504 bits (1299), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 258/569 (45%), Positives = 369/569 (64%), Gaps = 6/569 (1%)

Query: 172 SCSIGMAIPKVIGLVLDALKNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTM 231
           S ++ M IP ++G +LD  K+            D  P  FG+T   F  A     ++G  
Sbjct: 117 SSAVSMTIPTIVGKLLDIAKD--RKDADDTTEDDEGPKIFGMTTKQFCTALLAVFLVGAA 174

Query: 232 CNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLT 291
            N GR ++L++  ER+VARLR+  +K  L QDA F D N+VGDLIS L SDA +V++S+T
Sbjct: 175 ANAGRIVILKITGERLVARLRTRTMKAALDQDATFLDTNRVGDLISCLSSDASIVAKSVT 234

Query: 292 QKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEAT 351
           Q VSDG +A++              QL+S +++  P + I A ++G+KIR++S  LQ + 
Sbjct: 235 QNVSDGTRAVIQGFVGFGMMGYISWQLTSVMILMIPPLGIMAVVYGRKIRNLSRQLQTSV 294

Query: 352 GQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGD 411
           G LT+VSEEQL  VKT+QS+V E+KEI RY   +R+++NIG   A+ +  F  ST ++G+
Sbjct: 295 GGLTKVSEEQLGAVKTIQSYVGEKKEIHRYATEVRNVFNIGLKEALTSGVFFGSTGLVGN 354

Query: 412 MSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFD 471
           +S L +L  G+ ++ +G +T+GDL++FM+Y  YT +S+FGLS+FYSE+M+G GAA R+F+
Sbjct: 355 ISLLALLMVGTNMIQNGLITVGDLSSFMMYAVYTGSSMFGLSSFYSELMKGAGAAARVFE 414

Query: 472 LTDRIPAIRPTIGEKFIP-GDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGP 530
           L DR P I PTIG+  +   +  I F N+ F YPTR   ++F  L+  +EPG  VCIVGP
Sbjct: 415 LKDRKPLIPPTIGQDPVTLANKTIRFENVSFTYPTRLNQKIFDGLDITVEPGEHVCIVGP 474

Query: 531 SGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNI 590
           SG GKST+A LLLRYY+ + G+I+I + +I   N +  R+ +GIVQQEP L +G+I DNI
Sbjct: 475 SGSGKSTVASLLLRYYDTNEGRIMIGDHNINSFNVRKYRRLLGIVQQEPQLFNGTILDNI 534

Query: 591 TYGL--KREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARAL 648
            Y +  +R    D I     Q  C  F+  FPD  +T++GP G  LSGGQKQRIA+ARA 
Sbjct: 535 LYTVPPERADNDDLISTAIGQANCSKFLANFPDGLQTLVGPRGAQLSGGQKQRIALARAF 594

Query: 649 IKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGN 708
           +  P +LILDEATSALD +SE  +  T  ++   + +T +SIAHRLSTI+    ++VLG 
Sbjct: 595 LLDPSLLILDEATSALDSQSEEIVAQTL-RVRVQRGLTTISIAHRLSTIKNCTRVVVLGK 653

Query: 709 DGSVVETGKFKELYADPTSELSKLLNEKQ 737
            G VVE+G F+EL  +P SELS LL+++Q
Sbjct: 654 CGQVVESGPFEELLRNPLSELSILLSQQQ 682

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  503 bits (1296), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 269/611 (44%), Positives = 386/611 (63%), Gaps = 9/611 (1%)

Query: 138 AEDEKKGRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLD-ALKNVMTD 196
           A  +  G  ++ RL +++  + K           S S+ MA+P VIG +LD A ++   +
Sbjct: 79  ANSKSSGFKDIKRLFVLSRPESKYIGLALLLILISSSVSMAVPSVIGKLLDVASESDDEE 138

Query: 197 SPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVI 256
                  S L    +GLT   F  A     VIG + N  R I+L++  ER+VARLR+  +
Sbjct: 139 DEEKARDSKL----YGLTKKQFFTALGLVFVIGAVANASRIIILKITGERLVARLRTRTM 194

Query: 257 KKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXP 316
           K  L QDA F D N+VGDLISRL SDA +V++S+TQ VSDG +AI+              
Sbjct: 195 KAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSW 254

Query: 317 QLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQK 376
           +L+  +++ AP +   A ++GKKIR++S  LQ + G LT+V+EEQLN  +T+Q++  E+ 
Sbjct: 255 KLTCVMMLLAPPLGAMALVYGKKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKN 314

Query: 377 EIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLT 436
           E+ RY   +R++++IG   AV +  F  ST ++G+ + L +L  G+ ++  G +TIG+L+
Sbjct: 315 EVHRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTNMIQSGVMTIGELS 374

Query: 437 AFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIP-GDGCIE 495
           +FM+Y  YT +S+FGLS+FYSE+M+G GAA R+F+L DR P I PTIG+  I      + 
Sbjct: 375 SFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPISLAHKPVV 434

Query: 496 FRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILI 555
           F+N+ F YPTRP++Q+FK+LN  I+PG  VC VGPSG GKSTIA LLLRYY+ +SG I  
Sbjct: 435 FKNVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEF 494

Query: 556 DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREAT--PDEIREVSKQCFCH 613
           D++D+   N +  R+ +G VQQEP+L +G+I DNI Y +  E     D +    +Q  C 
Sbjct: 495 DDEDVRNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPSEIAEREDRVARAIEQANCT 554

Query: 614 NFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAIN 673
            F+  FPD  +T++G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  + 
Sbjct: 555 KFLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPALLILDEATSALDSQSEEIVA 614

Query: 674 YTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLL 733
               K ++ + +T +SIAHRLSTI+ S  IIVLG  GSVVETG F++L A P SEL+ LL
Sbjct: 615 KNLQKRVE-RGLTTISIAHRLSTIKHSTRIIVLGKHGSVVETGSFRDLIAIPDSELNALL 673

Query: 734 NEKQSRANKKE 744
            E+     K++
Sbjct: 674 AEQHDEEGKEK 684

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  501 bits (1290), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 267/609 (43%), Positives = 382/609 (62%), Gaps = 7/609 (1%)

Query: 138 AEDEKKGRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVMTDS 197
           A  +  G  ++ RL +++  + K           S S+ MA+P VIG +LD       + 
Sbjct: 79  ANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLDLASETEDEE 138

Query: 198 PSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIK 257
                 S+     +GLT   F  A     +IG + N  R I+L++  ER+VARLR+  +K
Sbjct: 139 KEEKAKSNK---LYGLTKRQFFTALGLVFIIGAVANASRIIILKVTGERLVARLRTRTMK 195

Query: 258 KTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQ 317
             L QDA F D N+VGDLISRL SDA +V++S+TQ VSDG +AI+              +
Sbjct: 196 AALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWK 255

Query: 318 LSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKE 377
           L+  +++ AP +   A I+G+KIR++S  LQ + G LT+V+EEQLN  +T+Q++  E+ E
Sbjct: 256 LTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNE 315

Query: 378 IRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTA 437
           +RRY   +R++++IG   AV +  F  ST ++G+ + L +L  G+ ++  GS+T+G+L++
Sbjct: 316 VRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSS 375

Query: 438 FMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIP-GDGCIEF 496
           FM+Y  YT +S+FGLS+FYSE+M+G GAA R+F+L DR P IRPTIG+  +      I F
Sbjct: 376 FMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKPIVF 435

Query: 497 RNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILID 556
           +N+ F YPTRP++Q+FK+LN  I PG  VC VGPSG GKSTIA LLLRYY+ +SG I   
Sbjct: 436 KNVSFTYPTRPKHQIFKDLNITINPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFG 495

Query: 557 NQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREAT--PDEIREVSKQCFCHN 614
           ++DI   N +  R+ +G VQQEP+L +G+I DNI Y +  E     D I     Q  C  
Sbjct: 496 DEDIRSFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRIGRAIGQANCTK 555

Query: 615 FITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINY 674
           F+  FPD  +T +G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +  
Sbjct: 556 FLANFPDGLQTTVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAK 615

Query: 675 TFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLN 734
              + ++ + +T +SIAHRLSTI+ S  ++VLG  GSVVETG F++L A P SEL+ LL 
Sbjct: 616 NLQRRVE-RGLTTISIAHRLSTIKHSTRVVVLGKHGSVVETGSFQDLIAIPNSELNALLA 674

Query: 735 EKQSRANKK 743
           E+Q    K+
Sbjct: 675 EQQDEEQKE 683

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  498 bits (1282), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 265/610 (43%), Positives = 385/610 (63%), Gaps = 7/610 (1%)

Query: 138 AEDEKKGRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVMTDS 197
           A+ +  G  ++ RL +++  +             S S+ MA+P VIG +LD   +   + 
Sbjct: 78  ADSKSSGFKDIKRLFVLSRPESGYIGLALLLILISSSVSMAVPSVIGKLLDLASDDDDEE 137

Query: 198 PSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIK 257
            +     +     +GL+   F  A     +IG + N  R I+L++  ER+VARLR+  +K
Sbjct: 138 DAKETKDNK---LYGLSKRQFFTALGAVFLIGAIANASRIIILKVTGERLVARLRTRTMK 194

Query: 258 KTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQ 317
             L QDA F D N+VGDLISRL SDA +V++S+TQ VSDG +AI+              +
Sbjct: 195 AALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWK 254

Query: 318 LSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKE 377
           L+  +++ AP +   A I+G+KIR++S  LQ + G LT+V+EEQLN  +T+Q++  E+ E
Sbjct: 255 LTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNE 314

Query: 378 IRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTA 437
           +RRY   +R+++++G   AV +  F  ST ++G+ + L +L  G+ ++  G++T+G+LT+
Sbjct: 315 VRRYAKEVRNVFHVGLKEAVTSGLFFGSTGLVGNAAMLSLLLVGTNMIQSGAMTVGELTS 374

Query: 438 FMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIP-GDGCIEF 496
           FM+Y  YT +S+FGLS+FYSE+M+G GAA R+F+L DR P IRPTIG+  +      I F
Sbjct: 375 FMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAHKPIVF 434

Query: 497 RNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILID 556
           +++ F YPTRP++Q+FK+LN  I+PG  VC VGPSG GKSTIA LLLRYY+ S+G I   
Sbjct: 435 KDVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDTSAGSIDFG 494

Query: 557 NQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIR--EVSKQCFCHN 614
           ++DI   N +  R+ MG VQQEP+L +G+I DNI Y +  E    E R      Q  C  
Sbjct: 495 DEDIKNFNLRKYRRLMGYVQQEPLLFNGTILDNILYCIPPEIAEQEDRVARAIGQANCTK 554

Query: 615 FITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINY 674
           F+  FPD  +T++G  G  LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +  
Sbjct: 555 FLANFPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEVVAK 614

Query: 675 TFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLN 734
              + +K + +T +SIAHRLSTI+ S  +IVLG  GSVVETG F++L + P SEL+ LL 
Sbjct: 615 NLQRRVK-RGLTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFQDLISIPGSELNALLA 673

Query: 735 EKQSRANKKE 744
           E+Q    K E
Sbjct: 674 EQQDDEGKDE 683

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  497 bits (1279), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 269/605 (44%), Positives = 376/605 (62%), Gaps = 11/605 (1%)

Query: 138 AEDEKKGRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLD--ALKNVMT 195
           A+ ++ G   + RL  +   + K           S ++ M IP VIG +LD    K    
Sbjct: 73  ADSKEYGFKNVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISKEKEAGG 132

Query: 196 DSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHV 255
           D     ET       +GLT   F  A  G  VIG   N GR ++L++  E++VARLR+  
Sbjct: 133 DGDEEQETR-----IYGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVARLRTKT 187

Query: 256 IKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXX 315
           +K  L QDA F D N+VGDLISRL SDA +VS+S+TQ  SDG +A++             
Sbjct: 188 MKAALQQDAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGMMGYIS 247

Query: 316 PQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQ 375
            QL+  +++ AP +V+ A ++G++IR+++  LQ   G LT+V+EEQLN  +T+QS+  E+
Sbjct: 248 AQLTGVMLLLAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQSYCGER 307

Query: 376 KEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDL 435
           KEIRRY   +R ++ +G   AV +  F  +T ++G+M+ L +L  G+ ++  G++T+G+L
Sbjct: 308 KEIRRYAEEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAITVGEL 367

Query: 436 TAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIP-GDGCI 494
           ++FM+Y  YT +S+FGLS+FYSE+M+G GAA R+F+L DR+P I PT G+  I      I
Sbjct: 368 SSFMMYAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISLAAKEI 427

Query: 495 EFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQIL 554
           EF+N+ F+YP+R  + VF  LN KI PG  VC+VGPSG GKSTI+ LLLR+Y+  SG I 
Sbjct: 428 EFKNVKFSYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVDSGVIT 487

Query: 555 IDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIR--EVSKQCFC 612
           I  Q+I   N +  R+ +GIVQQEP+L +GSI+DNI Y L      D+ R     +   C
Sbjct: 488 IGGQNIKDFNLRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRALEAANC 547

Query: 613 HNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI 672
             FI+ FPD  +T++GP GT LSGGQKQRIAIARA I  P ILILDEATSALD +SE  I
Sbjct: 548 TRFISNFPDGLDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQSEDII 607

Query: 673 NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKL 732
                   +S  +TI SIAHR+STI  S  +IVL  +G V ETG F +L   P S L+KL
Sbjct: 608 AQALRARSESGKITI-SIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQPNSNLNKL 666

Query: 733 LNEKQ 737
           L+++ 
Sbjct: 667 LSKEH 671

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  497 bits (1280), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 259/578 (44%), Positives = 378/578 (65%), Gaps = 9/578 (1%)

Query: 172 SCSIGMAIPKVIGLVLDALKNVMTDSPSSLETSDLPPIAF-GLTLYPFLGAFAGALVIGT 230
           S S+ M +P +IG +LDA K    ++      + +P I F GLT   F  A     ++G 
Sbjct: 121 SSSVSMTVPSIIGKLLDAAKKGQKENEEEDSKTIVPDITFFGLTRTQFYTALGVLFLVGA 180

Query: 231 MCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSL 290
           + N GR I+L++  ER+VARLR+  +K  L QDA F D N+VGDLISRL SDA +VS+++
Sbjct: 181 IANTGRIIILKVTGERLVARLRTRTMKAALDQDATFLDANRVGDLISRLSSDAAIVSKAV 240

Query: 291 TQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEA 350
           TQ VSDG +AI+              +L+  +++  P + I A ++G+KIR++S  LQE+
Sbjct: 241 TQNVSDGTRAIIQGFVGFGMMGYLSWKLTGVMMLMVPPLGIMALVYGRKIRNLSKQLQES 300

Query: 351 TGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIG 410
            G L++V+EEQLN  KT+Q++V E+ EI RY   +R+++ IG   AV +  F  ST ++G
Sbjct: 301 VGGLSKVAEEQLNATKTIQAYVGERLEIHRYATEVRNVFRIGLKEAVTSGLFFGSTGLVG 360

Query: 411 DMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLF 470
           +++ + +L  G+ ++  G+LT+G+L++FM+Y  YT +S+FGLS+FYSE+M+G GAA R+F
Sbjct: 361 NIAMISLLLVGTNMIQSGTLTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAASRVF 420

Query: 471 DLTDRIPAIRPTIG--EKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIV 528
           +L DR P I+ T+G   K + G   I+F N+ F YP+RP +++F NLN +I PG  VCIV
Sbjct: 421 ELNDRKPLIKSTVGIDPKTLFGK-SIKFENVSFTYPSRPNHKIFDNLNLEINPGEHVCIV 479

Query: 529 GPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRD 588
           G SG GKSTIA LLLRYY+ ++G I I + DI   + +  R+ +G VQQEP L +GSI D
Sbjct: 480 GFSGSGKSTIASLLLRYYDVNNGSIRIGDNDIRNFSLRKYRRLIGTVQQEPSLFNGSILD 539

Query: 589 NITYGLKREATPDEIRE----VSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAI 644
           NI Y +  E T ++  E      KQ  C+ F+ KFPD  +T++GP G  LSGGQKQRIA+
Sbjct: 540 NIIYAIPPELTSEKQHERVQLAIKQANCNIFLGKFPDGLQTLVGPRGAQLSGGQKQRIAL 599

Query: 645 ARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYII 704
           ARA +  P +LILDE+TSALD  SE  +  T  +   ++ +T +SIAHRLSTI+ S  +I
Sbjct: 600 ARAFLLDPTLLILDESTSALDSLSEELVAKTL-QARSARGLTTISIAHRLSTIKHSSRVI 658

Query: 705 VLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANK 742
           V+G  GSVVE+G F  L  +P SEL+ LL+++    ++
Sbjct: 659 VIGKYGSVVESGPFDRLIDNPKSELNMLLSQQNEHIDE 696

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  497 bits (1280), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 260/603 (43%), Positives = 380/603 (63%), Gaps = 8/603 (1%)

Query: 144 GRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLDALKNVMTDSPSSLET 203
           G  ++ RL  +   + K           S S+ M IP +IG +LD  K    D       
Sbjct: 92  GMKDIKRLFKLAKPEAKYILLALLFIVISSSVSMTIPTIIGKLLDLAKADNDDEDGDNNA 151

Query: 204 SDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQD 263
                + FGLT   F  A  G  + G + N  R ++L++  ER+VARLR+  +K  L+QD
Sbjct: 152 KKEKLMIFGLTKPQFYTALGGLFLAGAIANASRIVILKVTGERLVARLRTRTMKAALYQD 211

Query: 264 AEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLV 323
           A F D N+VGDLISRL SDA +V++++TQ VSDG +A++              +L+  ++
Sbjct: 212 ASFLDTNRVGDLISRLSSDASIVAKAVTQNVSDGSRAVIQGFVGFGMMSFISWKLTCVMM 271

Query: 324 IFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNN 383
           I  P + + A ++G+KIR +S  LQ + G LT+V+EEQLN  +T+Q++  E  EI RY  
Sbjct: 272 IMVPPLGVMALVYGRKIRTLSRQLQASVGGLTKVAEEQLNATRTIQAYGGEALEIHRYAT 331

Query: 384 AIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTD 443
            +R ++++G   AV +  F  ST ++G+++ + +L  G+ ++ +G+LT+GDL++FM+Y  
Sbjct: 332 EVRKVFDVGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTSMIQYGTLTVGDLSSFMMYAV 391

Query: 444 YTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIG--EKFIPGDGCIEFRNLGF 501
           YT +S+FGLS FYSE+M+G GAA R+F+L DR P I+PTIG   K + G   IEF+N+ F
Sbjct: 392 YTGSSLFGLSGFYSELMKGAGAATRVFELNDRKPLIKPTIGYDPKSLLGK-SIEFQNVSF 450

Query: 502 AYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIM 561
           AYPTRP + +  NL+  I+PG  VCIVGPSG GKST++ LLLRYY+ S+G I ID Q+I 
Sbjct: 451 AYPTRPTHSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGSIKIDGQNIK 510

Query: 562 KLNPKSLRQYMGIVQQEPVLMSGSIRDNITYG-LKRE---ATPDEIREVSKQCFCHNFIT 617
           + N +  R+ +G+VQQEP+L +G+I DNI Y  L +E   A   +++   +Q  C  F+ 
Sbjct: 511 EFNLRKYRRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALEQANCTKFLK 570

Query: 618 KFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFG 677
            FP+   T++GP GT LSGGQKQRIA+ARA +  P +LILDEATSALD +SE  +     
Sbjct: 571 NFPEGVNTLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSEEIVAKNLS 630

Query: 678 KLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQ 737
           + ++   +T +SIAHRLSTI+ S  +IVL   GSVVETG F+EL     SEL+ LL+++ 
Sbjct: 631 ERVE-LGLTTISIAHRLSTIKHSTRVIVLDKSGSVVETGPFEELVDYSRSELNMLLSQQH 689

Query: 738 SRA 740
            + 
Sbjct: 690 KKG 692

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  490 bits (1262), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 263/599 (43%), Positives = 373/599 (62%), Gaps = 29/599 (4%)

Query: 172 SCSIGMAIPKVIGLVLDALKNVMTDSPSSLETSD-----------LPPIAFGLTLYPFLG 220
           S ++ M +P VIG +LD  K   + SPS  E  +                +G T   F  
Sbjct: 117 SSTVSMLLPSVIGKLLDLAK---SSSPSENEKQESGDGDDKDKDKEEGTIYGFTPKQFCV 173

Query: 221 AFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLG 280
              G  V G   N GR I+L++  ER+VARLR+  +K  L QD+ F D+N+VGDLISRL 
Sbjct: 174 IMGGIFVAGAFANCGRIIILKVTGERLVARLRTRTMKAALDQDSAFLDRNRVGDLISRLS 233

Query: 281 SDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKI 340
           SD+ +V++SLTQ VSDG +A++              QL+  + +  P +   A I+GKKI
Sbjct: 234 SDSSIVAKSLTQNVSDGTRAVIQGFVGFGMMTYISWQLTCVMGLMLPPIGAMAIIYGKKI 293

Query: 341 RDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNS 400
           R++S  LQ + G LT+V+EEQL   KT+QS+V E+KEIRRY   +R +++IG   A+ + 
Sbjct: 294 RNLSKQLQTSVGGLTKVAEEQLGATKTIQSYVGEKKEIRRYAKEVRQVFDIGLKEALTSG 353

Query: 401 KFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIM 460
            F  ST  +G++S L +L  G+ ++  G +T+GDL++FM+Y  YT  S+FGLSNFYSE+M
Sbjct: 354 MFFGSTGFVGNISLLALLMSGASMIQSGLITVGDLSSFMMYAVYTGGSMFGLSNFYSELM 413

Query: 461 QGVGAAKRLFDLTDRIPAIRPTIGE-----KFIPGDGCIEFRNLGFAYPTRPENQVFKNL 515
           +G GAA R+F+L DR PAI PT+G+     + +P    I F+++ F YPTR   ++F +L
Sbjct: 414 KGAGAAARVFELNDRKPAIAPTLGKGPTSIRNLP----ISFKDVSFTYPTRLNKKIFNHL 469

Query: 516 NFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIV 575
           N  I+PG  +CI GPSG GKSTIA LL+RYY+   G I I + D+   N +  R+ +G+V
Sbjct: 470 NLTIQPGEHICIAGPSGSGKSTIASLLVRYYDVDQGGISIGDTDLRTFNLRKYRRLIGVV 529

Query: 576 QQEPVLMSGSIRDNITYGLKREATPDEIREVSK---QCFCHNFITKFPDAYETIIGPHGT 632
            QEPVL +G+I +NI Y +      DE R VS    +  C  F++ FPD  ET++GP G 
Sbjct: 530 HQEPVLFNGTILENILYAVPPSVAQDE-RRVSAAIGKANCSKFLSNFPDGLETLVGPRGA 588

Query: 633 LLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAH 692
            LSGGQKQR+A+ARA +  P +L+LDEATSALD +SE  +  T  + ++ + +T +SIAH
Sbjct: 589 QLSGGQKQRVALARAFLLDPALLVLDEATSALDSQSEEIVARTLQERVR-RGLTTISIAH 647

Query: 693 RLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQ-SRANKKEAPLPPQ 750
           R+STI  S  ++VLG DG VVE+G F+EL   P SEL+ LL+ +Q  R   KE P  P+
Sbjct: 648 RISTIAHSTRVVVLGRDGFVVESGPFQELIDRPNSELNYLLSLQQDEREEIKENPSEPR 706

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  488 bits (1257), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 259/605 (42%), Positives = 376/605 (62%), Gaps = 10/605 (1%)

Query: 138 AEDEKKGRSELARLVLMTLRDWKXXXXXXXXXXXSCSIGMAIPKVIGLVLD-ALKNVMTD 196
           A     G  ++ RL  +   + K           S ++ M IP VIG +LD A ++V  +
Sbjct: 75  ATGNASGAKDVRRLFQLARPELKSLVCALVLIVISGAVSMTIPSVIGKLLDVAREDVEQE 134

Query: 197 SPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVI 256
           S    E      + +GL    F  A +G   +G + N GR ++L+   ER+VARLR+  +
Sbjct: 135 SGDEEEA-----VLYGLPEKQFYLALSGIFAVGALANMGRIVVLKTTGERLVARLRTRTM 189

Query: 257 KKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXP 316
           K  L Q+  F D N+VGDLISRL SDA +VS+S+TQ  SDG +A++              
Sbjct: 190 KAALEQEGAFLDSNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGAVGFGMMSYISW 249

Query: 317 QLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQK 376
           QL++ + + AP +V+ A+ +G+++R++S  LQ   G LT+V+EEQLN  +TVQ++  E++
Sbjct: 250 QLTAVMTLLAPPLVLMAAFYGRRVRNLSRELQTKVGGLTKVAEEQLNATRTVQAYCGERR 309

Query: 377 EIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLT 436
           EIRRY   +R+++++G   A+++  F  +T  +G+ + L +L  G+ ++  G +++G+L+
Sbjct: 310 EIRRYATEVRNVFDVGLKEALISGSFFGATGFVGNATLLALLLTGTSMIKGGGISVGELS 369

Query: 437 AFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDG-CIE 495
           +FM+Y  YT +S+F LS+FYSE+M+G GAA R+F+L DR P I PTIG+  +   G  I 
Sbjct: 370 SFMMYAVYTGSSLFNLSSFYSELMKGAGAAVRVFELNDRKPLIHPTIGKDPVSLTGKTIA 429

Query: 496 FRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILI 555
           F ++ FAYPTRP +QVF  ++  I PG  VCIVGPSG GKST+A LLLR+Y+P SG I I
Sbjct: 430 FNSVNFAYPTRPHHQVFAGMDLSICPGEHVCIVGPSGGGKSTVASLLLRFYDPISGSITI 489

Query: 556 DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREAT--PDEIREVSKQCFCH 613
             +DI   N    R+ MGIVQQEPVL + SI +NITY L    T  P  I    +   C 
Sbjct: 490 GGEDIRLFNLSKYRRMMGIVQQEPVLFNASILENITYALPLHLTKDPARIDRALRLSNCS 549

Query: 614 NFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAIN 673
            F+  FP+  +T +GP GT LSGGQKQR+A+ARA ++ P ILILDEATSALD +SE  + 
Sbjct: 550 AFVGSFPEGLQTAVGPRGTQLSGGQKQRVALARAFLQDPAILILDEATSALDSKSEDIVA 609

Query: 674 YTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLL 733
            T  +  +   +TI SIAHR STI+ S  +IVL   G V+ETG +++L  DP S LS LL
Sbjct: 610 STLLQRCQEAKITI-SIAHRKSTIQHSTRVIVLDKLGHVLETGTYQQLIGDPGSSLSGLL 668

Query: 734 NEKQS 738
           +++ S
Sbjct: 669 SKEHS 673

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  477 bits (1227), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 254/597 (42%), Positives = 376/597 (62%), Gaps = 27/597 (4%)

Query: 172 SCSIGMAIPKVIGLVLDALKNVMTDSP---------------SSLETSDLPPIAFGLTLY 216
           S S+ M +P VIG ++D  K   T S                S+   +D   +  GLTL 
Sbjct: 111 SSSVSMLVPGVIGKLMDVAKEDGTSSSEADGKRGDATDKTDGSTAADTDSEKLILGLTLP 170

Query: 217 PFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLI 276
            F G      V+G   N GR ++L++  E++VARLR+  +K  L QDA F D NKVGDLI
Sbjct: 171 QFYGGLFSLFVVGAAANMGRIVILKVTGEKLVARLRTRTLKAALQQDASFLDNNKVGDLI 230

Query: 277 SRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIF 336
           SRL SDA +VS+SLTQ +SDG ++++              +L+  +++ AP + + A ++
Sbjct: 231 SRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAVMALVY 290

Query: 337 GKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSA 396
           G+KIR++S  LQ + G LT+ +EEQL+  +T+Q++  E++ IR Y   +R +Y +G   A
Sbjct: 291 GRKIRNLSRTLQASVGGLTKAAEEQLSATRTIQAYGGEKQAIRHYAKEVRQVYQVGLKEA 350

Query: 397 VVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFY 456
           + +  F   T ++G+ + L +L  G+ ++  G++T+GDL++FM+Y  YT +S+FG+S+FY
Sbjct: 351 LTSGGFFGLTGLVGNSAVLALLLTGTSMISTGAMTVGDLSSFMIYAVYTGSSLFGMSSFY 410

Query: 457 SEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIP-GDGCIEFRNLGFAYPTRPENQVFKNL 515
           SE+M+G GAA R+F+L DR PAI PT G   +      +EF+ + FAYPTR ++ +F++L
Sbjct: 411 SELMKGAGAAARVFELNDRKPAIHPTKGRDPVSLARKPVEFKKVHFAYPTRRQHVIFEDL 470

Query: 516 NFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIV 575
           + +I+PG  VCIVGPSG GKST+A LLLR+Y+  +G ILI  Q+I   N +  R+ +GIV
Sbjct: 471 SLRIDPGEHVCIVGPSGGGKSTVASLLLRFYDVDAGAILIGGQNIADFNLRKYRRLVGIV 530

Query: 576 QQEPVLMSGSIRDNITYGLKREATPDEIREVSK---QCFCHNFITKFPDAYETIIGPHGT 632
           QQEP+L +G+I +NI Y + +    +E   V++   Q  C  F++ FPD  +T++GP GT
Sbjct: 531 QQEPMLFNGTILENILYTVPQRLLNEEDGRVARAIGQANCSAFLSSFPDGLQTMVGPRGT 590

Query: 633 LLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAH 692
            LSGGQKQRIA+ARA +  P +LILDEATSALD  SE  I  T      ++  T +SIAH
Sbjct: 591 QLSGGQKQRIALARAFLLDPDLLILDEATSALDSRSEEVIARTLHS-RTTRGKTTISIAH 649

Query: 693 RLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEAPLPP 749
           R+STI+ S  +IVLG +G VVETG F EL ++  S+L+KLL        K+E P+ P
Sbjct: 650 RVSTIQHSTRVIVLGRNGGVVETGTFDELASNTDSQLNKLL-------RKEEEPVQP 699

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  474 bits (1221), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 251/576 (43%), Positives = 368/576 (63%), Gaps = 16/576 (2%)

Query: 172 SCSIGMAIPKVIGLVLDALKN------VMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGA 225
           S S+ M +P VIG ++DA K+      ++ +   +          FGLT+  F G     
Sbjct: 111 SSSVSMLVPGVIGKLMDAAKDDQQASKLVENDSDAAAPDADGRQIFGLTMPQFYGVLFSV 170

Query: 226 LVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYV 285
            V+G   N GR ++L++  E++VARLR+  +K +L QDA F D NKVGDLISRL SDA +
Sbjct: 171 FVVGAAANMGRIVILKVTGEKLVARLRTRTLKASLQQDASFLDNNKVGDLISRLSSDASI 230

Query: 286 VSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDIST 345
           VS+SLTQ +SDG ++++              +L+  +++ AP +   A I+GK+IR++S 
Sbjct: 231 VSKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAAMALIYGKRIRNLSR 290

Query: 346 ILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTS 405
            LQ + G LT+ +EEQL+  +T+Q++  E+  I +Y   +R +Y +G   A+ +  F   
Sbjct: 291 TLQASVGGLTKAAEEQLSATRTIQAYGGEKHAIHQYAKEVRQVYQVGLKEALTSGAFFGL 350

Query: 406 TSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGA 465
           T ++G+++ L +L  G+ ++  G++T+GDL++FM+Y  YT +S+FG+S+FYSE+M+G GA
Sbjct: 351 TGLVGNVAVLALLLTGTSMIRTGAMTLGDLSSFMIYAVYTGSSLFGMSSFYSELMKGAGA 410

Query: 466 AKRLFDLTDRIPAIRPTIGEKFIPGDGC-IEFRNLGFAYPTRPENQVFKNLNFKIEPGTS 524
           A R+F+L DR PAI PT G   +   G  +EF+N+ FAYPTR ++ +F+NL F+I  G  
Sbjct: 411 AARVFELNDRRPAIHPTRGIDPVSLAGKPVEFQNVKFAYPTRHQHTIFENLTFRINAGEH 470

Query: 525 VCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSG 584
           VCIVGPSG GKST+A LLLR+Y+  +G I I  Q I   N +  R+ +G+VQQEP+L +G
Sbjct: 471 VCIVGPSGGGKSTVASLLLRFYDVDTGAITIGGQSIASFNLRKYRRMLGVVQQEPMLFNG 530

Query: 585 SIRDNITYGLKREATPDEIR--EVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRI 642
           +I DNI Y + +    DE R      Q  C  F++ FPD  +T++GP GT LSGGQKQRI
Sbjct: 531 TILDNIVYSVPQSLLNDENRVARAIGQANCSAFLSSFPDGLQTLVGPRGTQLSGGQKQRI 590

Query: 643 AIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSV---TIVSIAHRLSTIRR 699
           A+ARA +  P +LILDEATSALD  SE  +     + + S+S    T +SIAHR+STI+ 
Sbjct: 591 ALARAFLLDPDLLILDEATSALDSRSEEVV----ARALYSRSTRGKTTISIAHRVSTIQH 646

Query: 700 SEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNE 735
           S  +IVLG  G VVETG F EL +DP S+L+ LL +
Sbjct: 647 SSRVIVLGRSGYVVETGTFDELISDPDSQLNLLLRK 682

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  459 bits (1180), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 249/579 (43%), Positives = 359/579 (62%), Gaps = 18/579 (3%)

Query: 172 SCSIGMAIPKVIGLVLDALKNV--MTDSPSSLETSDL------------PPIAFGLTLYP 217
           + ++ M +P VIG +LD    +   ++   + E+S                + +G T   
Sbjct: 123 TSAVSMLVPSVIGKLLDISTGIEFASNKDENDESSKEDKNENENENENKQTLIYGYTPLV 182

Query: 218 FLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLIS 277
           F        V+G + N GR I+L+L  ER+VARLR+  +K  L QD +F D NKVGDLIS
Sbjct: 183 FFSGLGVIFVVGAIANTGRIIILKLTGERIVARLRTRTMKNILKQDGKFQDSNKVGDLIS 242

Query: 278 RLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFG 337
           RL SD+ +VS ++T+ VSDG +A++              +LS  ++   P + + A I+G
Sbjct: 243 RLSSDSSIVSNAVTRNVSDGARAVIQGCVGVGMMSFISLKLSGVMLFMVPPIGVLAMIYG 302

Query: 338 KKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAV 397
           +KIR+IS  LQE+ G LT++SEEQLNG +T+QS+V E+ EI +Y   +R +Y++G   AV
Sbjct: 303 RKIRNISKKLQESVGSLTKISEEQLNGTRTIQSYVGEKLEIHKYAKEVRKVYHVGLNEAV 362

Query: 398 VNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYS 457
            +  F   T +IG+ + L +L  G  ++ +G+L+IG L++FM+Y  YT +S+FGLS+FYS
Sbjct: 363 ASGLFFGVTGLIGNGAMLSLLYVGCNMISNGTLSIGGLSSFMMYAVYTGSSLFGLSSFYS 422

Query: 458 EIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIP-GDGCIEFRNLGFAYPTRPENQVFKNLN 516
           EIM+G GAA R+F++   +P I  T G   I   D  IEF ++ FAYPTR  + +F++LN
Sbjct: 423 EIMKGSGAASRIFEINKYVPDINATKGIDPISFQDKPIEFEHIKFAYPTRSGHMIFQDLN 482

Query: 517 FKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQ 576
            KI PG  VCI+GPSG GKSTI+ LLLRYY+P +G I I  +DI + + +  R+ MG+V 
Sbjct: 483 IKINPGEHVCIIGPSGSGKSTISSLLLRYYDPLAGTISIGGKDIKEYSLRKYRKLMGVVH 542

Query: 577 QEPVLMSGSIRDNITYGLKREATPDEIR--EVSKQCFCHNFITKFPDAYETIIGPHGTLL 634
           QEPVL +G+I +NI Y +  E   D+ R     +   C+ F+   P   ET +GP GT L
Sbjct: 543 QEPVLFNGTILENILYNVPEEIANDKERLSNAIESSNCNKFLNTLPLGLETPVGPRGTQL 602

Query: 635 SGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRL 694
           SGGQKQR+A+ARA + +P +L+LDEATSALD  SE  +  T  K   +K  T +SIAHR+
Sbjct: 603 SGGQKQRVALARAFLLEPTLLVLDEATSALDPRSESIVAQTL-KQRCAKGFTTISIAHRV 661

Query: 695 STIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLL 733
           STI+ S  ++VL   G VVETG ++EL     S L+KLL
Sbjct: 662 STIKHSSRVVVLDKVGHVVETGPYEELLGIKDSALNKLL 700

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  447 bits (1151), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 249/570 (43%), Positives = 354/570 (62%), Gaps = 31/570 (5%)

Query: 172 SCSIGMAIPKVIGLVLDALKNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTM 231
           S ++ M++P VIG ++D              T D P   +GLT   FL A     V+G +
Sbjct: 58  SSAVSMSLPSVIGTLID-----------HASTPDAP--IYGLTRNQFLLALGSVFVVGAI 104

Query: 232 CNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLT 291
            N GR I+L++  E++VARLR+  +K  L QDA F D+++VGDLISRL SDA +VS+S+T
Sbjct: 105 ANSGRIIILKITGEKLVARLRTKTMKSMLSQDATFLDKHRVGDLISRLSSDASIVSKSVT 164

Query: 292 QKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEAT 351
             +SDG +A L              +L++ + +  P + I A ++G KI+ IS  LQ+  
Sbjct: 165 SNLSDGCRATLQGVVGIGMMTYISLKLTTVMTMMVPPLGILAMLYGGKIKKISRQLQDKV 224

Query: 352 GQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGD 411
           GQL++ SEEQLN +KTVQ++  E+KE++RY+N +R ++NIG   AV ++ F  ST +IG+
Sbjct: 225 GQLSKTSEEQLNSLKTVQAYAGERKELQRYSNEVRSVFNIGVKEAVASALFFGSTGLIGN 284

Query: 412 MSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFD 471
           ++ + +L  G+      S+T+G+L++FM+Y  YT +S+FGL+ FYSE+M+G GAA+R+ +
Sbjct: 285 IAMIGLLLVGTA---DSSITLGELSSFMMYGVYTGSSVFGLTGFYSELMKGCGAAERVLE 341

Query: 472 LTDRIPAIRPTIG------EKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSV 525
           L +    I PT G       K +P    I F N+ FAY       V   +NF+I PG  V
Sbjct: 342 LQNMKTKISPTKGISPPKTLKGLP----ITFNNVSFAYSN--GKSVLSEMNFQIHPGEHV 395

Query: 526 CIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGS 585
           C VG SG GKSTI+ LLLRYY   SG I I N DI   N +  R+ +G+VQQEP+L +G+
Sbjct: 396 CFVGGSGCGKSTISSLLLRYYRTGSGNISIGNYDISAFNLRKYRRMLGVVQQEPLLFNGT 455

Query: 586 IRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIA 645
           I DNITYGL  ++  D +    K   C  FI +     +T++GP G  LSGGQ+QRIA+A
Sbjct: 456 ILDNITYGLHDKSLTD-LNMALKAANCDQFIKESHMGLDTLVGPRGAQLSGGQRQRIALA 514

Query: 646 RALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIV 705
           R  ++ P ILILDEATSALD +SE  IN    +  ++  +T +SIAHRLSTIR S  +IV
Sbjct: 515 RVFLQNPDILILDEATSALDTKSEDIINKELQRRQEA-GMTTISIAHRLSTIRHSSRVIV 573

Query: 706 LGNDGSVVETGKFKELYADPTSELSKLLNE 735
           +  DG VVE+G F +L +   SEL+KLL E
Sbjct: 574 I-EDGRVVESGSFDQLRSTRDSELNKLLKE 602

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  211 bits (537), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 164/553 (29%), Positives = 272/553 (49%), Gaps = 30/553 (5%)

Query: 200 SLETSD---LPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVI 256
           ++E SD   + PIA  LT+  +  A  GA++ G +    R  +   +++  + ++     
Sbjct: 147 NIEWSDATTVLPIAITLTVLSYGAARFGAVLFGEI----RNAVFASVAQNAIRKVSLQTF 202

Query: 257 KKTLHQDAEFFDQNKVGDLISRLGSD----AYVVSRSLTQKVSDGFK-AILCXXXXXXXX 311
           +  +  D  +    + G L   +       +YV+S  +   +   F+ +++C        
Sbjct: 203 QHLMRLDLGWHLSRQTGGLTRAMDRGTKGISYVLSAMVFHIIPIAFEISVVCGILTY--- 259

Query: 312 XXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQE----ATGQLTRVSEEQLNGVKT 367
                Q  +       A ++  SIF  K     T  +     A  +   V+ + L   + 
Sbjct: 260 -----QFGTSFAAVTFATMLLYSIFTFKTTAWRTEFRRSANRADNKAASVALDSLINFEA 314

Query: 368 VQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH 427
           V+ F  E+    +Y+N++ +  N     A   +  ++  ++I   +   ++  G   V+ 
Sbjct: 315 VKYFNNERYLADKYHNSLTNYTNSQIKVAQSLAFLNSGQNLIFTSALTAMMYMGCTGVMS 374

Query: 428 GSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKF 487
           G L++GDL          +  +  L + Y E+ Q +   + LF L      I+ +     
Sbjct: 375 GDLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLQKNKVNIQNSKTPLM 434

Query: 488 IPGDG-C-IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRY 545
           +P D  C I+F N+ F Y   P+ ++ +N NF +  G    IVGPSG GKSTI  L+ R+
Sbjct: 435 LPKDKPCEIKFENVTFGY--HPDRKILENANFTLPAGWKTAIVGPSGSGKSTILKLVFRF 492

Query: 546 YNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIRE 605
           Y+P  G+ILID +DI +L+ KSLR+ +G+V Q+  L + +I +N+ +G K  AT D+IR+
Sbjct: 493 YDPQEGRILIDGKDIRELDLKSLRRAIGVVPQDTPLFNDTIWENVKFG-KITATDDDIRK 551

Query: 606 VSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALD 665
              +      I   P   ETI+G  G ++SGG+KQR+AIAR L+K   I+  DEATSALD
Sbjct: 552 AIDKAQLAPLIHSLPQGSETIVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALD 611

Query: 666 VESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADP 725
             +E A+  T  +     S T + IAHRL TI  ++ I+VL N G V E GK  EL + P
Sbjct: 612 THTEQALLRTIKENFAGNSRTSIYIAHRLRTIADADKIVVLEN-GRVKEEGKHAELLSKP 670

Query: 726 TSELSKLLNEKQS 738
           TS  S+L N +++
Sbjct: 671 TSLYSELWNIQEN 683

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  201 bits (510), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 139/389 (35%), Positives = 208/389 (53%), Gaps = 15/389 (3%)

Query: 357 VSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYN----IGKMSAVVNSKFSTSTSVIGDM 412
           ++ + L   + V+ F  E     +YN+A+ D  N    I K  A +NS      ++I   
Sbjct: 314 IALDSLINFEAVKYFNNENYLSSKYNSALIDYRNSQIKISKSLAFLNS----GQNLIFTT 369

Query: 413 SFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDL 472
           +   ++  G   V+ G+LT+GDL          +  +  L + Y E+ Q +   + LF L
Sbjct: 370 ALTGMMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKL 429

Query: 473 TDRIPAIRPTIGEKFI-PGDGCIE--FRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVG 529
                 I      K I   DG  E  F N+ F Y    + ++ KN +F I  G    IVG
Sbjct: 430 RKNEVKIHNIENPKIILKEDGPFEITFENVTFGY--HADRKILKNASFTIPAGWKTAIVG 487

Query: 530 PSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDN 589
           PSG GKSTI  L+ R+Y+P  G+ILI+  D+ ++   SLR+ +G+V Q+  L + SI +N
Sbjct: 488 PSGSGKSTILKLVFRFYDPEEGRILINGIDVREIELDSLRKLIGVVPQDTPLFNDSIWEN 547

Query: 590 ITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALI 649
           + +G + +A   EI EV ++    + I K P +YETI+G  G ++SGG+KQR+AIAR L+
Sbjct: 548 VKFG-RIDALDSEIYEVIEKAQLDSLIRKLPQSYETIVGERGLMISGGEKQRLAIARVLL 606

Query: 650 KKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGND 709
           K   ++  DEATSALD  +E A+  T     K+ S T + IAHRL TI  ++ IIVL  D
Sbjct: 607 KDASVMFFDEATSALDTHTEQALLKTIRANFKTGSRTSIYIAHRLRTIADADKIIVL-ED 665

Query: 710 GSVVETGKFKELYADPTSELSKLLNEKQS 738
           G+V E G   EL A  TS   +L N +++
Sbjct: 666 GTVREEGTHNELLAKSTSLYKELWNVQEN 694

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  199 bits (506), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 125/331 (37%), Positives = 187/331 (56%), Gaps = 11/331 (3%)

Query: 413 SFLVVLAY-GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFD 471
           S L  + Y G+  V+ G+LT+GDL          +  +  L + Y E+ Q +   + LF 
Sbjct: 372 SALTAMMYMGASGVMEGALTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFK 431

Query: 472 LTDRIPAI----RPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCI 527
           L      I    RP +  + +P +  I+F N+ F Y  +P+  + KN  F I PG    I
Sbjct: 432 LQKNPILIKNTERPLMLPEHLPCE--IKFENVTFGY--QPDRNILKNATFTIAPGKKTAI 487

Query: 528 VGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIR 587
           VGPSG GKSTI  L+ R+Y+P  G+IL+D +DI +L+   LR+ +G+V Q+  L + +I 
Sbjct: 488 VGPSGSGKSTILRLVFRFYDPQQGRILLDGKDIRELDLDELRRIVGVVPQDTPLFNDTIW 547

Query: 588 DNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARA 647
           +N+ +G +  AT +EI    ++    + I K P   ETI+G  G ++SGG+KQR+AIAR 
Sbjct: 548 ENVKFG-RINATDNEIVTAIEKAQLSDLIHKLPKGTETIVGERGLMISGGEKQRLAIARV 606

Query: 648 LIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLG 707
           L+K   I+  DEATSALD  +E ++  T  +     + T V IAHRL TI  ++ IIVL 
Sbjct: 607 LLKDTPIMFFDEATSALDTHTEQSLLKTIKENFSDVAKTSVYIAHRLRTIADADKIIVLE 666

Query: 708 NDGSVVETGKFKELYADPTSELSKLLNEKQS 738
           N G+V E G    L A+P S  S+L N +++
Sbjct: 667 N-GAVREEGTHNALLANPNSLYSELWNIQEN 696

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  199 bits (505), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 163/571 (28%), Positives = 268/571 (46%), Gaps = 25/571 (4%)

Query: 175 IGMAIPKVIGLVLDALKNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNY 234
           + + +P     ++D++    TD+ S L      PIA G  +  +  A  G+++ G + N 
Sbjct: 151 LNVQVPFFFKQIVDSMNIEWTDATSVL------PIAIGSMILSYGAARFGSVLFGELRN- 203

Query: 235 GRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKV 294
               +   + +  + R+     +  +  D  +    + G L   +      +S  L+  V
Sbjct: 204 ---AIFASVGQSAITRVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGTKGISYVLSAMV 260

Query: 295 SDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQE----A 350
              F  I               Q          + ++  SIF  K     T  ++    A
Sbjct: 261 ---FHIIPITVEIGAVCGILTYQFGGSFAAMTFSTMLLYSIFTFKTTAWRTEFRKSANKA 317

Query: 351 TGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIG 410
             +   V+ + L   + V+ F  EQ    +Y+ ++   Y   ++    +  F  S   + 
Sbjct: 318 DNKAASVAVDSLINFEAVKYFNNEQYLANKYHKSLAQ-YRDSQIKVAQSLAFLNSGQNLI 376

Query: 411 DMSFLVVLAY-GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL 469
             S L  + Y G   V+ G L++GDL          +  +  L + Y E+ Q +   + L
Sbjct: 377 FTSALTAMMYMGCTGVMSGELSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESL 436

Query: 470 FDLTDRIPAIRPTIGEKFIPGD--GCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCI 527
           F L     +I+ +     +P +    I F+N+ F Y   P+  + KN +F I  G+   I
Sbjct: 437 FQLQRNKVSIQNSKKPLMLPPNVPSEIVFKNVSFGYD--PDRLILKNASFTIPTGSKTAI 494

Query: 528 VGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIR 587
           VGPSG GKSTI  L+ R+Y+P  G+IL+D +D+ +L+ +SLR+ +G+V Q+  L + SI 
Sbjct: 495 VGPSGSGKSTILKLVFRFYDPIEGRILLDGKDVRELDIESLRRSIGVVPQDTPLFNESIW 554

Query: 588 DNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARA 647
           DN+ +G + +AT  EI     +      I + P   +TI+G  G ++SGG+KQR+AIAR 
Sbjct: 555 DNVKFG-RIDATDQEIERAIDRAQLRALIRQLPKGRDTIVGERGLMISGGEKQRLAIARV 613

Query: 648 LIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLG 707
           L+K   I+  DEATSALD  +E A+  T  +   + S T V IAHRL TI  ++ IIVL 
Sbjct: 614 LLKDAPIMFFDEATSALDTHTEQALLRTIKENFTTGSKTSVYIAHRLRTIADADKIIVL- 672

Query: 708 NDGSVVETGKFKELYADPTSELSKLLNEKQS 738
             G V E GK  EL A P S  ++L N +++
Sbjct: 673 EHGRVKEEGKHAELLATPKSLYAELWNVQEN 703

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  197 bits (500), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 136/387 (35%), Positives = 210/387 (54%), Gaps = 18/387 (4%)

Query: 349 EATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAI---RDI-YNIGKMSAVVNSKFST 404
           +A  +   V+ + L   + V+ F  E+    +YN+++   RD    + +  A +NS    
Sbjct: 289 KADNKAASVALDSLINFEAVKYFNNEKYLSDKYNSSLISYRDSQIKVSQSLAFLNS---- 344

Query: 405 STSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVG 464
             ++I   +   ++  G   V+ G+LT+GDL          +  +  L + Y ++ Q + 
Sbjct: 345 GQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLI 404

Query: 465 AAKRLFDLTDRIPAI----RPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIE 520
             + LF L      I    RP +  + +P D  I F N+ F Y   P+ ++ KN +F I 
Sbjct: 405 DMETLFKLRRNEVKIKNAERPLMLPEHVPYD--ITFENVTFGY--HPDRKILKNASFTIP 460

Query: 521 PGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPV 580
            G    IVG SG GKSTI  L+ R+Y+P SG+ILI+ +DI + +  +LR+ +G+V Q+  
Sbjct: 461 AGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIREYDINALRKVIGVVPQDTP 520

Query: 581 LMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQ 640
           L + +I +N+ +G + +AT +E+  V ++      I K P  ++TI+G  G ++SGG+KQ
Sbjct: 521 LFNDTIWENVKFG-RIDATDEEVMTVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQ 579

Query: 641 RIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRS 700
           R+AIAR L+K  KI+  DEATSALD  +E A+  T      S S T V IAHRL TI  +
Sbjct: 580 RLAIARVLLKNAKIMFFDEATSALDTHTEQALLRTIRSNFTSGSRTSVYIAHRLRTIADA 639

Query: 701 EYIIVLGNDGSVVETGKFKELYADPTS 727
           + IIVL N G V E GK  EL A P S
Sbjct: 640 DKIIVLDN-GRVREEGKHLELLATPNS 665

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  196 bits (498), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 168/583 (28%), Positives = 280/583 (48%), Gaps = 45/583 (7%)

Query: 175 IGMAIPKVIGLVLDALKNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNY 234
           + + +P      +D++ N+  D P    T  LP  A GLT+  +  A  G+++ G + N 
Sbjct: 125 LNVQVPFFFKQTIDSM-NITWDDP----TVALPA-AIGLTIISYGVARFGSVLFGELRN- 177

Query: 235 GRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKV 294
               +   +++  +  +     +  +  D  +    + G L   +      +S+ LT  V
Sbjct: 178 ---AVFAKVAQNAIRTVSLQTFQHLMKLDLGWHLSRQTGGLTRAMDRGTKGISQVLTAMV 234

Query: 295 SDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQE----A 350
              F  I               Q  +       + ++  SIF  K     T  +     A
Sbjct: 235 ---FHIIPISFEISVVCGILTYQFGASFAAITFSTMLLYSIFTIKTTAWRTHFRRDANRA 291

Query: 351 TGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYN----IGKMSAVVNSKFSTST 406
             +   V+ + L   + V+ F  E+    +YN+++ +  +    + +  A +NS      
Sbjct: 292 DNKAASVALDSLINFEAVKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLAFLNS----GQ 347

Query: 407 SVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAA 466
           ++I   +   ++  G   V+ G LT+GDL          +  +  L + Y ++ Q +   
Sbjct: 348 NLIFTTALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDM 407

Query: 467 KRLFDLTD---RIPAI-RPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPG 522
           + LF L     +I ++ RP +  + +P +  I F N+ F Y   P+ ++ KN +F I  G
Sbjct: 408 ETLFKLRKNEVKIKSVERPLMLPEHVPYE--ITFENVTFGY--HPDRKILKNASFTIPAG 463

Query: 523 TSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLM 582
               IVG SG GKSTI  L+ R+Y+P SG+ILI+ +DI + +  +LR+ +G+V Q+  L 
Sbjct: 464 WKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRRVIGVVPQDTPLF 523

Query: 583 SGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRI 642
           + +I +N+ +G + +AT +E++   ++      I K P  +ETI+G  G ++SGG+KQR+
Sbjct: 524 NDTIWENVKFG-RIDATDEEVKTAVQKAQLAPLIKKLPQGFETIVGERGLMISGGEKQRL 582

Query: 643 AIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY 702
           AIAR L+K  +I+  DEATSALD  +E A+  T      S S T V IAHRL TI  ++ 
Sbjct: 583 AIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADADK 642

Query: 703 IIVLGNDGSVVETGKFKELYADPTS----------ELSKLLNE 735
           IIVL N G+V E GK  EL A P S          +LS L NE
Sbjct: 643 IIVLDN-GTVKEDGKHIELLATPGSLYRELWTIQEDLSHLENE 684

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  195 bits (496), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 135/383 (35%), Positives = 205/383 (53%), Gaps = 12/383 (3%)

Query: 350 ATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVI 409
           A  +   V+ + L   + V+ F  E+    +YN ++ + Y   ++    +  F  S   +
Sbjct: 293 ADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLIN-YRDSQIKVSQSLAFLNSGQNL 351

Query: 410 GDMSFLVVLAY-GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKR 468
              S L  + Y G   V+ G LT+GDL          +  +  L + Y E+ Q +   + 
Sbjct: 352 IFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEA 411

Query: 469 LFDLTDRIPAI----RPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTS 524
           LF L      I    RP +  + +P D  I F+N+ F Y   P+ ++ KN +F I  G+ 
Sbjct: 412 LFKLRKNEIKIKNAERPLMLPEHVPYD--ITFQNVTFGY--HPDRKILKNASFTIPAGSK 467

Query: 525 VCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSG 584
             IVG SG GKSTI  L+ R+Y+P SG+ILI+ +DI + +  +LR+ +G+V Q+  L + 
Sbjct: 468 TAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTPLFND 527

Query: 585 SIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAI 644
           +I +N+ +G + +AT +E+  V ++      I K P  + TI+G  G ++SGG+KQR+AI
Sbjct: 528 TIWENVKFG-RIDATDEEVNTVVEKAQLAPLIKKLPQGFNTIVGERGLMISGGEKQRLAI 586

Query: 645 ARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYII 704
           AR L+K  +I+  DEATSALD  +E A+  T      S S T V IAHRL TI  ++ II
Sbjct: 587 ARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIADADKII 646

Query: 705 VLGNDGSVVETGKFKELYADPTS 727
           V  N G V E GK  EL A P S
Sbjct: 647 VFDN-GKVREEGKHLELLATPGS 668

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  194 bits (494), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 130/371 (35%), Positives = 197/371 (53%), Gaps = 9/371 (2%)

Query: 357 VSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLV 416
           ++ + L   + V+ F  E     +YNNA+   Y   ++    +  F  S   +   S L 
Sbjct: 287 IALDSLINFEAVKYFNNESYLASKYNNALM-TYRDAQIKVSQSLAFLNSGQNLIFTSALT 345

Query: 417 VLAY-GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDR 475
            + Y G   +L G+LT+GDL          +  +  L + Y E+ Q +   + LF L   
Sbjct: 346 AMMYMGCTGILGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRRN 405

Query: 476 IPAIRPTIGEKFIPGDGC---IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSG 532
              I+     K +P DG    I F N+ F Y   P+  + KN +F I  G  + IVGPSG
Sbjct: 406 EVVIKNVEQPKMLPADGKPFEIRFENVTFGY--EPDRTILKNASFVIAAGKKIAIVGPSG 463

Query: 533 RGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITY 592
            GKSTI  L+ R+Y+P  G+ILI+  D+ +++  SLR+ +G+V Q+  L + +I +N+ +
Sbjct: 464 SGKSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLRKVIGVVPQDTPLFNDTIWENVRF 523

Query: 593 GLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKP 652
           G + +AT +E+    ++      I+K     +TI+G  G ++SGG+KQR+AIAR L+K  
Sbjct: 524 G-RIDATDEEVWAAVEKAHLSPLISKLSRGTDTIVGERGLMISGGEKQRLAIARVLLKNA 582

Query: 653 KILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSV 712
            I+  DEATSALD  +E  +  T     K+ S T + IAHRL TI  ++ IIVL  DGSV
Sbjct: 583 DIMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIYIAHRLRTIADADKIIVL-EDGSV 641

Query: 713 VETGKFKELYA 723
            E G   EL A
Sbjct: 642 KEEGTHTELLA 652

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  193 bits (491), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 133/387 (34%), Positives = 209/387 (54%), Gaps = 18/387 (4%)

Query: 349 EATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYN----IGKMSAVVNSKFST 404
           +A  +   V+ + L   + V+ F  E+    +YN ++ +  +    + +  A +NS    
Sbjct: 289 KADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAFLNS---- 344

Query: 405 STSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVG 464
             ++I   +   ++  G   V+ G+LT+GDL          +  +  L + Y ++ Q + 
Sbjct: 345 GQNLIFTTALTAMMYMGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLI 404

Query: 465 AAKRLFDLTDRIPAI----RPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIE 520
             + LF L      I    RP +  + +P D  I F N+ F Y   P+ ++ KN +F I 
Sbjct: 405 DMETLFKLRKNEVKIKNAERPLMLPENVPYD--ITFENVTFGY--HPDRKILKNASFTIP 460

Query: 521 PGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPV 580
            G    IVG SG GKSTI  L+ R+Y+P SG+ILI+ +DI + +  +LR+ +G+V Q+  
Sbjct: 461 AGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQDTP 520

Query: 581 LMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQ 640
           L + +I +N+ +G + +AT +E+  V ++      I K P  ++TI+G  G ++SGG+KQ
Sbjct: 521 LFNDTIWENVKFG-RIDATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMISGGEKQ 579

Query: 641 RIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRS 700
           R+AIAR L+K  +I+  DEATSALD  +E A+  T      S S T V IAHRL TI  +
Sbjct: 580 RLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRLRTIADA 639

Query: 701 EYIIVLGNDGSVVETGKFKELYADPTS 727
           + IIVL N G V E GK  EL A P S
Sbjct: 640 DKIIVLDN-GRVREEGKHLELLAMPGS 665

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  192 bits (489), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 132/395 (33%), Positives = 208/395 (52%), Gaps = 12/395 (3%)

Query: 349 EATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSV 408
           +A  +   V+ + L   + V+ F  EQ    +Y+N++   Y   ++    +  F  +   
Sbjct: 288 KADNKAATVAVDSLINFEAVKYFNNEQFLANKYHNSLAQ-YRDSQIKVAQSLAFLNAGQN 346

Query: 409 IGDMSFLVVLAY-GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAK 467
               S L  + Y G   V+ G+L++GDL          +  +  L + Y E+ Q +   +
Sbjct: 347 FIFTSALTAMMYMGCTGVISGTLSVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDME 406

Query: 468 RLFDLTDRIPAI----RPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGT 523
            LF L      I    +P +     P    I F N+ F Y   P+  + KN +F +  G 
Sbjct: 407 SLFQLQRNKVKIQNKEKPLMLSSQRPSK--IVFENVSFGYD--PDRMILKNSSFTMPAGW 462

Query: 524 SVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMS 583
              IVGPSG GKSTI  L+ R+Y+P  G+IL+D +D+ +L+ +SLR+ +G+V Q+  L +
Sbjct: 463 KTAIVGPSGSGKSTILKLVFRFYDPQEGRILVDGKDVRELDIESLRRAIGVVPQDTPLFN 522

Query: 584 GSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIA 643
            SI +N+ +G K  A+ +EIR   ++    + + + P   +TI+G  G ++SGG+KQR+A
Sbjct: 523 DSIWENVRFG-KISASDEEIRLAVEKAQLESLVDQLPKGRDTIVGERGLMISGGEKQRLA 581

Query: 644 IARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYI 703
           IAR L+K   I+  DEATSALD  +E A+  T      + S T V IAHRL TI  ++ I
Sbjct: 582 IARVLLKDAPIMFFDEATSALDTHTEQALLRTIKDNFPTGSKTSVYIAHRLRTIADADKI 641

Query: 704 IVLGNDGSVVETGKFKELYADPTSELSKLLNEKQS 738
           IV+   G V E GK  EL A P S  ++L N +++
Sbjct: 642 IVI-QQGQVKEEGKHAELLAKPGSLYAELWNVQEN 675

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  192 bits (488), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 127/332 (38%), Positives = 183/332 (55%), Gaps = 12/332 (3%)

Query: 413 SFLVVLAY-GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFD 471
           S L  + Y G   V+ G LT+GDL          +  +  L + Y E+ Q +   + LF 
Sbjct: 351 SALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQ 410

Query: 472 LTDRIPAIRPTIGEKFI---PGDGCIE--FRNLGFAYPTRPENQVFKNLNFKIEPGTSVC 526
           L  R   I+   G   I     DG  E  F N+ F Y ++   ++  N +F I  G    
Sbjct: 411 L--RKNEIKIENGTNPIVLKASDGPFEITFENVTFGYDSK--RKILNNASFTIPGGLKTA 466

Query: 527 IVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSI 586
           +VGPSG GKSTI  L+ R+Y+P  G+ILI+  D+ + +  SLR+ MG+V Q+  L + +I
Sbjct: 467 VVGPSGSGKSTILKLVFRFYDPEQGRILINGVDVKEYDVDSLRRVMGVVPQDTPLFNDTI 526

Query: 587 RDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIAR 646
            +N+ +G + +AT +E+  V ++      I K P  YETI+G  G ++SGG+KQR+AIAR
Sbjct: 527 WENVKFG-RIDATDEEVHTVIEKAQLAPLIKKLPQGYETIVGERGMMISGGEKQRLAIAR 585

Query: 647 ALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVL 706
            L+K  KI+  DEATSALD  +E A+  T     +S S T V IAHRL TI  ++ IIVL
Sbjct: 586 VLLKNAKIMFFDEATSALDTHTEQALLTTIRANFESGSRTSVYIAHRLRTIADADKIIVL 645

Query: 707 GNDGSVVETGKFKELYADPTSELSKLLNEKQS 738
             DG+V E G    L A P S  + L N +++
Sbjct: 646 -EDGAVKEEGTHSGLLATPGSLYANLWNIQEN 676

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  195 bits (496), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 159/527 (30%), Positives = 253/527 (48%), Gaps = 34/527 (6%)

Query: 233  NYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFF--DQNKVGDLISRLGSDAYVVSRSL 290
            N+ +  LL   SE  V  LR+ V++K   ++ ++F  + NK  ++ + + +D     R L
Sbjct: 777  NFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISALVLNDL----RDL 832

Query: 291  TQKVSDGFKA----ILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTI 346
               VS+   A    +               +LS   +   P ++I ++I+G  ++   T 
Sbjct: 833  RSLVSEFLSAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSAIYGGILQKCETD 892

Query: 347  LQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTST 406
             + +  QL     + +  +KT++   AE      Y++    +  I    A+      + T
Sbjct: 893  YKTSVAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQIASKRAIATGFGISMT 952

Query: 407  SVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAA 466
            ++I      ++  YG  LV+    T  ++        +T  S   L +   +I +G  AA
Sbjct: 953  NMIVMCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAA 1012

Query: 467  KRLFDLTDRIPAIRP-------TIGEKFIPGDG--------CIEFRNLGFAYPTRPENQV 511
              ++ + D              T+G   I G           +  +NL FAYP+ P   V
Sbjct: 1013 SWIYRILDEKHNTLEVENNNARTVG---IAGHTYHGKEKKPIVSIQNLTFAYPSAPTAFV 1069

Query: 512  FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
            +KN+NF +  G ++ I+G SG GKST+ LLL + YN   G+I ID  D+   N  SLR+ 
Sbjct: 1070 YKNMNFDMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKE 1129

Query: 572  MGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHG 631
            + +V+Q+P+L +G+IRDN+TYGL+ E    E+ +  K    H+F+   P   +T I    
Sbjct: 1130 ISVVEQKPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQGLDTRIDT-- 1187

Query: 632  TLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIA 691
            TLLSGGQ QR+ IARAL++K KILILDE TSALD  S   IN    K     ++  + I 
Sbjct: 1188 TLLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSSIINEIVKK--GPPALLTMVIT 1245

Query: 692  HRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQS 738
            H    +R    I VL  DG VVE G F  LY +   EL ++++ + S
Sbjct: 1246 HSEQMMRSCNSIAVL-KDGKVVERGNFDTLY-NNRGELFQIVSNQSS 1290

 Score =  173 bits (439), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 144/531 (27%), Positives = 250/531 (47%), Gaps = 47/531 (8%)

Query: 243 LSERVVARLRSHVIKKTLHQD-AEFFDQNK--VGDLISRLGSDAYVVSRSLTQKVSDGFK 299
           + ER   R+RS +++  L +   E++D N+  +GD  +++      +  S  +  +  F+
Sbjct: 99  IGERQGFRIRSQILEAYLEEKPMEWYDNNEKLLGDF-TQINRCVEELRSSSAEASAITFQ 157

Query: 300 AILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSE 359
            ++               L+  ++  +P +   A +F + I   S      T +  ++  
Sbjct: 158 NLVAICALLGTSFYYSWSLTLIILCSSPIITFFAVVFSRMIHVYSEKENSETSKAAQLLT 217

Query: 360 EQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVV-- 417
             +N  + V+ +  ++ E +++   I +          + S F  + +  G + FL +  
Sbjct: 218 WSMNAAQLVRLYCTQRLERKKFKEIILNCNTF-----FIKSCFFVAANA-GILRFLTLTM 271

Query: 418 ----LAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFG--LSNFYSEI--MQGVGAAKR- 468
                 +GS ++  G L I D+      T + +  + G  L+N   +I  +Q  G A   
Sbjct: 272 FVQGFWFGSAMIKKGKLNINDVI-----TCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEK 326

Query: 469 ----LFDLTDRIPAIRPTIGEKFIPGDGC---IEFRNLGFAYPTRPENQVFKNLNFKIEP 521
               L D + R P +  T+  +F P D     + F N+ F+YP+RP   V KN++     
Sbjct: 327 IMTLLKDGSKRNP-LNKTVAHQF-PLDYATSDLTFANVSFSYPSRPSEAVLKNVSLNFSA 384

Query: 522 GTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVL 581
           G    IVG SG GKST++ LLLR+Y+  +G I I+  +I  ++ K L + + +V+Q   L
Sbjct: 385 GQFTFIVGKSGSGKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTL 444

Query: 582 MSGSIRDNITYG-----LKREATPDE----IREVSKQCFCHNFITKFPDAYETIIGPHGT 632
            + ++R NI  G        + + +E    I++  +      FI   PD  ET+IG  G 
Sbjct: 445 FNDTLRKNILLGSTDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGV 504

Query: 633 LLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAH 692
            LSGGQ+QR+AIARA I+   IL LDEA SALD+     +        K K+  I++  H
Sbjct: 505 TLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRKGKTTIILT--H 562

Query: 693 RLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKK 743
            LS I   +Y+ ++  +G VVE+G   EL ADPT+  S   + +   ++ K
Sbjct: 563 ELSQIESDDYLYLM-KEGEVVESGTQSELLADPTTTFSTWYHLQNDYSDAK 612

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  191 bits (486), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 128/385 (33%), Positives = 205/385 (53%), Gaps = 7/385 (1%)

Query: 357 VSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLV 416
           ++ + L   + V+ F  EQ    +Y +++ D  N     A   +  ++  ++I   +   
Sbjct: 310 IALDSLINFEAVKYFNNEQYLANKYYSSLVDYRNSQVKVAQSLAFLNSGQNLIFTSALTA 369

Query: 417 VLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRI 476
           ++  G   V+ G+LT+GDL          +  +  L + Y E+ Q +   + LF L    
Sbjct: 370 IMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLRKNE 429

Query: 477 PAIRPTIGEKFIPGDGC---IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGR 533
             I+       +P +     I+F N+ F Y    E ++ KN +F I  G    +VGPSG 
Sbjct: 430 IKIQNVHRPLMLPNELTPFEIKFENVTFGYD--KERKILKNASFTIPAGWKTAVVGPSGS 487

Query: 534 GKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYG 593
           GKSTI  L+ R+Y+P  G+IL++  DI +++  SLR+ +G+V Q+  L + +I +N+ +G
Sbjct: 488 GKSTILKLVFRFYDPEEGRILLNGTDIKEIDLASLRKVIGVVPQDTPLFNDTIWENVKFG 547

Query: 594 LKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPK 653
            + EAT +EI +  ++      I K P   ETI+G  G ++SGG+KQR+AIAR L+K   
Sbjct: 548 -RIEATDNEILQAIEKAQLAPLIKKLPKGRETIVGERGLMISGGEKQRLAIARVLLKNSG 606

Query: 654 ILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVV 713
           I+  DEATSALD  +E ++  T  +     S T V IAHRL TI  ++ IIVL  DG V 
Sbjct: 607 IMFFDEATSALDTHTEQSLLRTIKENFDGSSRTSVYIAHRLRTIADADKIIVL-KDGQVE 665

Query: 714 ETGKFKELYADPTSELSKLLNEKQS 738
           E G  ++L A   S  S+L N +++
Sbjct: 666 EEGTHRQLIAKKESLYSELWNIQEN 690

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  193 bits (490), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 153/526 (29%), Positives = 252/526 (47%), Gaps = 24/526 (4%)

Query: 224  GALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNK--VGDLISRLGS 281
            G  +I  + N+ +  LL + SE  +  LR   +K+ L +  ++F   K    ++ + + +
Sbjct: 777  GITIIDGISNFFKGFLLGICSEYWIMDLRDKFMKEILRKKIQWFSDEKYQTAEMSALILN 836

Query: 282  DAYVVSRSLTQKVSDGFKA----ILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFG 337
            D     R L   VS+   A    I+              +L+   +   P ++I ++I+G
Sbjct: 837  DL----RDLRSLVSEFMSAMATFIVVSLFGLIWALVTGWKLALVCIAMFPLIIIFSAIYG 892

Query: 338  KKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAV 397
              ++   T  + +   L  +  + ++ +KT++S   E      Y  A   + N+    ++
Sbjct: 893  AVLQKSETDYKSSVANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVATKRSI 952

Query: 398  VNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYS 457
                  + T+ I      ++  YG  L++ G  T+  +        +T  +   L N   
Sbjct: 953  YTGLGISITNTITMCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSLVNQIP 1012

Query: 458  EIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDG--------CIEFRNLGFAYPTRPEN 509
            ++ +G  AA  ++ +  +    +       I  D          ++ +NL FAY + P  
Sbjct: 1013 DMSRGQRAASWVYSILQQSDDTKEVNDPNSIIVDNNTISNDFPILDIKNLTFAYESTPSI 1072

Query: 510  QVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLR 569
            +V   L  K+ PG  + I G SG GK+T+  LL+++Y+    QI  + +DI+    +SLR
Sbjct: 1073 KVLDGLTLKLFPGDKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYEFESLR 1132

Query: 570  QYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGP 629
              + IV+Q+P ++SGSIRDN+    KR  +  E+ +V K     +FI   P   +TII  
Sbjct: 1133 DAIVIVEQKPSVLSGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGIDTIIDT 1192

Query: 630  HGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVS 689
              TLLSGGQ QRI IARAL++KPKILILDE TSALD  S   IN    K +    VTI+S
Sbjct: 1193 --TLLSGGQAQRICIARALLRKPKILILDECTSALDAMSADIINNLVSKEL--NGVTIIS 1248

Query: 690  IAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNE 735
            I H  S +   + + VL N G +VE G +  L A  +S L KLL++
Sbjct: 1249 ITHSESMMTSCQNVAVLKN-GKIVEVGTYDSL-ATSSSHLGKLLSK 1292

 Score =  179 bits (453), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 135/510 (26%), Positives = 245/510 (48%), Gaps = 31/510 (6%)

Query: 243 LSERVVARLRSHVIKKTLHQDAEFFDQNKV--GDLISRLGSDAYVVSRSLTQKVSDGFKA 300
           + ER   ++R+ ++   L Q   ++D N+   GD  ++L      +  S  +  +  F+ 
Sbjct: 106 IGERQGIKVRTKILNNYLTQSMTWYDLNEQLQGDF-TQLHRCVEELRSSSAEASAVTFQN 164

Query: 301 ILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEE 360
            +               L+  ++   P + I +  F   I+  + +    T    ++  E
Sbjct: 165 CIAIIALIATSFYYSWSLTLIILCSTPIICIFSICFSIMIQKFANLENNETTVSAQIFTE 224

Query: 361 QLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVL-- 418
            +  ++ ++    + K++ ++  +I       K    +    S +TS++  ++ L+ +  
Sbjct: 225 TIQNIQLIKLNNLQLKKLMKFQTSIS---KCNKFFIQMCLYVSLNTSILRTLTLLMFVQG 281

Query: 419 -AYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFG--LSNFYSEIM---QGVGAAKRLFDL 472
             +GS ++  G L I ++      T +++  + G  +SN   +I+   +G  A +++ D 
Sbjct: 282 FWFGSTMIRKGHLKIDEVI-----TCFSSCLLLGSIISNTLHQIVVLQKGEVALQKIVDF 336

Query: 473 TDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSG 532
            D                +  I F+N+ FAYP+RP   +   +N   +   +  IVG SG
Sbjct: 337 LDEADDPLEINSAPITLINSNISFQNISFAYPSRPNENILNQINLYFQNSATTFIVGKSG 396

Query: 533 RGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITY 592
            GKST++ LLL++Y    G ILIDN +I  LN K+L   + IV+Q+  L + +IR+NI +
Sbjct: 397 SGKSTLSNLLLKFYETYKGDILIDNINIKNLNQKNLLDNIMIVEQKCTLFNDTIRNNILF 456

Query: 593 GL---------KREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIA 643
           G+          R    + ++         +F+   P+  +T+IG  G  LSGGQ+QR+A
Sbjct: 457 GVSNFTNQYASNRPNLNERLKNACTFALLDHFLIDLPNGIDTVIGTGGITLSGGQQQRVA 516

Query: 644 IARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYI 703
           +ARA ++ P ILILDEA SALDV     +     KL +S   TI+ + H L+ I   +++
Sbjct: 517 LARAYMRDPPILILDEAVSALDVNIRELLMKAI-KLWRSNKTTII-LTHDLTQIDNDDFL 574

Query: 704 IVLGNDGSVVETGKFKELYADPTSELSKLL 733
            V+ + G ++E GK KEL  DP +E  KL+
Sbjct: 575 YVIKH-GRIIEHGKRKELITDPNTEFHKLV 603

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  190 bits (482), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 123/328 (37%), Positives = 180/328 (54%), Gaps = 11/328 (3%)

Query: 413 SFLVVLAY-GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFD 471
           S L V+ Y G   ++ G+LT+GDL          +  +  L + Y E+ Q +   + LF 
Sbjct: 372 SALTVMMYMGCTGIIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMEYLFQ 431

Query: 472 LTDRIPAIRPTIGEKFIPGDG-----CIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVC 526
           L    P I   + +  +  +       I F N+ F Y    + ++ KN +F+IE G    
Sbjct: 432 LKKN-PIIIKNVEKPLMLAEKGHMPMTIRFENVTFGYD--KQRKILKNASFQIESGQKTA 488

Query: 527 IVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSI 586
           IVGPSG GKSTI  LL R+Y+P  G+IL++  D  + +  SLR+ +G+V Q+  L + +I
Sbjct: 489 IVGPSGSGKSTILKLLFRFYDPEEGRILVNGVDAREYDIDSLRKVIGVVPQDTPLFNDTI 548

Query: 587 RDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIAR 646
            +N+ +G +  A+ DEI +V  +      + K P   ETI+G  G ++SGG+KQR+AIAR
Sbjct: 549 WENVRFG-RIGASDDEITQVINKAQLGPLLVKLPQGRETIVGERGLMISGGEKQRLAIAR 607

Query: 647 ALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVL 706
            L+K   I+  DEATSALD  +E A+  T  +  K  S T V IAHRL TI  ++ IIVL
Sbjct: 608 VLLKDADIMFFDEATSALDTHTEQALLKTINENFKKGSRTSVYIAHRLRTIADADKIIVL 667

Query: 707 GNDGSVVETGKFKELYADPTSELSKLLN 734
             +G+V E GK  EL A   S   +L N
Sbjct: 668 -QEGTVREEGKHSELLARSGSLYKELWN 694

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  189 bits (479), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 116/316 (36%), Positives = 174/316 (55%), Gaps = 6/316 (1%)

Query: 425 VLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIG 484
           V+ GSLT+GDL          +  +  L + Y E+ Q +   + LF L      I+  + 
Sbjct: 373 VMEGSLTVGDLVLINQLIFQLSLPLNFLGSVYRELKQSLIDMESLFRLQKNKITIKNVLN 432

Query: 485 EKFIPGD--GCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLL 542
            + +P      I F N+ F Y   PE ++ KN  F I  G    IVGPSG GKSTI  L+
Sbjct: 433 PQMLPEKLPSDIRFENVTFGYD--PERKILKNATFTIPAGKKTAIVGPSGSGKSTILRLV 490

Query: 543 LRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDE 602
            R+Y P  G+ILID +DI +++  SLR+ +G+V Q+  L + +I +N+ +G + +A+  +
Sbjct: 491 FRFYEPEQGRILIDGKDIREVDLDSLRKSIGVVPQDTPLFNDTIWENVKFG-RIDASDKD 549

Query: 603 IREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATS 662
           I    ++      I   P    TI+G  G ++SGG+KQR+AI+R L+K   ++  DEATS
Sbjct: 550 ITNAIERAQLTKLIQNLPKGINTIVGERGLMISGGEKQRLAISRVLLKDCPLMFFDEATS 609

Query: 663 ALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELY 722
           ALD  +E ++  T  +  + +S T V IAHRL TI  ++ IIVL N+  V E G  K L 
Sbjct: 610 ALDTHTEQSLLKTINENFEGQSKTSVYIAHRLRTIADADKIIVL-NNSRVHEEGDHKTLL 668

Query: 723 ADPTSELSKLLNEKQS 738
             P S  S+L N ++S
Sbjct: 669 KTPGSLYSELWNIQES 684

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  191 bits (486), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 159/509 (31%), Positives = 247/509 (48%), Gaps = 26/509 (5%)

Query: 240  LRLLSERVVARLRSHVIKKTLHQDAEFF--DQNKVGDLISRLGSDAYVVSRSLTQKVSDG 297
            L  +SE  +  LR+  ++   +++ E+F  D+NK  +L + + +D   +   +++ +S  
Sbjct: 769  LGFVSENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDLRDLRSLISEFISAM 828

Query: 298  FKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRV 357
               I+              +LS   +   P +++ ++I+G  ++   T  +     L   
Sbjct: 829  STFIVVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTVADLENC 888

Query: 358  SEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVV 417
              E + G+KT++    EQ  I+RY+     + +IG+  A+        T+ +      ++
Sbjct: 889  VYEIMLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTALVMCIEAIL 948

Query: 418  LAYGSYLVLHGSLTIGDLT---AFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLF---D 471
              YG  LV  G  T   +      +L+T  T  S   L N   ++ +G  AA R+F   D
Sbjct: 949  FYYGLKLVFIGEYTTMKMFKTFTLLLFTIMTCTS---LINQIPDVTRGQRAASRIFRILD 1005

Query: 472  LTDRIPAIRPTIGE-KFIPGDGCIE----FRNLGFAYPTRPENQVFKNLNFKIEPGTSVC 526
             +DR        G  + IP +  I+      NL F YP+   + VF  LN +I    +V 
Sbjct: 1006 ESDRFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIADNQTVA 1065

Query: 527  IVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSI 586
            +V  SG GKST+  LL R Y      I ID  DI +    SLR  + IV+Q+P L  GSI
Sbjct: 1066 VVAESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPTLFEGSI 1125

Query: 587  RDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIAR 646
            R N+ YG K E    +I +V KQ    +F+T  P+  +T +    +LLSGGQ QRI IAR
Sbjct: 1126 RKNLIYGNKLEIMDMDIYDVLKQVGIFDFVTSLPNGIDTNVDT--SLLSGGQAQRICIAR 1183

Query: 647  ALIKKPKILILDEATSALDVESEGAINYTFGKLMKSK--SVTIVSIAHRLSTIRRSEYII 704
            AL++K KILILDE TSALD ES     +    L+KS    V  ++I H    +R    +I
Sbjct: 1184 ALLRKSKILILDECTSALDAESA----FVIQNLVKSGLPGVLTIAITHSEPMMRACGNVI 1239

Query: 705  VLGNDGSVVETGKFKELYADPTSELSKLL 733
            VL  DG   + G F ELY  P +EL +++
Sbjct: 1240 VL-QDGETAQQGTFDELYK-PGNELHRIV 1266

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 134/577 (23%), Positives = 260/577 (45%), Gaps = 48/577 (8%)

Query: 184 GLVLDALKNVMT----DSPSSLETSDLPPIAFGLTLYPFLG-AFAGALVIGTMCNYGRYI 238
           G V D L N++T    +  S L    +  +A G    P +  + +  + IG   ++    
Sbjct: 47  GKVFDLLANILTMEKDELLSQLTVKSMSLMALGAATIPVMWLSISAWMSIGETQSF---- 102

Query: 239 LLRLLSERVVARLRSHVIKKTLHQDAEFFDQNK--VGDLISRLGSDAYVVSRSLTQKVSD 296
                      R+R  ++   L +  E+FD+N   +GD +        V S S  +  + 
Sbjct: 103 -----------RIRRTILLSYLKKPMEWFDENDQLLGDFVQMHRCVEEVRSGS-AEASAI 150

Query: 297 GFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTR 356
            F+  +               L+  ++  +P +++ A+ F + I + + +  + TG   +
Sbjct: 151 TFQNFVAIIALVCTSFYYSWSLTLIILCSSPLLIVLAAFFSRMIENFTKLENDETGIAAQ 210

Query: 357 VSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKF--STSTSVIGDMS- 413
                +N  + V+ +  +  EI+++   +     I      +N+ F  S +TS++  +S 
Sbjct: 211 SLTWSMNAAQLVKLYCTQDFEIKKFKEIV-----IRCNDYFINAWFYVSANTSILRFLSL 265

Query: 414 --FLVVLAYGSYLVLHGSLTIGD-LTAF--MLYTDYTANSIFGLSNFYSEIMQGVGAAKR 468
             F+    +GS ++    +++   +T F   L      N+         +   G+   + 
Sbjct: 266 AMFVQGFWFGSTMIKKNKMSVDQVITCFSSCLMLGSILNTTLPQIVLLQKAHVGLNRVQD 325

Query: 469 LFDLTDRIPAIR---PTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSV 525
             +    +   R    +I    +P    I F  + F YP+RP++ V KN++   +P  + 
Sbjct: 326 FLEDKSEMATDRDRQTSINLDNVPIS--ISFDAISFCYPSRPDDMVLKNISMNFDPNKTT 383

Query: 526 CIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGS 585
            IVG SG GKST++ LLL++YN  +G I ++  ++  ++   + + + +V+Q+  L + +
Sbjct: 384 FIVGKSGSGKSTMSNLLLKFYNGYNGCIKVNGVNVQSIDRHWITKNVTLVEQKCTLFNDT 443

Query: 586 IRDNITYGLKR----EATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQR 641
           +R+N+  GL      E     ++E  +     N I K P   +T +G  G  LSGGQ+QR
Sbjct: 444 LRNNLLIGLSHISAAEDVDSRLQEACRFALLDNVIEKLPSGLDTKVGSGGVSLSGGQQQR 503

Query: 642 IAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSE 701
           +A+ARA ++   ++ILDEA SALD  +   +        +SK+  I++  H L+ I  S+
Sbjct: 504 VALARAYLRDTPVVILDEAISALDARNRRQLMENIRIWTRSKTAIILT--HELNQILPSD 561

Query: 702 YIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQS 738
           ++ ++ N G + E G   EL  +  S   K  + + S
Sbjct: 562 FLYLMEN-GQIKEEGYQNELIENVESTFCKFFHLQNS 597

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  191 bits (486), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 147/517 (28%), Positives = 249/517 (48%), Gaps = 25/517 (4%)

Query: 233  NYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFF--DQNKVGDLISRLGSDAYVVSRSL 290
            N+ +  +L   SE  +  LR+  +++   +  E+F  ++NK  ++ + L +D   +   +
Sbjct: 765  NFLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDLRSLV 824

Query: 291  TQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEA 350
            +Q +S     +               +LS   +   P +VI + I+G  +++  T  +  
Sbjct: 825  SQFLSVISTFLTVSLVGLIWAIATGWKLSLVCISMFPLIVIFSIIYGTVLKNYETTYKTK 884

Query: 351  TGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIG 410
               L  +  E + GVKT++    +    + Y+    ++  I +  A+V       T+ I 
Sbjct: 885  VANLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAITTAIA 944

Query: 411  DMSFLVVLAYGSYLVLHGSL---TIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAK 467
                 ++  YG  LV+ G     T+      +L+T  T NS+        +I +G  AA 
Sbjct: 945  TTIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNSLISQ---IPDISRGQRAAS 1001

Query: 468  RLFDLTDRIPAIRPT-----------IGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLN 516
             ++ + +     +              GEK       +   NL FAYPT  +  ++ NL+
Sbjct: 1002 WIYRIIEESEDTKEQTITDGRFDEIHCGEKVDKTQPLVSIHNLEFAYPTALDVNIYDNLS 1061

Query: 517  FKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQ 576
              +  G +V IVG SG GKST+  LL + Y  +   I ID  D+ + + ++LR+ + +V+
Sbjct: 1062 LDLNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLRRQISVVE 1121

Query: 577  QEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSG 636
            Q+PVL  G++R+N+ YGL       +I ++ K    ++FI   P+  ET +    +L+SG
Sbjct: 1122 QKPVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLETSVDT--SLISG 1179

Query: 637  GQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLST 696
            GQ QR+ IARAL++KPKILILDE TSALD  S   IN    K     S+  +SI H    
Sbjct: 1180 GQAQRLCIARALLRKPKILILDECTSALDANSSKIINDIVAK--GPPSLLTISITHNEQM 1237

Query: 697  IRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLL 733
            +R    + VL  DG + ETG F +L+  P +EL K++
Sbjct: 1238 MRSCNTVAVL-KDGKICETGPFNKLFK-PGNELYKVV 1272

 Score =  144 bits (363), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 119/429 (27%), Positives = 211/429 (49%), Gaps = 20/429 (4%)

Query: 327 PAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIR 386
           P ++I A IF + I+  + +    +G    +    +N  + ++    + KEI  +     
Sbjct: 185 PLLIILAFIFSRSIQKYAALENTESGLAADLLAWSMNSAQMIKLSCTQLKEIESFEELTL 244

Query: 387 DI--YNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGD-LTAF--MLY 441
               Y I K+S  V +  ST   +   M F+    +G+  +  G+L I D +T F   L 
Sbjct: 245 KCNDYFI-KLSLYVAANISTLRFLSLAM-FVQGFWFGNTEIRKGNLNISDVITCFSSCLM 302

Query: 442 TDYTANSIFGLSNFYSEIMQGVGAAKRLFD-LTDRIPAIRPTIGEKFIPGDGCIEFRNLG 500
              T N+  G   F   + +G  A +++   L D    I  +  ++       I FR++ 
Sbjct: 303 LGSTLNTTLGYLIF---LQKGQVALRKIQSFLNDNKVEIDESALKQIDISKADISFRHVS 359

Query: 501 FAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDI 560
           F+YP+RP + V  +++     G +  IVG SG GKST++ LLL+ Y+   G I I +  I
Sbjct: 360 FSYPSRPADDVLNDISIDFLSGKTTFIVGRSGSGKSTLSNLLLKLYDEYDGYISIGSTHI 419

Query: 561 MKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKRE-----ATPDEIREVSKQCFCHNF 615
            +++ + L + + +V+Q   L + ++ +NI  G + E         +++E  K     + 
Sbjct: 420 REIDQQVLIKNITVVEQRCTLFNDTLVNNILLGSQDEDKSSPVVQKKLKEAIKMACLESV 479

Query: 616 ITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYT 675
           I    +  +TI+G  G  LSGGQ+QR+A+ARA ++  ++LILDEA SALD+     +   
Sbjct: 480 IDSLSNGLDTILGTGGISLSGGQQQRVALARAYMRDTEVLILDEAVSALDIVHREQLMSN 539

Query: 676 FGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNE 735
             K  + ++  I++  H LS I   +Y+ V+  +G ++E+G   +L  DP S   + +N 
Sbjct: 540 ITKWRQGRTTIILT--HELSQISIQDYLYVV-EEGRIIESGFQGQLMYDPDSAFCR-MNI 595

Query: 736 KQSRANKKE 744
            Q+  +K E
Sbjct: 596 LQNVHDKYE 604

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  190 bits (482), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 147/523 (28%), Positives = 248/523 (47%), Gaps = 46/523 (8%)

Query: 224  GALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFF--DQNKVGDLISR--- 278
            G  +   + N+ +Y L    SE  + +LR+ V+++   ++ ++F  +++K  ++ +    
Sbjct: 741  GVAIADAILNFLQYFLFGYCSEYWILQLRNQVMQRISFEELDWFQRERHKASEVSALLLN 800

Query: 279  -------LGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVI 331
                   L SD  +   S     S G    L              +LS   +   P +VI
Sbjct: 801  DLRDLRALASDFLIAVSSFAVVSSVGIIWALIIGW----------KLSLVCISMFPLIVI 850

Query: 332  SASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNI 391
             ++++G  ++   T  + A   L  +  E   G+KT++    E   +R+Y      +  I
Sbjct: 851  FSAVYGMALQRQETQYKSAVVDLENLLYEVATGIKTIRRLQLETNFLRQYKRLESHMRVI 910

Query: 392  GKMSAVVNSKFSTSTSVIGDMSF---LVVLAYGSYLVLHGSLTIGDL---TAFMLYTDYT 445
                A+         +VI  ++     ++  Y   LV+ G  T   +      +L+T  T
Sbjct: 911  ASRRAITTG---LGVAVIEALAMSIQAILFYYALKLVIDGQYTTKKMFETLTLLLFTIMT 967

Query: 446  ANSIFGLSNFYSEIMQGVGAAKRLFDLTD-RIPAIRP------TIGEKFIPGDGCIEFRN 498
             N +        +I +G  AA R+  + D ++   +P      T           I  +N
Sbjct: 968  CNILISQ---VPDISRGQRAANRILQMLDEKLEREKPHQEKKQTTSGSVSESSAVISLQN 1024

Query: 499  LGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQ 558
            + FAYP+ P   +F +L  ++  G +  +VG SG GKST+  LL + Y P+SG +L++N+
Sbjct: 1025 VTFAYPSAPSIHIFDSLYLELPIGRTFALVGQSGSGKSTLVTLLTQLYRPTSGTVLVENK 1084

Query: 559  DIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITK 618
            D+ + N + LR+ M +V+Q P + SG++R+N+ YGL  +    E+ +V +    H+FI+K
Sbjct: 1085 DVNEWNIRDLRRQMSVVEQTPTIFSGTVRENLLYGLHHDPLEVEMYDVLRYVGIHDFISK 1144

Query: 619  FPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGK 678
             P   +T I     LLSGGQ QR+ IARA++K+PKILILDE TSALD  S   IN    +
Sbjct: 1145 LPLGLDTTIDID--LLSGGQLQRLCIARAILKRPKILILDECTSALDPFSSHVINNIVRR 1202

Query: 679  LMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
                 +   +SI H +  ++  + II L N G V  TG F  L
Sbjct: 1203 --GCPAPLTISITHNVDMMKACDEIIFLKN-GRVAGTGSFDAL 1242

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 114/412 (27%), Positives = 209/412 (50%), Gaps = 12/412 (2%)

Query: 326 APAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAI 385
           AP +++    F +K++  + +  E T + +++ +  +   + ++    E +EI+ + N +
Sbjct: 169 APLIIMCGWFFSRKVQRYADLENEQTSKASQLLDWSMTAAQFIRLSGTELREIKSFKNCV 228

Query: 386 RDIYN-IGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDY 444
           ++  N   KM    +   +T   +   M F+    +GS ++  G + IGD+         
Sbjct: 229 QNCTNNFVKMCQYSSINLATLKFLSLAM-FVQAFWFGSTMIRKGKMNIGDVITCFHSCIL 287

Query: 445 TANSIFGLSNFYSEIMQGVGA----AKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLG 500
             ++I G       I +G  A    +K L D       IR      F    G I F+N+ 
Sbjct: 288 LGSTISGTLQQLVIIQKGSVAVNIVSKFLADDKTATTDIRRWQDVPFPELKGDIRFQNVE 347

Query: 501 FAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDI 560
           F+YP+RP++ V ++++     G +  ++G SG GKS+++ LLL++Y   +G I +D ++I
Sbjct: 348 FSYPSRPDHNVLRSISLNFRAGKTTFLLGKSGSGKSSLSNLLLKFYENYTGVISVDGRNI 407

Query: 561 MKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGL---KREATPDEIREVSKQCFCHNFIT 617
             ++   L + + +V+Q   + +G++++NI  G+     E    +++ V +     NFI 
Sbjct: 408 KHIDQSQLIKNITVVEQRCNVFNGTLKENIIIGIDGADEEEILTKLKLVCRISLLENFIH 467

Query: 618 KFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFG 677
              D   T+IG  G  LSGGQ+Q++AIARAL+K P+ILILDE+ SALDV   G I     
Sbjct: 468 DLSDGLNTLIGSGGISLSGGQQQKVAIARALMKDPQILILDESLSALDVLQRGLILRAIR 527

Query: 678 KLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSEL 729
              K K+  I++  H L+ I  +++  ++   G  +E G  + L  DP++  
Sbjct: 528 THRKEKTTIILT--HELNQIGSNDFCYLI-ESGQCIEHGLEETLVNDPSTRF 576

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  189 bits (481), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 141/519 (27%), Positives = 250/519 (48%), Gaps = 17/519 (3%)

Query: 227  VIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFD--QNKVGDLISRLGSDAY 284
            +I   C + +  ++   SE  +  LR  V++   +   E+F   +NK  ++ +   +D  
Sbjct: 761  IIDAFCTFSKTFIMGYCSEYWIMDLRKKVMRTITYNKFEWFQLAENKPSEVSALALNDLR 820

Query: 285  VVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDIS 344
             +   +T+ ++     ++              +LS   +   P +++ + ++G  ++   
Sbjct: 821  DLRTLVTEFLATASTFLVVSTCGLIWALVAGWKLSLVSISMFPLIIVFSGVYGAALQKCE 880

Query: 345  TILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFST 404
            T  + A  QL     E +  +KT++    +     RY+   + + ++G+  +V+      
Sbjct: 881  TDYKSAVAQLENCLYEVVVSMKTIRCLQLQTHFQNRYDRRKQRMLSLGRRRSVITGCGIA 940

Query: 405  STSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVG 464
             T  +      ++  YG  LV+ G  T   +        +T  +   L N   E+ +G  
Sbjct: 941  ITHTLTLCIQAILYYYGIKLVIDGKYTSKKMFEVFTLILFTIMTCTNLINQIPEVTRGQR 1000

Query: 465  AAKRLFDLTDRIPAIRP--TIGEKFIP------GDGCIEFRNLGFAYPTRPENQVFKNLN 516
            AA  ++ +     A R    +  + +P       D  +  ++L FAYP  P   V+++LN
Sbjct: 1001 AATYIYRILKEAAATREHQDMHNRTLPISNTSEKDTMVLVKDLTFAYPATPSKHVYEHLN 1060

Query: 517  FKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQ 576
              ++  TSV +VG SG GKSTI  LL + Y+     I +D  D+ + +  SLR  + +V+
Sbjct: 1061 LNLKSDTSVALVGESGSGKSTIISLLTKLYDVPEKHIYVDGTDLSEWDTNSLRNQISVVE 1120

Query: 577  QEPVLMSGSIRDNITYGLKREATPD-EIREVSKQCFCHNFITKFPDAYETIIGPHGTLLS 635
            Q   L++G+IR+N+TYGL  E T + ++  + K    ++F+++ P+  +TI+     LLS
Sbjct: 1121 QSANLLNGTIRENLTYGLPEEDTTEVDLIGILKLVSIYDFVSRLPNGIDTIVDRD--LLS 1178

Query: 636  GGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLS 695
            GGQ QR+ IARAL+K  +ILILDE TSALD  S   I     K +   +  I++I H   
Sbjct: 1179 GGQAQRLCIARALVKPHRILILDECTSALDALSTNIIIDIVRKGI--PNTLIIAITHDEH 1236

Query: 696  TIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLN 734
             +R  E +++L N G++VE G F EL     SE  K LN
Sbjct: 1237 MMRSCESVLLLKN-GAIVEQGSFVELMQQD-SEFKKCLN 1273

 Score =  149 bits (377), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 85/253 (33%), Positives = 134/253 (52%), Gaps = 13/253 (5%)

Query: 494 IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI 553
           I F N+ F YP R  N   +N++ ++E G    I+G SG GKST+A LLLR+Y   SG I
Sbjct: 343 ITFNNISFKYPCRTSNSAVENVSLRLESGKMTFIIGKSGSGKSTLAKLLLRFYEEYSGSI 402

Query: 554 LIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEI-------REV 606
            +DN  I  LN + L   + +V+Q   L + ++R+NI  G + ++ P  +       R++
Sbjct: 403 TVDNISICDLNQEWLLSNITVVEQNCTLFNDTLRNNILLGSENQSEPARMESIEERERKL 462

Query: 607 SKQC---FCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSA 663
            K C     +  +    D  +T+IG  G  LSGGQ+QR+A+ARA ++   I+I DE+ SA
Sbjct: 463 RKACNFALLNEMLADLTDGLDTVIGSGGVELSGGQRQRVALARAFLRNTPIMIFDESVSA 522

Query: 664 LDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYA 723
           LDV     +        + K  T + + H LS I  +++I ++ + G V E G  ++L  
Sbjct: 523 LDVAHRKLLMKAIRSWRQGK--TTIVLTHELSQINPTDFIYIMEH-GRVCEYGYQEDLLK 579

Query: 724 DPTSELSKLLNEK 736
             TS  S+    +
Sbjct: 580 SETSYFSRFYQHQ 592

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  188 bits (477), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 158/528 (29%), Positives = 250/528 (47%), Gaps = 40/528 (7%)

Query: 233  NYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFF--DQNKVGDLISRLGSDAYVVSRSL 290
            N+ +  LL   SE  +  LR+ ++ K   ++  +F  + NK  ++ + + +D     R L
Sbjct: 778  NFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITALVLNDL----RDL 833

Query: 291  TQKVSDGFKA----ILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTI 346
               VS+   A    +               +LS   +   P +VI ++I+G  ++   T 
Sbjct: 834  RSLVSEFLSAMTSFVTVSTIGLVWALVSGWKLSLVCISMFPLIVIFSAIYGGILQKYETD 893

Query: 347  LQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTST 406
             + +  QL     + +  +KT++   AE      Y++  + +  I    A+      + T
Sbjct: 894  YKTSVAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYKRAIATGFGISVT 953

Query: 407  SVIGDMSFLVVLAYGSYLVL---HGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGV 463
            ++I      ++  YG  LVL   + S  + +    +L+T  +  S+ G      +I +G 
Sbjct: 954  NMIAMCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVGQ---IPDISRGQ 1010

Query: 464  GAAKRLFDLTD-------------RIPAIRPT--IGEKFIPGDGCIEFRNLGFAYPTRPE 508
             AA  ++ + D             R   I      G++ IP    I  RNL FAYP+ P 
Sbjct: 1011 RAASWIYRILDEEEDTLEIENNDARALDISGAEYYGDRNIP---IISIRNLSFAYPSAPN 1067

Query: 509  NQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSL 568
              +FK+++  +    ++ IVG SG GKST+ALLL R YN  +  I+ID  D+   N  SL
Sbjct: 1068 VPIFKHMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIIDGTDVNDWNLTSL 1127

Query: 569  RQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIG 628
            R+ + +V+Q+P    GSIRDN+TYG   E    EI +V K    ++F+   P   +T + 
Sbjct: 1128 RKQISVVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFVASLPQGLDTRVD 1187

Query: 629  PHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIV 688
             +  LLSGGQ QR+ IARAL++K KILILDE TSALD  S   IN    K      +  +
Sbjct: 1188 TN--LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIINDIVRK--GPPGLLTL 1243

Query: 689  SIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEK 736
             I H    +R    I VL + G VVE G F  LY +   EL +++  K
Sbjct: 1244 VITHSEQMMRCCNSIAVLKH-GKVVEEGNFDNLY-NKEGELFRIVCNK 1289

 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 90/245 (36%), Positives = 128/245 (52%), Gaps = 12/245 (4%)

Query: 496 FRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILI 555
           F N+ FAYP+RP   V +N+N K   G    IVG SG GKSTI+ LLL +Y+   G ILI
Sbjct: 360 FENVSFAYPSRPSETVLQNVNLKFPSGQFTFIVGKSGSGKSTISNLLLNFYDNYDGSILI 419

Query: 556 DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYG---------LKREATPDEIREV 606
           + ++   +  K L   + +V+Q   L + +++ NI  G                + I++ 
Sbjct: 420 NGRNTQSIQQKLLVSNITVVEQRCTLFNDTLKKNILLGSTGSIGNADTNTIGNNNLIKDA 479

Query: 607 SKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDV 666
            +       I   PD  ET+IG  G  LSGGQ+QR+AIARA I+   IL LDEA SALD+
Sbjct: 480 CRMALLDRLILDLPDGLETLIGSGGVSLSGGQQQRVAIARAFIRDTPILFLDEAVSALDI 539

Query: 667 ESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPT 726
                +        K K+  I++  H LS I   +++ V+  +G VVE+G   EL AD  
Sbjct: 540 VHRNLLMKAIRHWRKGKTTIILT--HELSQIESDDHLYVM-QEGRVVESGIQSELLADSA 596

Query: 727 SELSK 731
           +  SK
Sbjct: 597 TTFSK 601

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  183 bits (465), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 133/423 (31%), Positives = 220/423 (52%), Gaps = 21/423 (4%)

Query: 328 AVVISASIFGKKIRDISTILQ----EATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNN 383
           A ++  SIF  K+    T  +    +A  +   V+ + L   + V+ F  E     +Y+N
Sbjct: 260 ATMLLYSIFTIKVTAWRTAFRRDANKADNKAASVALDSLINFEAVKHFNNENYLAGKYHN 319

Query: 384 AI---RDI-YNIGKMSAVVNSKFS-TSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAF 438
           ++   RD    I +  A +N+  +   TS +  M ++     G   V+ G LT+GDL   
Sbjct: 320 SLMKYRDSQVKIAQSLAFLNAGQNFIFTSALSAMMYM-----GCTGVIGGDLTVGDLVLI 374

Query: 439 MLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGC---IE 495
                  +  +  L + Y E+ Q +   + LF+L +    I        +P +     I+
Sbjct: 375 NQLVFQLSVPLNFLGSVYRELKQSLIDMEALFNLRNNKIKIHNNDKPLMLPENAGPFEIK 434

Query: 496 FRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILI 555
           F N+ F Y TR   ++ +N +F I  G    IVGPSG GKSTI  L+ R+Y+P SG++L+
Sbjct: 435 FENVTFGYDTR--RKILRNASFTIPAGVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLV 492

Query: 556 DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNF 615
           + +D+ + +  S R+ +G+V Q+  L + +I +N+ +G + +AT DE+    ++      
Sbjct: 493 NGKDVREYDLDSFRKVIGVVPQDTPLFNDTIWENVKFG-RIDATDDEVTNAIEKAQLAPL 551

Query: 616 ITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYT 675
           I K P    TI+G  G ++SGG+KQR+AIAR L+K  +I+  DEATSALD  +E ++  T
Sbjct: 552 IHKLPVGSATIVGERGLMISGGEKQRLAIARVLLKNSQIMFFDEATSALDTHTEQSLLKT 611

Query: 676 FGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNE 735
             +     S T V +AHRL TI  ++ I+VL  +G V E G   EL + P S   +L + 
Sbjct: 612 IRENFDRGSRTSVYVAHRLRTIADADKILVL-EEGCVREEGSHTELLSRPNSLYKQLWDI 670

Query: 736 KQS 738
           +++
Sbjct: 671 QEN 673

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
           YKL209C
          Length = 1293

 Score =  185 bits (470), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 136/456 (29%), Positives = 229/456 (50%), Gaps = 46/456 (10%)

Query: 318 LSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKE 377
           L+  ++  AP +++ A +F   I   + +    TG+  ++    +N  + V+ +  +  E
Sbjct: 176 LTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAAQLLNWSMNSAQLVKLYCTQAYE 235

Query: 378 IRRYNNAIRDIYNIGKMSAVVNSKF--STSTSVIGDMS---FLVVLAYGSYLVLHGSLTI 432
           I  +   +    ++      + S F  S +TS++  +S   F+    +G+ +V  G L+I
Sbjct: 236 IHSFKELVGQCNDL-----FIKSCFYVSANTSILRFLSLSMFVQGFWFGAIMVKKGKLSI 290

Query: 433 GDLTAFMLYTDYTANSIFG--LSNFYSEIM---QGVGAAKRLFDL---TDRIPAIRPTIG 484
            D+      T + +  + G  L+N   +I+   +G  A K++ D    + R P++ P   
Sbjct: 291 KDVI-----TCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDFISFSQRSPSLEPPYE 345

Query: 485 EKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLR 544
                 +G I F+N+ FAYPTRP   V K+++   +PG S  I+G SG GKST+A LLL+
Sbjct: 346 PSVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFIIGKSGSGKSTLANLLLK 405

Query: 545 YYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGL---KREATPD 601
           +YN   G I I N ++ K+N   L + + +V+Q   L + ++R+N+  G+    ++   D
Sbjct: 406 FYNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRNNLLLGISNSNQKVEQD 465

Query: 602 EI------REVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKIL 655
           +I      ++  +       I + PD  +TIIG  G  LSGGQ+QR+AIARA IK   +L
Sbjct: 466 DIEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQQQRVAIARAYIKDSSVL 525

Query: 656 ILDEATSALDVESEGAI-----NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDG 710
           ILDEA SALD+     I     N+  GK       T + + H LS +   +++ V   DG
Sbjct: 526 ILDEAVSALDIIHRELIMKAIKNWRSGK-------TTIILTHDLSQLDYDDFLYVF-EDG 577

Query: 711 SVVETGKFKELYADPTSELSKLLNEKQSRANKKEAP 746
            V E+G  + L  D  +  SKL  + Q R +   +P
Sbjct: 578 EVKESGYQQALLQDEKTIFSKLY-DIQMRKHMSYSP 612

 Score =  166 bits (420), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 137/518 (26%), Positives = 243/518 (46%), Gaps = 23/518 (4%)

Query: 233  NYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFF--DQNKVGDLISRLGSDAYVVSRSL 290
            N+ +  +L   SE  +  LR+  +   +++  ++F  ++NK  +L + L +D   +   +
Sbjct: 782  NFLKSYILGYCSELWIMDLRNEAMAAIMNKRLDWFSKEENKSSELSALLLNDLRDLRSLV 841

Query: 291  TQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEA 350
            ++ +S     I+              +LS   +   P +++ + I+G  ++   T+ + A
Sbjct: 842  SEFLSAMTTFIVVSLVGLIWALVSGWKLSLVCISMFPLIILVSGIYGSTLQRYETMYKTA 901

Query: 351  TGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIG 410
              +L     E +  +KT++   A +  I+ Y     ++  I    ++      + T+ I 
Sbjct: 902  VAELENHEYEIMTKIKTIRYLQASKYFIKNYKVLENNLKKIAHKRSIATGFGISITNTIA 961

Query: 411  DMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLF 470
                 ++  YG  LV  G  +   +        +T  S   L +   +I +G  AA  L+
Sbjct: 962  VCIQSILYYYGLRLVFKGEYSSKKMFETFTLLLFTIISCTSLVSQIPDISRGQRAASWLY 1021

Query: 471  DLTDRIPAIRPTI------GEKFIPGDG----CIEFRNLGFAYPTRPENQVFKNLNFKIE 520
             + D     + ++       +  I G+      I  +NL F+YP+    +++KN+   + 
Sbjct: 1022 RILDESDDNKESVDSGSRSADIIISGNTNSVPLISIKNLRFSYPSAQTVEIYKNITLHVT 1081

Query: 521  PGT-SVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEP 579
                ++ IVG SG GKST+  LL + Y   +  I ID  D+ + +   LR+ + +V+Q P
Sbjct: 1082 SSQKTIGIVGESGSGKSTLMYLLTKLYKTPANSIYIDGTDVNEWDTLKLRKQISVVEQNP 1141

Query: 580  VLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQK 639
             L  G++RDN+ YG   + +  EI +V K    + FI   P   ++ I     L+SGGQ 
Sbjct: 1142 TLFEGTVRDNLVYGTLNDISEIEIYDVLKYLGIYEFIENLPMGLDSRIDTK--LVSGGQA 1199

Query: 640  QRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSK--SVTIVSIAHRLSTI 697
            QR+ IARAL++KP ILILDE TSALD  S   IN     L+K+   +V  + I H    +
Sbjct: 1200 QRLCIARALLRKPTILILDECTSALDAASAHLIN----NLVKNGLPTVLTIVITHSKQMM 1255

Query: 698  RRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNE 735
                 + V+  DG + E G F EL  +  SEL +++NE
Sbjct: 1256 EACNSLAVI-KDGRLAEQGNFAELMKN-NSELRRIINE 1291

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  182 bits (461), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 126/391 (32%), Positives = 199/391 (50%), Gaps = 19/391 (4%)

Query: 357 VSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLV 416
           ++ + L   + V+ F  EQ    +YN +++  Y   ++    +  F  S   +   S L 
Sbjct: 314 IALDSLINFEAVKYFNNEQYLASKYNTSLKS-YTEAQVKVAQSLAFLNSGQNLIFTSALT 372

Query: 417 VLAY-GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDL--- 472
            + Y G   +L G+L++GDL          +  +  L + Y ++ Q +   + LF L   
Sbjct: 373 AMMYMGCTGILGGNLSVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMESLFKLRKN 432

Query: 473 -----TDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCI 527
                 ++ PAI          G   IEF+N+ F Y   P  ++ +N +F I  G    +
Sbjct: 433 EVKILNNKNPAIL-----SLKDGPFNIEFKNVTFGYD--PNRKILRNASFIIPAGVKTAV 485

Query: 528 VGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIR 587
           VGPSG GKSTI  L+ R+Y+P  G++L++  D+   +  SLR+ +G+V Q+  L + +I 
Sbjct: 486 VGPSGSGKSTILKLVFRFYDPEEGRVLVNGIDVRDYDLDSLRRAIGVVPQDTPLFNDTIW 545

Query: 588 DNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARA 647
           +N+ +G    AT ++I    ++      I K P  YETI+G  G ++SGG+KQR+AIAR 
Sbjct: 546 ENVKFG-DVTATDEQILNAVEKAQLGTLIEKLPKKYETIVGERGLMISGGEKQRLAIARV 604

Query: 648 LIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLG 707
           L+K   I+  DEATSALD  +E  +  T        S T V IAHRL T+  S+ IIVL 
Sbjct: 605 LLKNAPIMFFDEATSALDTHTEQELLKTIKNNFDKGSRTSVYIAHRLRTVADSDKIIVL- 663

Query: 708 NDGSVVETGKFKELYADPTSELSKLLNEKQS 738
            +GS+ E G    L + P S    L N +++
Sbjct: 664 KEGSIFEEGTHLGLLSKPNSLYKDLWNIQEN 694

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  181 bits (459), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 121/333 (36%), Positives = 180/333 (54%), Gaps = 11/333 (3%)

Query: 413 SFLVVLAY-GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFD 471
           S L ++ Y G   V+ G+LT+GDL          +  +  L + Y E+ Q +   + LF 
Sbjct: 383 SALTMMMYLGCTGVIEGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQ 442

Query: 472 LTDRIPAIRPT------IGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSV 525
           L      I+        I  K   G   I+F N+ F Y T    ++ KN +F I  G   
Sbjct: 443 LRKNPIKIQNAKTGPAPIMLKSSDGPFEIKFENVTFGYDT--NRKILKNASFIIPAGLKT 500

Query: 526 CIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGS 585
            +VGPSG GKSTI  L+ R+Y+P  G++LI+  ++ + +  SLR+ MG+V Q+  L + +
Sbjct: 501 AVVGPSGSGKSTILKLVFRFYDPEEGRVLINGINVQRYDIDSLRRVMGVVPQDTPLFNDT 560

Query: 586 IRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIA 645
           I +N+ +G +  A  +EI++V ++      I K P   +TI+G  G ++SGG+KQR+AIA
Sbjct: 561 IWENVKFG-RINANDEEIKQVIEKAQLAPLIEKLPQREKTIVGERGLMISGGEKQRLAIA 619

Query: 646 RALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIV 705
           R L+K   I+  DEATSALD  +E A+  T      S + T + IAHRL TI  ++ IIV
Sbjct: 620 RVLLKDANIMFFDEATSALDTHTEQALLNTIRANFPSGTRTSIYIAHRLRTIADADKIIV 679

Query: 706 LGNDGSVVETGKFKELYADPTSELSKLLNEKQS 738
           L  DG V E G   EL A   S  S L N +++
Sbjct: 680 L-EDGKVKEEGSHNELLATKGSLYSNLWNIQEN 711

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  179 bits (455), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 141/519 (27%), Positives = 242/519 (46%), Gaps = 22/519 (4%)

Query: 227  VIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFF--DQNKVGDLISRLGSDAY 284
            V+ +   + +   L   SE  +  LR   I+K   QD  +F  D NK  ++ + + +D  
Sbjct: 801  VLDSTFTFLKNFFLGYCSEYWIRDLRMLAIRKITAQDLHWFSLDMNKSSEISALVLNDLR 860

Query: 285  VVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDIS 344
             +   +++ +S     I+              +LS   +   P  ++ +  +G  ++   
Sbjct: 861  DLRSLVSEFLSSISTLIIVSSVGIVWAFISGWKLSLVCISLFPIFILFSCFYGGLLQRYE 920

Query: 345  TILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFST 404
            T  +    +L     E   G+ T++    E + + +Y N  + +    K  A+       
Sbjct: 921  TDYKTKVAELENQLHEIFRGITTIRYLKLEYQFLEKYYNLEKKMRRASKKRAITIGFGVA 980

Query: 405  STSVIGDMSFLVVLAYGSYLVLHGSLT---IGDLTAFMLYTDYTANSIFGLSNFYSEIMQ 461
            +++ +      ++  YG  LV  GS +   + +    +L+T  T  S+ G      +I +
Sbjct: 981  ASNTLTLAVQAILFYYGIKLVTTGSYSTEKMFETFTLLLFTVMTCVSLIGQ---IPDISR 1037

Query: 462  GVGAAKRLFDLTD-RIPAIR---PTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNF 517
            G  AA  +F + D + PA +     I       D  I  +NL F+YP+ P   ++K L  
Sbjct: 1038 GQRAATYIFRIIDNQSPAAKDEKKKIASYKFTHDPLISVKNLSFSYPSAPSTAIYKGLKL 1097

Query: 518  KIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQ 577
             +  G ++ +VG SG GKST+ LL+   Y   +G I ID  DI + +   LR  + +V+Q
Sbjct: 1098 DVFSGETIAVVGESGSGKSTLTLLISALYEVPNGSIEIDGIDINRWDTNKLRTIISVVEQ 1157

Query: 578  EPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGG 637
            +P    G++ +N+ YG+    T  +++E        +F+   P+  +T I    +L+SGG
Sbjct: 1158 KPQFFDGTVGENLLYGISGRVTQIQVKEALCLAGVQDFVFSLPEGLDTRIDT--SLISGG 1215

Query: 638  QKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSK--SVTIVSIAHRLS 695
            Q QR++IARA+++KPKIL LDE TSALD  +  AI      L+K     +T + I H   
Sbjct: 1216 QAQRLSIARAMLRKPKILFLDECTSALDTSNTHAI----ANLIKKHFCGITTIVITHNEQ 1271

Query: 696  TIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLN 734
             +R  E I VL N G V E G F +LYA    E  +++N
Sbjct: 1272 MMRACERIAVLQN-GKVAEDGSFDDLYAQR-GEFFRIMN 1308

 Score =  136 bits (342), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 118/440 (26%), Positives = 207/440 (47%), Gaps = 31/440 (7%)

Query: 322 LVIFA--PAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIR 379
           LVI A  P +++ + I  K I   + +    + +  ++     +  + ++ F  +Q EI 
Sbjct: 182 LVIMAGVPIIIVFSVILSKLIERFTRLENMESSRAAQMVSWSFDAAEMIRLFCTQQFEIE 241

Query: 380 RYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFM 439
           ++  +++         ++ +S             F+    +G+ ++  G LT GD+    
Sbjct: 242 KFELSVKKCTKYFIRISLFSSASYAMLRFFTLCMFIQGFWFGNKMIRQGVLTTGDVI--- 298

Query: 440 LYTDYTANSIFG--LSNFYSEIM---QGVGAAKRLFDLT---DRIPAIRPTI-------- 483
             T +++  + G  L+N   +++   +G  A  ++   T   +  P  R  I        
Sbjct: 299 --TCFSSCLLLGNTLNNTLQQVITMQKGKVALGKILMFTSEENDFPDHRNEIISDAFILN 356

Query: 484 ---GEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIAL 540
                KF  G G I F+N+ F+YPTRP   V KN++       +  IVG SG GKSTI  
Sbjct: 357 HINANKFRCG-GEISFKNVSFSYPTRPNYHVLKNVSLNFPKNKTTFIVGKSGSGKSTIGK 415

Query: 541 LLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATP 600
           LLL+ Y   +G I +D  DI  +    L + + +V+Q   L + +I++NI  G K +A  
Sbjct: 416 LLLKSYGGYTGAIEVDGIDIQHIKTSWLAENITLVEQSCTLFNDTIKNNILLGCKGKAYG 475

Query: 601 DE-IREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDE 659
           D  +RE  +       I   P+  +T++G  G  LSGGQKQR+A+ARA ++   ILILDE
Sbjct: 476 DSLVREACQMALLDRLIFDLPNGLDTVLGSGGVSLSGGQKQRVALARARVRDSPILILDE 535

Query: 660 ATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFK 719
           A S +D+     +     K    K +T V + H L+ I   +Y+  +  +G + E+G   
Sbjct: 536 AISGMDIIHRDLLVEAIKKW--RKGMTTVIVTHELTQISDEDYLYFM-EEGQIRESGFKC 592

Query: 720 ELYADPTSELSKLLNEKQSR 739
            L  +  S  ++L   ++++
Sbjct: 593 NLEKNENSHFNRLWRLQKAK 612

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  176 bits (447), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 110/305 (36%), Positives = 163/305 (53%), Gaps = 6/305 (1%)

Query: 425 VLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIG 484
           V+ GSLT+GDL          +  +  L + Y ++ Q +   + LF L      I+ +  
Sbjct: 364 VMQGSLTVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSLIDMESLFKLQKNQVTIKNSPN 423

Query: 485 EKFIPGDG--CIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLL 542
            + +P      I F N+ F Y   PE ++  N++F I  G    IVGPSG GKSTI  L+
Sbjct: 424 AQNLPIHKPLDIRFENVTFGYD--PERRILNNVSFTIPAGMKTAIVGPSGSGKSTILKLV 481

Query: 543 LRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDE 602
            R+Y P  G+IL+   DI  L+  SLR+ +G+V Q+  L + +I +N+ +G    ++ DE
Sbjct: 482 FRFYEPEQGRILVGGTDIRDLDLLSLRKAIGVVPQDTPLFNDTIWENVKFG-NISSSDDE 540

Query: 603 IREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATS 662
           I    ++      +   P    T++G  G ++SGG+KQR+AIAR L+K   ++  DEATS
Sbjct: 541 ILRAIEKAQLTKLLQNLPKGASTVVGERGLMISGGEKQRLAIARVLLKDAPLMFFDEATS 600

Query: 663 ALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELY 722
           ALD  +E A+ +T  +   S S T V +AHRL TI  ++ IIVL   GSV E G    L 
Sbjct: 601 ALDTHTEQALLHTIQQNFSSNSKTSVYVAHRLRTIADADKIIVL-EQGSVREEGTHSSLL 659

Query: 723 ADPTS 727
           A   S
Sbjct: 660 ASQGS 664

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  177 bits (448), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 126/378 (33%), Positives = 197/378 (52%), Gaps = 15/378 (3%)

Query: 357 VSEEQLNGVKTVQSFVAEQKEIRRYNNAI---RDI-YNIGKMSAVVNSKFSTSTSVIGDM 412
           V+ + L   + V+ F  E     +Y+N++   RD    + +  A +NS      S+I   
Sbjct: 325 VALDSLINFEAVKYFNNESYLANKYHNSLIKYRDSQVKVAQSLAFLNS----GQSLIFTT 380

Query: 413 SFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDL 472
           +   ++  G   V+ G LT+GDL          +  +  L + Y E+ Q +   + LF L
Sbjct: 381 ALTGMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKL 440

Query: 473 TDRIPAIRPTIGEKFI-PGDG--CIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVG 529
                 I+     K I   DG   I+F N+ F Y    + ++ KN +F I  G    I G
Sbjct: 441 RKNQVKIQNCSQPKSISKSDGPFEIKFENVTFGYD--GQRKILKNASFTIPAGMKTAIAG 498

Query: 530 PSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDN 589
           PSG GKST+  L+ R+Y+P  G++L++  D+ + +   LR+ +G+V Q+  L + +I +N
Sbjct: 499 PSGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYDIDQLRKAIGVVPQDTPLFNDTIWEN 558

Query: 590 ITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALI 649
           + +G + EA+ +EI  V  +    + I K P    TI+G  G ++SGG+KQR+AIAR L+
Sbjct: 559 VKFG-RIEASDEEITRVIDKAQLSDLIAKLPQGSSTIVGERGLMISGGEKQRLAIARVLL 617

Query: 650 KKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGND 709
           K   I+  DEATSALD  +E ++  T  +   S   T V IAHRL TI  ++ IIVL  +
Sbjct: 618 KDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEKTSVYIAHRLRTIADADKIIVL-EE 676

Query: 710 GSVVETGKFKELYADPTS 727
           G+V E G  +EL A   S
Sbjct: 677 GTVREEGTHQELLARENS 694

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  179 bits (453), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 147/510 (28%), Positives = 232/510 (45%), Gaps = 27/510 (5%)

Query: 233  NYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFF--DQNKVGDLISRLGSDAYVVSRSL 290
            N+ +  LL   SE  +  LR+ +++K   ++  +F  + NK  ++ + + +D     R L
Sbjct: 778  NFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGENNKAAEISALVMNDL----RDL 833

Query: 291  TQKVSDGFKA----ILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTI 346
               VS+   A    I               +LS   +   P ++I + I+G  ++   T 
Sbjct: 834  RSLVSEFLSAMTSFITVSTIGLVWALISGWKLSLVCISMFPLIIIFSVIYGSSLQTYETD 893

Query: 347  LQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTST 406
             + +  QL     + +  +KT++   AE      Y++    +  I    A+      + T
Sbjct: 894  YKSSVAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKMEGIASKRAIATGFGVSMT 953

Query: 407  SVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAA 466
            ++I      ++  YG  LV+    T   + A      +T  S   L     +I +G  AA
Sbjct: 954  NMIAMCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMSCTTLVGQIPDISRGQRAA 1013

Query: 467  KRLFDLTDRIPA---IRPTIGEKFIPGDGC---------IEFRNLGFAYPTRPENQVFKN 514
              ++ + D       I    G       G          +  +NL FAYP+ P   ++K 
Sbjct: 1014 SWIYRILDEAECTLEIEDNNGRVLGISGGTYYGNSNKPIVSIQNLTFAYPSAPNISIYKR 1073

Query: 515  LNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGI 574
            ++  +  G +V IVG SG GKST+ LLL   Y    G I ID  D+   N  SLR+ + +
Sbjct: 1074 MDLNMFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEIDGTDVNDWNLTSLRREISV 1133

Query: 575  VQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLL 634
            V+Q+P L  GSIRDN+TYG   +    E+ +  K    ++F+   P + +T I  +  LL
Sbjct: 1134 VEQKPSLFDGSIRDNLTYGCLGQMPDFELYDALKYVGIYDFVASLPQSLDTRIDTN--LL 1191

Query: 635  SGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRL 694
            SGGQ QR+ IARAL++K KILILDE TSALD  S   IN    K     ++  + I H  
Sbjct: 1192 SGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIINDIVKK--GPPALLTMVITHNE 1249

Query: 695  STIRRSEYIIVLGNDGSVVETGKFKELYAD 724
              +R    ++V   DG +VE G F  LY D
Sbjct: 1250 EMMRCCSSVVVF-KDGKIVEEGSFDTLYND 1278

 Score =  163 bits (412), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 141/533 (26%), Positives = 249/533 (46%), Gaps = 51/533 (9%)

Query: 243 LSERVVARLRSHVIKKTLHQD-AEFFDQNK--VGDLISRLGSDAYVVSRSLTQKVSDGFK 299
           + ER   R+RS +++  L +   E++D N+  +GD  +++      +  S  +  +  F+
Sbjct: 100 IGERQGFRIRSMLLEAYLKKKPIEWYDANETLLGDF-TQINRCVEELRSSSAEASAITFQ 158

Query: 300 AILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSE 359
            ++               L+  ++  +P + + A  F + I   +      TG+  ++  
Sbjct: 159 NLVAICALIGTSFFYSWSLTLIILCSSPIIALFAVAFCRMIHIYTKKENTETGKAAQLLT 218

Query: 360 EQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVV-- 417
             +N  + V+ +  +  E +++   + +          + S F  + +  G + FL +  
Sbjct: 219 WSMNAAQLVRLYCTQPLERKKFEEIVSNCNTF-----FIKSCFYLAANA-GVLRFLTLTM 272

Query: 418 ----LAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFG--LSNFYSEIM---QGVGAAKR 468
                 +GS ++  G L I D+      T + +  + G  L+N   +I+   +G  A ++
Sbjct: 273 FVQGFWFGSTMIRKGRLNINDVI-----TCFHSCIMLGTTLNNTLHQIVVLQKGEVALEK 327

Query: 469 LFDL---------TDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKI 519
           +  L         ++ I   +P I   +  GD  + F N+ FAYP+RP   + +N   K 
Sbjct: 328 IMTLLENGPKRNTSNTIELYQPLI--DYATGD--LVFENVSFAYPSRPTETILQNAGIKF 383

Query: 520 EPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEP 579
             G    IVG SG GKSTI+ LLL++Y+   G I I+ ++I  +  KSL + + +V+Q  
Sbjct: 384 PGGQFTFIVGKSGSGKSTISNLLLKFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRC 443

Query: 580 VLMSGSIRDNITYGLK---REATPDE------IREVSKQCFCHNFITKFPDAYETIIGPH 630
            L + ++++NI  G     R A  +       I+E  +       I   PD  ETIIG  
Sbjct: 444 TLFNNTLKNNILLGSTGSIRNADSNTIDNNNLIKEACRMALLDRLILDLPDGLETIIGSG 503

Query: 631 GTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSI 690
           G  LSGGQ+QR+AIARA I+   IL LDEA SALD+     +        K K+  I++ 
Sbjct: 504 GITLSGGQQQRVAIARAFIRDTPILFLDEAISALDIVHRNLLMKAIRHWRKGKTTIILT- 562

Query: 691 AHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKK 743
            H+LS I   +Y+ ++  DG V+E+G   EL  D T+  SK  + ++   + K
Sbjct: 563 -HQLSQIEADDYLYLM-QDGKVIESGIQSELLVDSTTTFSKWYHLQEDYFDAK 613

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  178 bits (451), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 148/526 (28%), Positives = 250/526 (47%), Gaps = 34/526 (6%)

Query: 219  LGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQ--NKVGDLI 276
            L   A AL  GT  N+ +  +L   SE  +  LR+ +++    +  E++ +  NK  ++ 
Sbjct: 726  LIVLAIALADGTF-NFIKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYGRSSNKSSEIS 784

Query: 277  SRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIF 336
            +   +D   +   +T+ +S     +               +LS   +   P ++I + I+
Sbjct: 785  ALALNDLRDLRTLVTEFLSTMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIY 844

Query: 337  GKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSA 396
            G  +++  T  + A   L  +  E +  +KT++        +  Y+   + +  I K   
Sbjct: 845  GTVLQNYETSYKSAVADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRT 904

Query: 397  VVN----SKFSTSTSVIGDMSFLVVLAYGSYLVLHG---SLTIGDLTAFMLYTDYTANSI 449
            +V     S  +T T+ I      ++  YG  LVL G   S T+      +L+T  T NS 
Sbjct: 905  IVTGLGLSMLTTITTCIQS----ILYYYGLKLVLTGEYTSKTMFQTFTLVLFTVTTCNS- 959

Query: 450  FGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFI--------PGDGCIEFRNLGF 501
              L +   ++ +G  AA  +  + D     +   GE             D  IE  NL F
Sbjct: 960  --LVSQIPDVSRGQRAASWVLRIIDENEYTKEVNGEDCRVETIEHENDSDPLIEIENLNF 1017

Query: 502  AYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIM 561
             YP  P   V+++LN KI  G ++ +VG SG GKST+  LL + Y+    +ILI+  DI 
Sbjct: 1018 HYPNTPGVNVYQDLNLKINSGETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDIN 1077

Query: 562  KLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGL--KREATPDEIREVSKQCFCHNFITKF 619
              +   LR  + +V+Q+P L  G+IR+NITYG+  K   +  E++E+ +    H F+   
Sbjct: 1078 DWSYDILRAEICVVEQKPNLFHGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVEAL 1137

Query: 620  PDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKL 679
            P A +T++     LLSGGQ QR+ I R L++KPK+LILDE TS+LD ++   I     K 
Sbjct: 1138 PKALDTVVDIG--LLSGGQAQRLCIVRTLLRKPKVLILDECTSSLDAQTT-QIVIALIKD 1194

Query: 680  MKSK---SVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELY 722
            + +K    +  + I H    ++    ++VL + G VVE G+F +L+
Sbjct: 1195 LNTKLGWDILTIVITHNRQMMQCCSRLVVL-DVGRVVEDGQFDDLH 1239

 Score =  163 bits (412), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 137/521 (26%), Positives = 246/521 (47%), Gaps = 43/521 (8%)

Query: 243 LSERVVARLRSHVIKKTLHQDAEFFD--QNKVGDLIS--------RLGSDAYVVSRSLTQ 292
           L ER   R+RS ++++ L +  E++D  +N  GD           R GS     + ++T 
Sbjct: 93  LGERQGFRVRSKLLEEYLEKPMEWYDLKENLAGDFTQLNRCMEELRSGSAE---ASAVTY 149

Query: 293 KVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATG 352
           +      A++C             QL+  ++  +P +++ A+ F + I+  ++   + T 
Sbjct: 150 QNCVAIIALICVSFYYSW------QLTLIILCTSPFIIVCAACFSRFIQKYASFENKETA 203

Query: 353 QLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDM 412
               +    ++  +TV+    + KEI+++   +    +      +  S F+ +   IG +
Sbjct: 204 AAADLLMWTMDSSQTVKLSCTQSKEIKKFETLVSKCNDY----FIRTSLFTAAN--IGIL 257

Query: 413 SFLVV------LAYGSYLVLHGSLTIGD-LTAFMLYTDYTANSIFGLSNFYSEIMQ-GVG 464
            FL +        +GS ++  G L I D +T F  Y+     SI   +  +   +Q G  
Sbjct: 258 RFLTLSMFVQGFWFGSTMIRKGKLNISDVITCF--YSCLMLGSILNTTLHHVIFIQKGQV 315

Query: 465 AAKRLFDLTDRIPAI--RPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPG 522
           A  ++    +  P +  +       +     I   NL FAYP+RP   V KN++ KI+  
Sbjct: 316 ALAKIQKFINESPELPSKTLTSSGLVYSHVDISIDNLTFAYPSRPTENVLKNVSLKIKSA 375

Query: 523 TSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLM 582
            +  IVG SG GKSTI  L++++Y    G I++ ++DI  +    L Q + +V+Q   L 
Sbjct: 376 RTTFIVGKSGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSVPIDELLQNITLVEQRCTLF 435

Query: 583 SGSIRDNITYGLKREATPDEIREVSKQC---FCHNFITKFPDAYETIIGPHGTLLSGGQK 639
           + ++++NI  G K  +       +S  C      + I+  PD  ET +G  G  LSGGQ+
Sbjct: 436 NDTLKNNILLGSKYTSQTINDGLLSSICSLACLDSVISSLPDGIETRLGTDGITLSGGQQ 495

Query: 640 QRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRR 699
           QR+A+ARA ++   ILILDEA SALD+     +     K+ ++K+  I++  H L+ I  
Sbjct: 496 QRVALARAFLRDTDILILDEAVSALDIMQREILMRNISKVRQNKTTIILT--HDLNQIND 553

Query: 700 SEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRA 740
           ++YI +  N+  + E G  K L  D  +    + N +++ A
Sbjct: 554 NDYIYLFENN-EIKENGFKKTLMNDENTLFYNMYNLQRNAA 593

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON}
           similar to uniprot|P12866 Saccharomyces cerevisiae
           YKL209C STE6 ATP-binding cassette (ABC) transporter
           required for the export of a-factor catalyzes ATP
           hydrolysis coupled to a-factor transport contains 12
           transmembrane domains and two ATP binding domains
           expressed only in MATa cells
          Length = 1271

 Score =  177 bits (450), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 134/525 (25%), Positives = 251/525 (47%), Gaps = 28/525 (5%)

Query: 243 LSERVVARLRSHVIKKTLHQDAEFFDQNK--VGDLISRLGSDAYVVSRSLTQKVSDGFKA 300
           L ER   R+R+ +I     +D +++D N+   GD I ++      V  S  +  +  F+ 
Sbjct: 91  LGERQGFRIRNSLIMFYFEKDLKWYDSNENLEGDFI-QINRCIEEVRASSAEASAIFFQN 149

Query: 301 ILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEE 360
           ++               L+  ++   P +   A     K+   S +    + + + V   
Sbjct: 150 VISIIALIATSMYYSWSLTLIILCSLPLLATLAVFLSMKVEKFSKLENLESSKASSVLAW 209

Query: 361 QLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAY 420
            L+  + ++ F     E +++   +         S + ++  ++S   +    F+    +
Sbjct: 210 SLDAFQMIRLFNTSYWEQKKFETLVSKCNKHFVKSCLYSALNASSLRFLTLCMFVQGFWF 269

Query: 421 GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIR 480
           G+  +  G +  GD+           +S+         I +G  A +R+      +P  +
Sbjct: 270 GNTQIKRGKMKAGDVITCFSSCLLLGSSLSSTLQQIVTIQKGKAAIQRINQFL--VPNSK 327

Query: 481 PTIGEKF----------------IPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTS 524
             +GE                  I  DG IEFR++ FAYPTRP++ V KN++ KI+ G +
Sbjct: 328 SAVGEWEKRSSLISTSSSIGLAPIFCDGDIEFRDVSFAYPTRPDDYVLKNVSIKIKSGAT 387

Query: 525 VCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSG 584
             IVG SG GKST+A LLL+ Y   +G+I     +I  L+   L + + +V+Q   L +G
Sbjct: 388 CFIVGKSGSGKSTLASLLLKMYGEYTGEIKFGEYEIDSLDDSWLVENITLVEQRCTLFNG 447

Query: 585 SIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAI 644
           +++DN+T  + + A+  E+++  +    +  +   P+  +T++G HG  LSGGQ+QR+A+
Sbjct: 448 TLKDNLTI-VNKYASCTEVKQACQFALLNTVLLNLPNGIDTLLGRHGVTLSGGQQQRVAL 506

Query: 645 ARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYII 704
           ARA ++   +LILDE+ SALD+ S   I        K K+  I++  H  + I+  EY+ 
Sbjct: 507 ARAYLRNTPVLILDESLSALDIMSRELIVEAIRHWRKGKTTIILT--HEYTQIKDDEYVY 564

Query: 705 VLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEAPLPP 749
           ++ ++G+VVE+G   +L  +P S  ++L + +++R    E P+ P
Sbjct: 565 LM-SEGTVVESGFKYDLLENPDSYFAQLNSLQETRY---EVPVSP 605

 Score =  163 bits (412), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 122/416 (29%), Positives = 214/416 (51%), Gaps = 17/416 (4%)

Query: 317  QLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQK 376
            +LS   +   PA ++ + I+G  ++   T  +    +L     E +  +KT++    +Q 
Sbjct: 848  KLSLVCISLFPAFILFSGIYGSLLQVYETAYKTEIAELETRVHELVISMKTIKLLQLQQH 907

Query: 377  EIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLT 436
                +   +  +  + K  +V        T+ +  +   ++  +G  LV+ G  ++  + 
Sbjct: 908  FEGSFKTQLAKVRIVCKKRSVAVGFGIAVTNALAMVVQAILFFFGIKLVIQGEYSVAQMF 967

Query: 437  AFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIR-----PTIGEKFIPGD 491
                   ++  +   L N   EI +G  AA  +F + +   ++      P+  + F    
Sbjct: 968  ETFTLLLFSIMTCVSLINQVPEISRGQRAATYIFKVLEDSGSVDTSKPDPSQNQSFFSTA 1027

Query: 492  G---CIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNP 548
            G    I+  NL FA+ + P N++F +L+ +I    +V IVG SG GKST++LLL R Y  
Sbjct: 1028 GNRETIKISNLSFAFSSAPMNKIFNSLSCEICLNETVGIVGESGSGKSTLSLLLTRLYPV 1087

Query: 549  SSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSK 608
             SG++ I   DI K +  +LR+ + IV+Q+P    G++R+N+ YGLKR  +  E+R V K
Sbjct: 1088 PSGKVYIGGIDINKWDEYALRRTISIVEQKPKFFDGTVRENLVYGLKRNVSNSELRSVLK 1147

Query: 609  QCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
                 +F+   P+   T +  H  L+SGGQ QR++IAR L+++PKI+ILDE TSALD  +
Sbjct: 1148 SVDLLSFVQTLPNDLNTRV--HDGLMSGGQAQRLSIARTLLRQPKIIILDECTSALDAAN 1205

Query: 669  EGAINYTFGKLMKS--KSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELY 722
              AI     +L+++  K+VT++ I H    ++  + ++VL   G V E G + EL+
Sbjct: 1206 SFAI----AELIRTVLKNVTVIVITHSEQLMQICDRVLVL-KKGKVKEEGSYAELF 1256

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  177 bits (449), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 144/491 (29%), Positives = 235/491 (47%), Gaps = 22/491 (4%)

Query: 244  SERVVARLRSHVIKKTLHQDAEFF--DQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAI 301
            SE  +  LR   ++K  +   E+   D NK  +L + L +D   +  S +  +S     +
Sbjct: 776  SEIYIRTLRDDAMRKITYNRIEWLTQDNNKPSELSALLMNDLRDLRTSTSNFISFVSSFV 835

Query: 302  LCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQ 361
            +              +LS   +   P +VI + I+G  ++   T  +    +L  V  E 
Sbjct: 836  IVSSVGLIWAIVTGWKLSLVCISMFPLLVIFSMIYGILLKKYETEYKNTIAKLENVQYEV 895

Query: 362  LNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYG 421
            + G+KT++    E     ++N   +    +G+  A+V + F  + S    MS   +L Y 
Sbjct: 896  VTGMKTIRCLQIEDHFKAKFNVLKQTAKLMGQRRAIV-TGFGVAVSNGLTMSIQGILYYY 954

Query: 422  SY-LVLHGSLTIGDLT---AFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIP 477
            +  LV+HG  T   +      +L+T  T N+   L N   +I +G  AA +++ + + I 
Sbjct: 955  AIKLVIHGEYTTKKMFETFTLLLFTIMTCNN---LVNQIPDIRRGQRAASKIYRILEGID 1011

Query: 478  AIR--PTIGEKFIP-----GDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGP 530
                  T G + +P         I F +L FAYPT P  ++ K+L+ +I  G  + IVG 
Sbjct: 1012 ESECFETEGHRIVPIVENPTGPIIRFNDLSFAYPTAPTVKILKHLSMEIYSGDRIAIVGE 1071

Query: 531  SGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNI 590
            SG GKST+  ++ R Y   S  + +DN D+       LR+ + +V+Q+P L  G+IR+N+
Sbjct: 1072 SGCGKSTLVNIITRLYECPSNSLFVDNTDVNDWALPKLREQIAVVEQKPTLFKGTIRENL 1131

Query: 591  TYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIK 650
             YG        ++  + K    ++F    P+  ET I     LLSGGQ QR+ IARAL++
Sbjct: 1132 VYGSPLGTADVDVFNMLKYVGIYDFFATLPEGLETKI--DSGLLSGGQNQRLCIARALLQ 1189

Query: 651  KPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDG 710
            +PKILILDE TSALD  S   IN    +     ++  +SI H    +R    + VL + G
Sbjct: 1190 RPKILILDECTSALDTMSSHIINEIIRE--GPPTMLTISITHDEQMVRACNKVAVL-DQG 1246

Query: 711  SVVETGKFKEL 721
             +VE G  ++L
Sbjct: 1247 HIVEMGNREDL 1257

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 138/515 (26%), Positives = 239/515 (46%), Gaps = 30/515 (5%)

Query: 223 AGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNK--VGDLISRLG 280
           AG++VI  +C         LL ER   R+R+ +I   L +  +++D N    GDL ++  
Sbjct: 73  AGSIVIIWICISS----WMLLGERQNFRVRTQLIDSYLQKPMKWYDDNDTLTGDL-TQTN 127

Query: 281 SDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKI 340
                +  S  +  +  +K ++               L+   +  AP +V+ A  F + I
Sbjct: 128 RCVEELRSSSAEASALTWKNLVTILALTVTSFYYSWSLTLVTMCGAPVIVLCAIFFSRLI 187

Query: 341 RDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDI-YNIGKMSAVVN 399
              S      T   +++    +   + V+    +  E++ +  A++    N  KM     
Sbjct: 188 HIYSEKENSHTAISSQLLSWSMEAAQLVRLSCMQLVEVQNFQLAVKKCSKNFMKMCLYA- 246

Query: 400 SKFSTSTSVIGDMS---FLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFY 456
              S +T+++  ++   F+    +GS ++    L I D+            +I G  +  
Sbjct: 247 ---SANTAILKFLTLTIFVQAFWFGSTMIRKHKLRIEDVITCFQSCVLLGATINGTLHQI 303

Query: 457 SEIMQGVGAAKRLFDLTDRIPAIRPTI--GEKFIPGDGC---IEFRNLGFAYPTRPENQV 511
             + +G      + +   +   ++       +F    G    IE RN+ F YP+RP    
Sbjct: 304 VILQKGKVGVINVNEFLKKDEYLKEDFKNNRRFYLDGGISEKIELRNVQFNYPSRPTVPA 363

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
            KN++  +  G    +VG SG GKS++  LLL+ Y+  +G I ID  DI  ++ KS+ + 
Sbjct: 364 LKNVSLTLPVGKITYVVGKSGSGKSSLGNLLLKLYDDYNGSISIDGIDIKGIDQKSILKN 423

Query: 572 MGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCH-----NFITKFPDAYETI 626
           + +V+Q   L + ++R+NI +G K   T + +R+ S +  C      NFI   P+  +T+
Sbjct: 424 ITLVEQRCTLFNDTLRNNILFGSKE--TDELVRDESLKAACRISLLDNFIYDLPEGLDTL 481

Query: 627 IGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVT 686
           IG  G   SGGQ+QRIAIARA ++   IL+LDEA SALD+   G +     +  +S+  T
Sbjct: 482 IGTGGITPSGGQQQRIAIARAYMRDTPILVLDEAVSALDIIHRGLLMNAI-RNWRSEKTT 540

Query: 687 IVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
           I+ + H LS I   + I +L  DG VVE G+ + L
Sbjct: 541 II-LTHDLSEIGPDDMIYLL-EDGEVVEQGQQRNL 573

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  171 bits (433), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 122/397 (30%), Positives = 201/397 (50%), Gaps = 15/397 (3%)

Query: 349 EATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAI---RDI-YNIGKMSAVVNSKFST 404
           +A  +   V+ + L   + V++F  E+    +Y  ++   RD    + +  A +NS    
Sbjct: 284 KADNKAASVALDSLINFEAVKNFNNEKYLAEKYETSLLKYRDSQVRVAQSLAFLNS---- 339

Query: 405 STSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVG 464
             ++I   +   ++  G   ++ GSLT+GDL          +  +  L + Y E+ Q + 
Sbjct: 340 GQNLIFTTALTAMMYMGCTGIIGGSLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLI 399

Query: 465 AAKRLFDLTDRIPAIRPTIGEKFIPGDGC---IEFRNLGFAYPTRPENQVFKNLNFKIEP 521
             + LF+L +    I      K +P +     I F N+ F Y   P  ++ +N +F I  
Sbjct: 400 DMESLFNLRNNPILIDNPSKPKMLPANAGPFDIVFENVTFGYD--PRRKILQNASFVIPA 457

Query: 522 GTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVL 581
           G    +VGPSG GKST+  L+ R+Y+P  G+IL++  DI + +  SLR+ +G+V Q+  L
Sbjct: 458 GWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIREYDLDSLRRAIGVVPQDTPL 517

Query: 582 MSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQR 641
            + +I +N+ +G + +A   E+    ++      + + P    TI+G  G ++SGG+KQR
Sbjct: 518 FNDTIWENVKFG-RIDADDQEVTRSIEKAHLAPLVYRLPGGLNTIVGERGLMISGGEKQR 576

Query: 642 IAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSE 701
           +AIAR L+K   I+  DEATSALD  +E A+  T        S T V IAHRL TI  ++
Sbjct: 577 LAIARVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFDRGSKTSVYIAHRLRTIADAD 636

Query: 702 YIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQS 738
            IIVL  +G   E G   EL     S   +L N +++
Sbjct: 637 KIIVL-EEGRPREEGTHHELLQKEDSLYRELWNIQEN 672

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  173 bits (438), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 134/497 (26%), Positives = 229/497 (46%), Gaps = 12/497 (2%)

Query: 233  NYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQ 292
            N+ +  LL  +SE+ V +LR ++++  L +D  +  QNK  ++ +   +D   +    + 
Sbjct: 778  NFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNKSSEITALTMNDLRDLRNVTSI 837

Query: 293  KVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATG 352
             +S      +              +L+   +   P  +   +++G  ++      + A  
Sbjct: 838  LLSSLTSLCVLASVGLIWAIVIGWKLTLVCLSLLPLFIGVITLYGMFVQKSEVQYKTAVS 897

Query: 353  QLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDM 412
            QL  +  E + GVKT++    E     RY    + +    +  +++       TS +  +
Sbjct: 898  QLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILYGSGLAITSCLVIL 957

Query: 413  SFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDL 472
               ++  YG  LV+ G      L        +T  S  GL +      +G  A   +F +
Sbjct: 958  LQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSSSRGQRAGTFVFGM 1017

Query: 473  T-------DRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSV 525
                    D   A+           +  +  R L FAYP   + Q++KN N +I  GT V
Sbjct: 1018 LEEPLPEPDNYSAVLRKAPTNHFSREPLVVLRALNFAYPAAKDVQIYKNFNLRINQGTKV 1077

Query: 526  CIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGS 585
             IVG SG GKST+  L+   Y      + ID  DI      +LR+ + +V+Q+P   +G+
Sbjct: 1078 AIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRKIIAVVEQKPRFFNGT 1137

Query: 586  IRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIA 645
            IR+N+ YGL+   T +EI EV  +    NF+   P+  ET +  +  L+SGGQ QR++I 
Sbjct: 1138 IRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDTN--LVSGGQLQRLSIV 1195

Query: 646  RALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIV 705
            RAL+++P +LILDE TSALD  +  AI       +    +T++ I H    ++  + I+V
Sbjct: 1196 RALLRRPTLLILDECTSALDAANANAIANVVRNSL--HDITVIVITHSKQMMKMCDRIVV 1253

Query: 706  LGNDGSVVETGKFKELY 722
            L N G+V E G F +L+
Sbjct: 1254 LKN-GAVAEDGSFDDLF 1269

 Score =  132 bits (332), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 122/516 (23%), Positives = 230/516 (44%), Gaps = 23/516 (4%)

Query: 242 LLSERVVARLRSHVIKKTLHQDAEFFDQ----NKVGDLISRLGSDAYVVSRSLTQKVSDG 297
           LL ER   R+R  +++  L +  +++D+    N +  + +R   +A     S  +     
Sbjct: 97  LLGERQSLRIRRELLRSYLAKPMQWYDKIDDINGMYTITNRCVEEARA---SCAEASGVL 153

Query: 298 FKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRV 357
           F++ +              +L+   +  AP + +   +F K ++  + +  E T   +  
Sbjct: 154 FQSAVTALILAVTAFKFSAKLTVVTLAGAPLLALLTVVFSKFVQKYAALENEQTSSASST 213

Query: 358 SEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVV 417
               LN    V+ F  +  E+R++N A+         + + +S    +   +  M F+  
Sbjct: 214 LSWALNSATMVKLFGTQDLELRKFNKAVNLSKKYFVRTLICSSINQAAMRFLSLMMFVQA 273

Query: 418 LAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIP 477
             YGS L+    +    +      +   ++SI  + +    + +G  A +++ +  +  P
Sbjct: 274 FWYGSILIQRDEVETAAVITVFSASVLLSSSINAMLSKVVLLQKGKVACRQIAEAVNVEP 333

Query: 478 AIRPT-------IGEKFIPGD--GCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIV 528
             RP        +G      D    I F  + F YP RP+ +    ++    P     IV
Sbjct: 334 EGRPNQYAFPYEVGHIIALEDQPSEIVFDQVSFNYPARPDTKALDGVSLTFRPNQITFIV 393

Query: 529 GPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRD 588
           G SG GKST+  LLL++Y+   G I +++ ++  ++   L Q + +V+Q   L +G++ +
Sbjct: 394 GKSGSGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQSCTLFNGTLFE 453

Query: 589 NITYGLK-REATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARA 647
           NIT   K    T   ++   +       +   P+   T +G  G  +SGGQ+QR+A+ARA
Sbjct: 454 NITLSAKPVNKTAGAVKRACQMALLEKLVFDLPEGLHTKVGSGGISMSGGQQQRVALARA 513

Query: 648 LIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLG 707
           +++   +LILDEA SALD+     +          K+  I++  H LS +   +Y+ ++ 
Sbjct: 514 ILRDAPVLILDEAISALDIIHRDLLMEVIRSWRADKTTIILT--HELSHVLDDDYLYMM- 570

Query: 708 NDGSVVETGKFKELYADPTSE---LSKLLNEKQSRA 740
             G V+E G   EL ++P S    L++L N K  RA
Sbjct: 571 EHGQVIEQGYKSELLSNPNSRFRALNRLQNSKNERA 606

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  171 bits (434), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 141/533 (26%), Positives = 254/533 (47%), Gaps = 30/533 (5%)

Query: 224  GALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFF--DQNKVGDLISRLGS 281
            G  V   + N+ +  +L   SE  +  LR+  ++  L++D  +F  D NK  +L + L +
Sbjct: 766  GVAVADGVSNFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKSSELSALLLN 825

Query: 282  DAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIR 341
            D   +   +++ +S     ++              +LS   +   P ++  ++++G  ++
Sbjct: 826  DLRDLRSLVSEFLSAMTTFMVVSLIGLIWALVSGWKLSLVCLSMFPLIIAFSAVYGTMLQ 885

Query: 342  DISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSK 401
               T  + +   L     E + G+KT++S  AE   I+ Y+    ++  I    ++    
Sbjct: 886  KYETTYKTSVAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAHKRSIATGF 945

Query: 402  FSTSTSVIGDMSFLVVLAYGSYLVLHG---SLTIGDLTAFMLYTDYTANSIFG------- 451
              + T++I      ++  YG  LV  G   S  + +    +L+T  T  S+         
Sbjct: 946  GISVTNMITICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTSLVNQIPDISR 1005

Query: 452  ----LSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRP 507
                 +  Y  + +G+ + +  F+   +   + P    K  P    I+ +NL FAYP+  
Sbjct: 1006 GQRSATFLYRILDEGLASDESEFETHRKAEIVAPKQESKSNP---LIKIQNLTFAYPSET 1062

Query: 508  ENQVFKNLNFKIEPGT-SVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPK 566
               V+++LN ++     ++ +VG SG GKST+  LL + Y  +   I +D  D+      
Sbjct: 1063 NVNVYEDLNLEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVNDWGLM 1122

Query: 567  SLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETI 626
            +LR  + +V+Q+P L  G++R+N++YG+  +    E+ ++ K    + F+   P   +T 
Sbjct: 1123 NLRTQISVVEQKPTLFDGTVRENLSYGISTDILDMELFDMLKYVGIYEFVESLPFGLDTR 1182

Query: 627  IGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSK--S 684
            I     LLSGGQ QRI IARAL++KPKILILDE TSALD  S   I      ++K+   +
Sbjct: 1183 IDTK--LLSGGQAQRICIARALLRKPKILILDECTSALDALSANII----IDIVKNGPPA 1236

Query: 685  VTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQ 737
            +  + I H    +R    I VL N G ++E G FKEL  +   EL K+++ ++
Sbjct: 1237 LLTIVITHSEKMMRACNTIAVLKN-GKIIEKGGFKEL-VNGNGELKKIIDLQE 1287

 Score =  142 bits (357), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 144/572 (25%), Positives = 258/572 (45%), Gaps = 45/572 (7%)

Query: 184 GLVLDALKNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLL 243
           G V D L N+   S  ++  S+L   AF +     LGA +  L+  ++ ++        L
Sbjct: 53  GRVFDLLSNISNFSMHTI-LSELRTRAFAIMA---LGAASLPLMWISLSSWMS------L 102

Query: 244 SERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDG------ 297
            ER    +R  ++++ L +   ++D N        L  D   ++R + +  S        
Sbjct: 103 GERQGFAVREKILQEYLTKPITWYDSN------DNLSGDFTQINRCVEELRSSSAEASAI 156

Query: 298 -FKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTR 356
            F+ ++               L+  ++  AP ++  A  F   I   + +    TG+  +
Sbjct: 157 IFQNLVSILALIGTSFYYSWSLTLIILCTAPIIIAFAVFFSHMIHKYTELENTETGKAAQ 216

Query: 357 VSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLV 416
           ++   ++ ++ V+ +  + +E+R +     +  ++     +  S  +     +    F+ 
Sbjct: 217 LANWAMDSIQLVKLYCTQFREVRNFRELTSNCNDLFIKCCLYVSANTALLRFLSLSMFIQ 276

Query: 417 VLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFG--LSNFYSEIM---QGVGAAKRL-- 469
              +G+ +V  G L I ++      T + +  + G  LSN    I+   +G  A K++  
Sbjct: 277 GFWFGATMVRKGKLQISNVV-----TCFQSCLMLGSTLSNTLQVIVILQKGDVALKKILG 331

Query: 470 FDLTDRIPAIRPTIGEKFIPGDGC-IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIV 528
           F  T         I E   P + C I F N+ F+YP+RP + V KN++   EP     I+
Sbjct: 332 FLSTSVDHGADEPIYEPETPAELCTIAFNNITFSYPSRPSHPVLKNVSLCFEPTKFTFII 391

Query: 529 GPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRD 588
           G SG GKST++ LLL++Y+  +G I +   D+ ++N   L   + +V+Q   L + ++R+
Sbjct: 392 GKSGSGKSTLSNLLLKFYDDYNGTITVKGNDVKEINRNWLLNNVTVVEQRCTLFNDTLRN 451

Query: 589 NITYGLKREATPD------EIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRI 642
           NI  G+ ++   D      ++++          +   P    TIIG  G  LSGGQ+QR+
Sbjct: 452 NILLGVSKDQLEDHESIEQKLKDACSISMLDRLVCDLPHGLNTIIGSGGISLSGGQQQRV 511

Query: 643 AIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY 702
           AIARA ++   ILILDEA SALD+     +     +    K  T + + H LS I   +Y
Sbjct: 512 AIARAFMRNKPILILDEAVSALDIIHRELLMKNIRQWRSGK--TTILLTHELSQIEPDDY 569

Query: 703 IIVLGNDGSVVETGKFKELYADPTSELSKLLN 734
             V+  +G V E G  K+L    TS  + +LN
Sbjct: 570 TYVI-QEGEVKENGYQKDLKQKKTSVFNHMLN 600

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  167 bits (422), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 147/499 (29%), Positives = 230/499 (46%), Gaps = 28/499 (5%)

Query: 239  LLRLLSERVVARLRSHVIKKTLHQDAEFF--DQNKVGDLISRLGSDA----YVVSRSLTQ 292
            +L + SE  +  LR   + +  +QD  +F  D NK  ++ + + +D     Y+VS  L+ 
Sbjct: 813  ILSVCSELWIMSLRIKAMDRISNQDVHWFSLDINKPSEISALILNDLRDLRYLVSGFLSA 872

Query: 293  KVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATG 352
              +     I               +LS   +   P  +    I+G  ++   T  + A  
Sbjct: 873  VTT----LIFVSAIGLAWAFVSGWKLSLVCISTIPLFIGVTGIYGGVLQKYETDYKTAVA 928

Query: 353  QLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTS---VI 409
            +L     E + G+KTV+    E     +Y      + +  +  AVV + F  + S   VI
Sbjct: 929  ELENNMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSRRRAVV-TGFGVALSNALVI 987

Query: 410  GDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL 469
            G  + L    YG  LV+ G  T  +L        +T  +   L        +G  AA  +
Sbjct: 988  GVQAILYY--YGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMYEVPSFSRGRRAATYV 1045

Query: 470  F-------DLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPG 522
            F       D        R    EK    +  I  ++L FAYP+  + +V+K L+  I  G
Sbjct: 1046 FRILNTRSDFLSIDDDFRTEPIEKPSHMNPLIRIQDLTFAYPSALDVEVYKKLSLTINFG 1105

Query: 523  TSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLM 582
             ++ IVG SG GKST+ L+L   Y  +   + ID+ DI K N  SLR+++ +V+Q+    
Sbjct: 1106 ENLAIVGESGSGKSTMGLILCGLYPVNGNTVFIDDTDICKWNLSSLRKHISMVEQKAKFF 1165

Query: 583  SGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRI 642
             GSIRDN+ YGL R  T  +I EV       +F+ + P    T I  +  L+SGGQ QRI
Sbjct: 1166 DGSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQGLNTRIDTN--LISGGQAQRI 1223

Query: 643  AIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY 702
            +I RAL+++PK+LILDE TS+LD ++  AI    G  +    +T + I H    ++    
Sbjct: 1224 SIGRALLRQPKLLILDECTSSLDAKNAQAIASLVGSSL--YGITTIVITHNTQMMKSCNR 1281

Query: 703  IIVLGNDGSVVETGKFKEL 721
            I+   N G + E G F+EL
Sbjct: 1282 ILFFKN-GRISEEGTFQEL 1299

 Score =  129 bits (324), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 115/444 (25%), Positives = 205/444 (46%), Gaps = 48/444 (10%)

Query: 322 LVIFA--PAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIR 379
           LVI A  P ++  A IF K +   + +    T     +    +   + ++ F  EQ E++
Sbjct: 180 LVILASTPLIIALAIIFSKLVEKYTELENTETSHAASILTWSMEAPQLIRLFGTEQVELQ 239

Query: 380 RYNNAIRD----IYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDL 435
           +++ +++       N+ K +A   +     + ++    F+    +G+ ++  G L  G +
Sbjct: 240 KFSISVKKCSKFFINLSKYAAANQASLRGLSLIM----FVQGFWFGNTMIKRGKLNSGQV 295

Query: 436 TAFMLYTDYTANSIFG--LSNFYSEIM---QGVGAAKRLFDLTD-RIPAIRPTIGEKF-- 487
                 T ++A  + G  L+N    I+   +G  A +++  + +    A+R   GE F  
Sbjct: 296 I-----TCFSACILLGTTLNNTLQHIVIMQKGKVALQKILSMVESESDALRGRRGETFEI 350

Query: 488 --IPGDGC---------IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKS 536
              P  G          I F N+ F+YP+RP      N++    P     IVG SG GKS
Sbjct: 351 FPSPISGMFVSPVFPKQITFENVSFSYPSRPNEYALDNVSLTFYPEKITFIVGKSGSGKS 410

Query: 537 TIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKR 596
           T++ LLL+ Y+   G I +   DI       L + + +V+Q   L + S+ +N+    K 
Sbjct: 411 TLSNLLLKLYSDYEGTIKVGTLDIRATKDSWLLENITLVEQSCTLFNDSLLNNLLLTAKD 470

Query: 597 EATPD-EIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKIL 655
           +   +  I+   +       +   PD   T+IG +G  LSGGQ+QR+A+ARA+++   +L
Sbjct: 471 DNKNEASIKRACQMALLEKLLFDLPDGLSTVIGSNGISLSGGQQQRVALARAILRDTPVL 530

Query: 656 ILDEATSALDVESEGAI-----NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDG 710
           ILDE+ SALD+     +     N+  GK       T + + H LS I   +Y+ ++  DG
Sbjct: 531 ILDESISALDIIHRDLLMEVIRNWRAGK-------TTIILTHELSHILDDDYLYLM-EDG 582

Query: 711 SVVETGKFKELYADPTSELSKLLN 734
            V E G  ++L +  +   ++L N
Sbjct: 583 KVGEHGYKRDLLSYTSGRFTELHN 606

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
            YKL209C (REAL)
          Length = 1316

 Score =  166 bits (419), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 153/526 (29%), Positives = 244/526 (46%), Gaps = 32/526 (6%)

Query: 233  NYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFF--DQNKVGDLISRLGSDAYVVSRSL 290
            N+ +  LL   SE  +  LR+ V++K   +   +F  + NK  ++ + + +D     R L
Sbjct: 803  NFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVSALVLNDL----RDL 858

Query: 291  TQKVSDGFKAILCXXXXX----XXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTI 346
               VS+   AI                   +LS   +   P ++I ++I+G  ++   T 
Sbjct: 859  RSLVSEFLSAITSFITVSFIGLVWALASGWKLSLVCISMFPLIIIFSAIYGSILQKHETD 918

Query: 347  LQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTST 406
             + +  QL     + +  +KT++   AE      Y+     +  I    A+      + T
Sbjct: 919  YKTSVVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIASKRAIATGFGISMT 978

Query: 407  SVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAA 466
            ++I      ++  YG  LV+    T   +        +T  S   L +   +I +G  AA
Sbjct: 979  NMIAMCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAA 1038

Query: 467  KRLFDLTDR--------------IPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVF 512
              ++ + D               I  I  T  EK       +  +NL FAYP+ P   ++
Sbjct: 1039 SWIYRILDEKQVTLEIEDNNARSIGIIGETYHEK--QTTPMLSIQNLTFAYPSAPSVLIY 1096

Query: 513  KNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYM 572
            KN+N  +  G ++ IVG SG GKST+ LLL R Y+   G I +D  D+   N   LR+ +
Sbjct: 1097 KNMNLNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDVNDWNLTVLRREI 1156

Query: 573  GIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGT 632
             +V+Q+P+L +G+IRDN+TYG   E    EI +  K    ++F+   P    T I  +  
Sbjct: 1157 SVVEQKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLPLGLGTRIDTN-- 1214

Query: 633  LLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAH 692
            LLSGGQ QR+ IARAL++KPKILILDE TSALD  S   I     K     ++  + I H
Sbjct: 1215 LLSGGQAQRLCIARALVRKPKILILDECTSALDSMSSHVIKEIVKK--GPPALLTLVITH 1272

Query: 693  RLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQS 738
                +R  + I V   DG V+E G F  LY +   E+ ++++EK +
Sbjct: 1273 DEQMMRCCDSIAVF-KDGKVIEEGSFDTLY-NNCGEMFRIVSEKNA 1316

 Score =  153 bits (387), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 120/445 (26%), Positives = 209/445 (46%), Gaps = 27/445 (6%)

Query: 318 LSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKE 377
           L+  ++  +P +   A  F + +   S    E T +  ++    +N  + V+ +  +  E
Sbjct: 202 LTLIILCSSPIITFFAVAFSRMVHMYSQKENEETSKAAQLFAWSMNAAQLVRLYCTQPLE 261

Query: 378 IRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTA 437
            +++   I         S +  +  +     +    F+    +GS ++  G L I D+  
Sbjct: 262 RKKFQRIILSCNTFFIKSCLFVAANAGILRFLTLTMFVQGFWFGSTMIKQGKLNINDVI- 320

Query: 438 FMLYTDYTANSIFG--LSNFYSEIM---QGVGAAKRLFDLTDRIPAIRP--TIGEKFIPG 490
               T + +  + G  L+N   +I+   +G  A +++ +L +  P   P   I     P 
Sbjct: 321 ----TCFHSCILLGSTLNNTLHQIVVLQKGEVALQKIMNLLENGPKCNPPNEIELHQYPL 376

Query: 491 DGC---IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYN 547
           D     + F N+ F+YP+RP   V +N + K   G    IVG SG GKST++ LLL++Y+
Sbjct: 377 DYANSDLVFDNVSFSYPSRPSEIVLENASLKFPAGQFTFIVGKSGSGKSTLSSLLLKFYD 436

Query: 548 PSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYG---LKREA------ 598
              G I I+ ++I  +  K L + + +V+Q   L + ++R NI  G   L + A      
Sbjct: 437 GYDGSISINGRNIQAIPQKLLIKNITVVEQRCTLFNDTLRKNILLGSTELAKNADYSTNK 496

Query: 599 TPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILD 658
             + I++  +       I   PD  ET+IG  G  LSGGQ+QR+A+ARA I+   IL LD
Sbjct: 497 NTNLIKDACRMALLDRLILDLPDGLETLIGSGGVTLSGGQQQRVAMARAFIRDTPILFLD 556

Query: 659 EATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKF 718
           EA SALD+     +        K K+  I++  H L  +   +++ ++  +G V+E+G  
Sbjct: 557 EAVSALDIIHRNLLMKAIRHWRKGKTTIILT--HELGQVESDDHLYLM-QEGKVIESGTQ 613

Query: 719 KELYADPTSELSKLLNEKQSRANKK 743
            EL AD TS  SK    ++  ++ K
Sbjct: 614 SELLADSTSTFSKWYCLQKDYSDTK 638

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score =  164 bits (415), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 123/426 (28%), Positives = 204/426 (47%), Gaps = 15/426 (3%)

Query: 317  QLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQK 376
            +LS   +   PA ++    +G  ++      + A   +       +  +KT++    E++
Sbjct: 876  KLSLVCISLIPAFILFTGAYGGLLQKCEANYKSAVASMEDQLYSAVRRIKTIRCLQVEER 935

Query: 377  EIRRYNNAIRDIYNIGKMSAVVNSKFSTSTS-VIGDMSFLVVLAYGSYLVLHGSLTIGDL 435
             I+ Y   +     +      + + F  + S  +  ++  ++L YG  LV+ G  +   +
Sbjct: 936  VIKEYE-VLEGKAKLAGRKRALGTGFGVALSNALTLITQSILLYYGMKLVITGEYSSERM 994

Query: 436  TAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPT--IGEKFIPGDGC 493
               +    +T  +   L     EI +G  AA  LF + D           GE  +   GC
Sbjct: 995  FQTLTLLLFTIMTCMSLIAQIPEISRGQRAATYLFRILDSETQFADANLEGESALTSRGC 1054

Query: 494  -----IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNP 548
                 I  ++L F+Y       V++ LN  ++ G +V +VG SG GKST+  L+ R Y  
Sbjct: 1055 SNEALIFIKDLRFSYSFLNNPMVYRGLNLSVKAGETVALVGLSGSGKSTLWHLITRLYRV 1114

Query: 549  SSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSK 608
             SG I  D  D+ +    +LR+ + +V+Q P L  GSI DN+TYGL       EIRE+ +
Sbjct: 1115 PSGSIWFDGLDVNEWEEWALRKRIAVVEQRPSLFRGSIFDNLTYGLSTSVDEREIRELLE 1174

Query: 609  QCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
                 +F+   P   ++ I     +LSGGQ QR+AI RAL++KP++L+LDE TSALD + 
Sbjct: 1175 LVGMMDFVNSNPLGLQSFIDTD--VLSGGQLQRLAIVRALLRKPQLLVLDECTSALDAQ- 1231

Query: 669  EGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSE 728
             G I   F +   S+S T + + H    +R    I+   N G+++E G F+ LY+    E
Sbjct: 1232 HGFIMSEFVR-QGSQSTTTLVLTHSEQMMRACNRILTFAN-GNIIEDGSFERLYSQK-GE 1288

Query: 729  LSKLLN 734
            L K+L+
Sbjct: 1289 LFKILS 1294

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 131/503 (26%), Positives = 228/503 (45%), Gaps = 19/503 (3%)

Query: 243 LSERVVARLRSHVIKKTLHQDAEFFDQNK--VGDLISRLGSDAYVVSRSLTQKVSDGFKA 300
           L ER   RLR  +++  L +   ++D N+   GD  ++L      +  S  +  +  F+ 
Sbjct: 99  LGERQAFRLRRKMLQSYLDKSMAWYDANEQISGDF-TQLNRCVEELRSSSAESSAIVFQN 157

Query: 301 ILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEE 360
           ++               L+  ++  +P V+  A  F +K+   +      T         
Sbjct: 158 VVTVAALLGSALYYSWSLTLIIMANSPLVIGFAVFFSRKVEKYAKRENSETSSAADAMAW 217

Query: 361 QLNGVKTVQSFVAEQKEIRRYNNAIRDI-YNIGKMSAVVNSKFSTSTSVIGDMSFLVVLA 419
            L+  K V+    + +E+ R+   ++    +  KMS   +  +S    +   M F+    
Sbjct: 218 SLDAAKMVRLLGTQDRELARFEACVQKCRQHFNKMSLFSSLNYSVLRFLTLCM-FVQGFW 276

Query: 420 YGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAI 479
           YG+  +  G L  GD+          A+++    +    + +G    +++    +   A 
Sbjct: 277 YGNSRINIGKLKPGDVVTCFSSCVLLASTLNSTLHQIIILQKGAVGLQKIMAFVNSRDAS 336

Query: 480 -----RPTIGEKFIP---GDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPS 531
                +  I  + +P       I F+N+ FAYPTRP++ V K ++     G +  ++G S
Sbjct: 337 ESQKNKVEISFRRLPLCWERASITFQNVHFAYPTRPDDFVLKGVSLDFPSGETTFVIGKS 396

Query: 532 GRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT 591
           G GKSTI  LLL +Y   SG I ++ QD+ ++N   L + + +V+Q   L + ++ +N+T
Sbjct: 397 GSGKSTIGNLLLGFYGIGSGTINVNGQDVKEINQSELARNIMLVEQTTSLFTETLANNVT 456

Query: 592 YGLKREATPDEIR--EVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALI 649
            G +     DEIR  +  +     N I       ET IG  G  LSGG++QR+A+ARA  
Sbjct: 457 IG-EAGVDDDEIRLKQACQMAMLGNIIRDLAKGLETTIGCSGLDLSGGEQQRVALARAYF 515

Query: 650 KKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGND 709
           +   ILILDEA SA D   +  +     K    K+  I++  H LS I  ++Y+ V+ +D
Sbjct: 516 RNAPILILDEALSAQDRIHKSLLMEAIRKWRADKTTIILT--HELSDILDTDYVYVM-SD 572

Query: 710 GSVVETGKFKELYADPTSELSKL 732
           G + E G    L ++P SE S L
Sbjct: 573 GQIREHGYKSGLLSNPKSEFSNL 595

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL209C
            (STE6) - ABC transporter, glycoprotein, component of
            a-factor secretory pathway [contig 290] FULL
          Length = 1297

 Score =  160 bits (405), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 144/518 (27%), Positives = 235/518 (45%), Gaps = 40/518 (7%)

Query: 237  YILLRLLSERVVARLRSHVIKKTLHQDAEFFD--QNKVGDLISRLGSDAYVVSRSLTQKV 294
            YIL R   E  +  LR +  +  + +D  +F    N   ++ S + +D     R L    
Sbjct: 794  YILSRC-GENWIKELRINAFRSVMEKDFTWFQDSNNSTSNITSLILNDL----RDLRALA 848

Query: 295  SDGFKAI-------LCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTIL 347
            S+   A+       LC             +LS   +   P  V+ + I+G  +++     
Sbjct: 849  SEFLAALSTLAVVSLCGLLWALVAGW---KLSLVCISLIPMFVLFSGIYGGLLQNYEARY 905

Query: 348  QEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTS 407
            +    +L     + +  +KT++    E K  R Y     ++  +    A       T   
Sbjct: 906  KTCIAELENELYKAIRCMKTIKCLQMENKVARSY-----EMLEVTSKGAARKRAMGTGFG 960

Query: 408  VIGD--MSFL---VVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQG 462
            V     ++F+   ++L +G  LV+ G  T G +   +    +T  +   L +   EI +G
Sbjct: 961  VASSNALTFITQSILLYFGMKLVITGEYTPGKMLETLTLLLFTIMTCMTLMSQVPEISRG 1020

Query: 463  VGAAKRLFDL-TDRIPAIRPTIGEKFIP------GDGCIEFRNLGFAYPTRPENQVFKNL 515
              AA  LF L  +        + E+  P          I  ++L F+Y       V+KNL
Sbjct: 1021 QRAATYLFKLFGNEHEEGASVLKERHAPIIKTCSKQTLISIKHLKFSYSNINNPMVYKNL 1080

Query: 516  NFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIV 575
            + K++ G  V ++G SG GKST+  LL R Y   +G I ID  DI + + K+LR  + +V
Sbjct: 1081 SLKVDRGEIVGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTDINQWDRKALRSCIAVV 1140

Query: 576  QQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLS 635
            +Q+P+  SGSI +N+TYGL R+ + +E+ E+        F+   P    ++I     LLS
Sbjct: 1141 EQKPLFFSGSIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLHSVIDTQ--LLS 1198

Query: 636  GGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLS 695
            GGQ QR+AI RAL++KP++L+LDE TSALD      I   F K     + T+V + H   
Sbjct: 1199 GGQVQRLAIVRALLRKPQLLVLDECTSALDAR-HSFIMSEFVKHHLYHTTTLV-VTHSEQ 1256

Query: 696  TIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLL 733
             +R    I+   N G +VE G    L+ +   EL ++L
Sbjct: 1257 MMRSCHRILTF-NKGEIVEEGSIDNLF-NQKGELYRIL 1292

 Score =  157 bits (397), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 151/590 (25%), Positives = 262/590 (44%), Gaps = 32/590 (5%)

Query: 157 RDWKXXXXXXXXXXXSCSIGMAI-PKVIGLVLDALKNVMTDSPSSLETSDLPPIAFGLTL 215
           RDW             CS+   I P V  +++ A+ N++   P   +   +  +   LT+
Sbjct: 24  RDWWLLMIISI-----CSVAYGIVPAVTSILMGAVFNLL-QKPVIQQFDSVNTLMRDLTI 77

Query: 216 YPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQN-KVGD 274
                   G   I   C    Y  + L  ER   RLR  +++    +   ++D N ++  
Sbjct: 78  RTMAILITGIASI-PFCWLSIYAWMSL-GERQGFRLRRKLLRSYFEKSMAWYDINEQISG 135

Query: 275 LISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISAS 334
             ++L      +  S  +  +  F+ ++               L+  ++  +P V+  A 
Sbjct: 136 EYTQLNRCVEELRSSSAEASAIIFQNLVTVIALLGTALYYSWSLTLVIMANSPLVIGFAI 195

Query: 335 IFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDI-YNIGK 393
              + +     I    T     +    LN  K V+    +  EI ++  ++     N  K
Sbjct: 196 YCSRNVEKYGKIENSETSVAADIMAWSLNAAKMVRLLGTQDYEIAKFRASVLKCRMNFNK 255

Query: 394 MSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLS 453
           MS   +  +S    +   M F+    YG+  +  G+L  GD+          A+++    
Sbjct: 256 MSLFSSLNYSILRFLTLCM-FVQGFWYGNVRIKSGNLKPGDVMTCFSSCILLASTLNSTL 314

Query: 454 NFYSEIMQGVGAAKRL--FDLTDRIPAIRPTIGEKFIP---GDGCIEFRNLGFAYPTRPE 508
           +    + +G    K++  F  +D +      +    +P       I F N+ FAYP+R +
Sbjct: 315 HQVVTLQKGAVGLKKIQEFLTSDVVQGKECVVNSMHLPLLWEQAQISFENVSFAYPSRSK 374

Query: 509 NQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSL 568
           + V KNLN K+  G    IVG SG GKSTI+ LLL+ Y P SG I +++ DI ++N + L
Sbjct: 375 HPVIKNLNLKVPGGRFTFIVGKSGSGKSTISNLLLKLYRPCSGLIKVNDVDIREINQQDL 434

Query: 569 RQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIRE---VSKQC---FCHNFITKFPDA 622
            + + +V+Q   L   SI++NI      + T DE R+   +S+ C        I      
Sbjct: 435 FRSITLVEQNSPLFEDSIKNNI------QLTSDEHRDDGRLSQACQAAMLEGVIRDLAKG 488

Query: 623 YETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKS 682
            +TIIG  G  LSGG++QR+A+ARA ++   ILILDEA SA D   +  +        K 
Sbjct: 489 LDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHKDLLMEAIRFWRKG 548

Query: 683 KSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKL 732
           ++  I++  H L+ I   ++++++  DG+V+E G+  +L +D TS+ S L
Sbjct: 549 RTTIILT--HELNDILEDDFVLLM-EDGNVIERGQKSDLLSDSTSKFSLL 595

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  159 bits (401), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 153/570 (26%), Positives = 253/570 (44%), Gaps = 61/570 (10%)

Query: 199  SSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKK 258
            S+  TS      + L +Y F+    GA V G++  +  YI     S ++ A L    + K
Sbjct: 1148 SNSRTSSEHSTKYYLIMY-FMIGLTGATV-GSLKTFLTYIFGINASRKIFAML----LNK 1201

Query: 259  TLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQL 318
             +H    FFD   +G +++R   D   V + LT  ++  F + +             PQ 
Sbjct: 1202 VIHSKLRFFDTTPIGRIMNRFSKDIESVDQELTPYLTGAFYSFVECFSTIILISWITPQF 1261

Query: 319  SSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEI 378
                ++ +    +    +    R++  +       + +   E L GV T+++F  E + +
Sbjct: 1262 FVVAILISIMYYLVGYFYMAGSRELKRLDSITKSPIYQHFSETLVGVTTIRAFGDEMRFL 1321

Query: 379  RRYNNAIRDIYNIGKMS------AVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GSLT 431
            +       +++ I + +       V N   S    +IG     VV   G +++    ++ 
Sbjct: 1322 KE------NLFKIDENNKPFFYLWVANRWLSFRIDMIGS---FVVFGAGVFILADIKNID 1372

Query: 432  IGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL----------FDLTDRIPAIRP 481
             G     + Y          L  FYSE+   + + +R+          +D+ D I    P
Sbjct: 1373 SGMAGISLTYAISFTEGALWLVRFYSEVEMNMNSVERIKEYMSVEQEPYDIKDEIVRTPP 1432

Query: 482  TIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALL 541
            T+     P +G IE  +L   Y      +V KN++F +EP + V +VG +G GKSTI   
Sbjct: 1433 TVW----PDEGKIEVNDLSLRYAANLP-RVIKNVSFTVEPNSKVGVVGRTGAGKSTIITA 1487

Query: 542  LLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDN-----------I 590
            L R+ +P SG I IDN DI  +    LR+ + I+ Q+P L +G+++ N           I
Sbjct: 1488 LFRFLDPESGYIKIDNMDITTIPLTRLRRAITIIPQDPTLFAGTLKFNLDPYDEYNDKDI 1547

Query: 591  TYGLKR------EATPDEIREVSKQCFCH-NFITKFPDAYETIIGPHGTLLSGGQKQRIA 643
               L R      E    E   VS Q   H N   +F D    I    G  LS GQ+Q I 
Sbjct: 1548 FAALTRVNLVSGEELNGETTAVSDQGSMHSNNENRFLDLSNEITEGGGN-LSQGQRQLIC 1606

Query: 644  IARALIKKPKILILDEATSALDVESEGAINYTF-GKLMKSKSVTIVSIAHRLSTIRRSEY 702
            +AR+L++ PKIL+LDEAT+++D ES+  +  T  G+   S   TI++IAHRL ++   + 
Sbjct: 1607 LARSLLRNPKILLLDEATASIDYESDARLQATIRGEFGNS---TILTIAHRLRSVIDYDK 1663

Query: 703  IIVLGNDGSVVETGKFKELYADPTSELSKL 732
            I+V+ + G V+E      L  +  SE  K+
Sbjct: 1664 ILVM-DAGEVIEYDHPYSLLLNRNSEFYKM 1692

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 76/255 (29%), Positives = 126/255 (49%), Gaps = 27/255 (10%)

Query: 494 IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI 553
           + F N   ++ T       +NLN   + G    ++G +G GK+++ + LL   +   G+I
Sbjct: 759 LAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLMALLGEMHICQGRI 818

Query: 554 LI---DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIR--EVSK 608
           ++   + +  +  N       +    Q   L++ ++R+NI +     ++ DE R  +V +
Sbjct: 819 IVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFN----SSFDENRYHKVVE 874

Query: 609 QC-FCHNF-ITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDV 666
            C    +F I K  D  E  IG  G  LSGGQKQRI++ARAL    K L+LD+  SA+D 
Sbjct: 875 ACGLKRDFDILKAGDLTE--IGEKGITLSGGQKQRISLARALYSDSKHLLLDDCLSAVDS 932

Query: 667 ESEGAI--NYTFGKLMKSKSVTIVSIAHRLS-TIRRSEYIIVLGNDGSVVETGKFKELYA 723
            +   I  N   G LM  ++  +VS  H ++ T+R +E +++L  DG V + G       
Sbjct: 933 HTASWIYDNCITGPLMVGRTCILVS--HNIALTLRNAELVVIL-EDGRVKDQG------- 982

Query: 724 DPTSELSK-LLNEKQ 737
           DP +   K LL E +
Sbjct: 983 DPLNLFDKGLLGEDE 997

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  156 bits (394), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 128/432 (29%), Positives = 203/432 (46%), Gaps = 27/432 (6%)

Query: 317  QLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQK 376
            +LS   +   P VV+   ++G  +       + +   L  +  E + G+KT+QS   +Q 
Sbjct: 808  KLSLVCIAIIPLVVVLTGLYGTILIKTENRYKTSVANLESIVYEAIIGMKTIQSLCLQQY 867

Query: 377  EIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDL- 435
              +++N  I+ +   G   AV        T+++  +   ++  YG  LVL G  T   L 
Sbjct: 868  ITKKFNCKIKLLEKNGTYRAVATGLGIALTNMLVLLFQSILFYYGFKLVLTGEYTHSKLF 927

Query: 436  --TAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRI-----------PAIRPT 482
               A +L+T  T  S   L     +I +G    +R     D+I           P+   T
Sbjct: 928  ETIALLLFTIVTVAS---LVTQLPDITRG----QRSISWIDQILKGDNQQTIEPPSNLST 980

Query: 483  IGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLL 542
                + P    IE  NL F Y      +   N+N ++       IVG SG GKST+  L+
Sbjct: 981  TKGIWNPNQPVIEVSNLSFTYAQVHNKKTLTNINMQLYSNQIYGIVGKSGSGKSTLINLI 1040

Query: 543  LRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDE 602
               Y+ S G I I + DI K + K L + + ++QQ PVL   +IR+N+ YGL      + 
Sbjct: 1041 CGLYSLSEGSINICSCDINKWSTKELHKTVALLQQNPVLQFDTIRNNLLYGLTETVGDEH 1100

Query: 603  IREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATS 662
            +  V +     +FI    +  ++ +    +LLSGGQ QR+ +AR +++ PK+LILDE TS
Sbjct: 1101 LLNVLEYVGLKSFIISLNNGLDSKLDD--SLLSGGQSQRLCMAREMLRNPKVLILDECTS 1158

Query: 663  ALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELY 722
            ALDV S   IN   G   +S +   + ++H+  TI+  + I  L  DG+V   G ++EL 
Sbjct: 1159 ALDVTSAKKINDIIGS--RSLAPVTIIVSHQKETIKLCDKIFFLV-DGTVAMMGTYEEL- 1214

Query: 723  ADPTSELSKLLN 734
             +   E  KLLN
Sbjct: 1215 MENNWEFRKLLN 1226

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 130/433 (30%), Positives = 198/433 (45%), Gaps = 44/433 (10%)

Query: 322 LVIFA--PAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFV----AEQ 375
           L+IF   P ++I A IF K I   +    E     +  + E+L  +     FV     + 
Sbjct: 177 LIIFCSTPFIIICAVIFSKYIHKYT----EKENTESECAAERLAWMLKNIEFVRLHNGDD 232

Query: 376 KEIRRYNNAIRDI--YNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIG 433
            EI  Y + I     Y I K S  +++  S    +   M F+    +GS ++  G L I 
Sbjct: 233 FEISMYTHYIAQANEYYI-KASLFISANISILRLLSLLM-FVQGFWFGSSMIKQGKLNID 290

Query: 434 D-LTAF--MLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPA-----IRPTIGE 485
             +T+F   L      NS  G +     + +G  A KRL  + DR P      I    G 
Sbjct: 291 SVITSFHCCLMLGSIINSALGQA---VVLQKGDVAMKRLLKMIDRTPRESLAFIDAISGI 347

Query: 486 KFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRY 545
             +P    I F N+ F YP R  ++VF  +NF I+P     ++GPSG GKST+  L+L +
Sbjct: 348 DLLP----IVFNNVSFCYPERKTDKVFDKMNFIIKPNKMTYVIGPSGSGKSTLFDLILLH 403

Query: 546 YNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIRE 605
           Y+   G I++ + DI  +N   + + + +V Q P L + +IR+NI         P ++  
Sbjct: 404 YDNYHGSIMLGDLDIRSINRNIILENITLVSQTPTLFNDTIRNNILACSNWTNLPSKLE- 462

Query: 606 VSKQCFC-----HNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEA 660
              +C C      N I + PD  +T IG  G  LSGGQ Q++A+ARA  +   IL+LDE 
Sbjct: 463 --MECICKFALLENLIAELPDGLDTRIGSGGIKLSGGQAQKVALARAFARNTSILLLDEP 520

Query: 661 TSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGND---GSVVETGK 717
            SA+D+     +     +    K+  I  I H L  IR ++ I+ +       S + T K
Sbjct: 521 LSAVDMRQRIVLMENIKRWRNGKTTVI--ITHDLEFIRNTDNILNISERKILSSALNTEK 578

Query: 718 FKELYADP--TSE 728
            +E   D   TSE
Sbjct: 579 TQEFKWDDHLTSE 591

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  156 bits (394), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 143/531 (26%), Positives = 235/531 (44%), Gaps = 20/531 (3%)

Query: 215  LYPFLGAFAGALVIGTMCNYGRYILLRLLSE-RVVARLRSHVIKKTLHQDAEFFDQNKVG 273
            ++ +LG +       ++    R I L +    +  ARL   + K  L     FF+   VG
Sbjct: 980  IWKYLGIYFLLCFSASLSTLLRSITLCMFCTIKASARLHDAMAKAVLRAPMSFFETTPVG 1039

Query: 274  DLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISA 333
             +++R  +D Y V   L +  S  F  +               Q   F++  +   +   
Sbjct: 1040 RILNRFSNDIYKVDELLGRSFSQFFIHVTKVVFTMIVICSITWQFIFFILPLSVLYLFYQ 1099

Query: 334  SIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGK 393
              + +  R++  +       +    +E L GV TV+SF  + + I    + I        
Sbjct: 1100 QYYLRTSRELRRLASVTKSPVYAHFQETLTGVTTVRSFKKQDRFIHINQSRINTYMCAYY 1159

Query: 394  MSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLS 453
            +S   N   +     +G +  L       + +  G LT G L   + Y      S+  + 
Sbjct: 1160 LSINANRWLAFRLEFMGSIVILAAAVLSVFRLKQGKLTAGMLGLGLSYALQITQSLNWIV 1219

Query: 454  NFYSEIMQGVGAAKRLFDLTDR-------IPAIRPTIGEKFIPGDGCIEFRNLGFAYPTR 506
                E+   + + +R+ + TD        IP  RP    K  P +G I+F +    Y  R
Sbjct: 1220 RMTVEVETNIVSVERIKEYTDLKPEAPMIIPTSRP---PKNWPANGDIKFEHFSTRY--R 1274

Query: 507  PE-NQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP 565
            PE + + +++N  I P   V IVG +G GKS++ + L R    ++G+ILID+  I  +  
Sbjct: 1275 PELDLILEDINLHIHPREKVGIVGRTGAGKSSLTVSLFRLIEAAAGRILIDDLPIDSIGL 1334

Query: 566  KSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFC-HNFITKFPDAYE 624
              LR  + I+ Q+  +  G+ R+NI    K   T DEI    +      + +T   +   
Sbjct: 1335 NDLRSSLSIIPQDSEVFEGTFRENIDPCNK--FTDDEIWNALELAHLKQHVMTLGTEGLN 1392

Query: 625  TIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKS 684
            T +   G+ LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++  I  T     K + 
Sbjct: 1393 TSLKEGGSNLSVGQRQLMCLARALLVPSKILVLDEATAAIDVETDKLIQRTIRTAFKDR- 1451

Query: 685  VTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNE 735
             TI++IAHRL+TI  S+ I+VL + G + E      L  D TS    L NE
Sbjct: 1452 -TILTIAHRLNTIMDSDKIVVL-DKGRIAEFDTPCNLLKDETSIFYSLCNE 1500

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 142/591 (24%), Positives = 258/591 (43%), Gaps = 88/591 (14%)

Query: 180 PKVIGLVLDALKNVMTDSPSSLETSDLPPI-AFGLTLYPFLGAFAGALVIGTMCNYGRYI 238
           P+++ L++  + +  T   +     DLP I  F L +  FL       VI       +Y 
Sbjct: 301 PQLLKLLIKFVYDYSTAVSNDTTLEDLPIIRGFMLAIAMFLVGVVQTTVIQ------QYF 354

Query: 239 LLRLLS-ERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQK---- 293
            L   S   V + + S V +K+L    E    +  GD+++ +  D   + + L+Q     
Sbjct: 355 ALAFDSGMHVSSSMTSMVYQKSLKLSNEASQTSMTGDIVNLMSVDVQRL-QDLSQWGHLI 413

Query: 294 VSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQ 353
            S  F+ ILC            P + + + I    + +++ I G + + +  +  +   +
Sbjct: 414 WSGPFQIILCLFSLYKLLG---PCMWAGVFIMVITIPLNSLIMGIQ-KKLQGVQMKNKDK 469

Query: 354 LTRVSEEQLNGVKTVQSFVAEQK-----EIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSV 408
            TR+  E LN +K+++ +  EQ      +  R    ++++  IG  + +   +FS     
Sbjct: 470 RTRIISEILNNIKSLKLYAWEQPYKAKLDYVRNEKELKNLVKIGITNTISVFQFSV---- 525

Query: 409 IGDMSFLVVLA-YGSYLVLHGSLTIGDLTAFMLYTD--YTANSIFGLSNF--------YS 457
              + F+V  A +G+++     LT  D     L TD  + A ++F L +F         +
Sbjct: 526 ---VPFMVSCATFGTFV-----LTQKDKA---LSTDLIFPALALFNLLSFPLGFIPMAAT 574

Query: 458 EIMQGVGAAKRLF----------DLTDRIPAIRPTIGE--KFIPGDGCIEFRNLGFAYPT 505
             ++   + KRL           D    +P +   IG+    I GD         + +  
Sbjct: 575 SFIEASVSIKRLHSFLTSGEIQRDAIQHLPKVEE-IGDISVNISGDAT-------YLWQR 626

Query: 506 RPENQV-FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLN 564
           +PE +V  KN+NF+   G   CIVG  G GKS +   +L               D+ ++ 
Sbjct: 627 QPEYKVALKNINFQARKGELSCIVGKVGTGKSALIQAML--------------GDLFRVK 672

Query: 565 -PKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAY 623
              +L   +  V Q   +M+G+I+DNI +G K +A   E  +  K C     +   PD  
Sbjct: 673 GSATLHGSVAYVSQVSWIMNGTIKDNILFGYKYDAEFYE--KTIKACALSLDLNTLPDGD 730

Query: 624 ETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGKLMKS 682
           +T +G  G  LSGGQK R+A+ARA+  K  +  LD+  +A+D   S+  + Y  G     
Sbjct: 731 QTFVGERGISLSGGQKARLALARAVYAKADVYFLDDPLAAVDEHVSKHLVKYVIGPTGLL 790

Query: 683 KSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLL 733
           K+ T +   +++  +  ++ I +L N G +V+ G + ++ ++  S L KL+
Sbjct: 791 KTKTRILTTNKIHVLSVADSITLLDN-GVIVQQGSYDQVNSNKDSPLFKLI 840

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  153 bits (386), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 155/562 (27%), Positives = 250/562 (44%), Gaps = 42/562 (7%)

Query: 182  VIGLVLDALKNVMTDSPSSLET--SDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYIL 239
            +I +    + NV     S + T  +D    A+ L +Y  LG FA +L      N  + I+
Sbjct: 953  IIAMFFSVMGNVWLKHWSEVNTVNNDNSHAAYYLFIYFTLG-FASSL-----ANLIQTII 1006

Query: 240  LRLLSE-RVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGF 298
            L +    +   +L S +          FF+   +G +++R  +D Y +   L +  S  F
Sbjct: 1007 LWIFCTIQGSKQLHSSMTSSIFRAPMSFFETTPIGRILNRFSNDVYKIDEILGRSFSQFF 1066

Query: 299  KAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVS 358
            +  +              Q    ++  A   +     F +  R++  +       L    
Sbjct: 1067 QNTIRVSFTIVVICSTTWQFIFLIIPMAFLYIYYQQYFLRTSRELRRLDSTTRSPLYAHF 1126

Query: 359  EEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSK--FSTSTSVIGDMSFLV 416
            +E L GV T++ F  + + I  + N  R   N+      +NS    +     +G +  L 
Sbjct: 1127 QETLCGVSTIRGFAQQDRFI--HINQSRVDSNMMAYYPSINSNRWLAFRLEFLGSLIILG 1184

Query: 417  VLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRI 476
                  + + +GSLT G +   M Y      S+  +     ++   + + +R+ + +  +
Sbjct: 1185 AATLSIFRLKNGSLTAGMIGLSMSYALQVTQSLNWIVRMTVDVESNIVSVERIEEYS-HL 1243

Query: 477  PAIRPTIGE-----KFIPGDGCIEFRNLGFAYPTRPE-NQVFKNLNFKIEPGTSVCIVGP 530
            P+  P I E     +  P  G IEF+N    Y  RPE + V KN+N KI P   V IVG 
Sbjct: 1244 PSEAPLIIENNRPSEEWPSKGAIEFKNYSTRY--RPELDLVLKNINLKILPKEKVGIVGR 1301

Query: 531  SGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNI 590
            +G GKS++ L L R    SSG I ID  +I +L    LR  + I+ Q+  +  GSIR+NI
Sbjct: 1302 TGAGKSSLTLALFRIIEASSGSIEIDGVNINELGLYDLRHKLSIIPQDSQVFEGSIRENI 1361

Query: 591  TYGLKREATPDEIREVSKQCFCHNFITKF----PDA-----------YETIIGPHGTLLS 635
                 ++ +  EI    +       I K     P++            +  I   G+ LS
Sbjct: 1362 --DPTQQFSEQEIWNALEMAHLKPHILKMNEISPESENSDTNQSSNPLDAKITEGGSNLS 1419

Query: 636  GGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLS 695
             GQ+Q I +ARAL+    +LILDEAT+A+DVE++  I +T     K +  TI++IAHR++
Sbjct: 1420 VGQRQLICLARALLVPSNVLILDEATAAVDVETDELIQHTIRTAFKDR--TILTIAHRIN 1477

Query: 696  TIRRSEYIIVLGNDGSVVETGK 717
            TI  S+ IIVL N G V E  K
Sbjct: 1478 TIMDSDKIIVLDN-GEVAEFDK 1498

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 102/418 (24%), Positives = 188/418 (44%), Gaps = 64/418 (15%)

Query: 355 TRVSEEQLNGVKTVQSFVAEQK-----EIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVI 409
           T +  E LN +K+++ +  E+      E  R    ++++  IG  +A++  +F+    ++
Sbjct: 472 TGLVNEILNNIKSLKLYAWEKPFQEKLEFVRNEKELKNLKKIGVFNAMIAFQFNIVPFLV 531

Query: 410 GDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNF--------YSEIMQ 461
              +F +      ++ +       DL        + A ++F L NF         S  ++
Sbjct: 532 SCCTFAI------FVWVEDKPLTTDLV-------FPALTLFNLLNFPLVAVPITISAFIE 578

Query: 462 GVGAAKRLF----------DLTDRIPAIRPTIGEKFIP-GDGCIEFRNLGFAYPTRPENQ 510
              +  RL+          D   R+P ++   GE  +  GD      N  F +  +PE +
Sbjct: 579 ASVSISRLYSYLTNEELQKDAIQRLPFVKQN-GETTVKIGD------NATFLWKRKPEYK 631

Query: 511 V-FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP-KSL 568
           V  KN+NF+   G   CIVG  G GKS     +L               D+ ++    S+
Sbjct: 632 VALKNINFEARKGELACIVGKVGSGKSAFIQSIL--------------GDLFRVKGFASI 677

Query: 569 RQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIG 628
              +  V Q   +M+G+++DNI +G + +  P+   +  K C     ++  PD  +T++G
Sbjct: 678 HGNVAYVSQLAWIMNGTVKDNIIFGHRYD--PEFYEKTIKACALTIDLSILPDGDQTLVG 735

Query: 629 PHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGKLMKSKSVTI 687
             G  LSGGQK R+++ARA+  +  I +LD+  +A+D   S+  I    G     KS T 
Sbjct: 736 EKGISLSGGQKARLSLARAVYARADIYLLDDPLAAVDEHVSKHLIQNVLGAKGLLKSKTR 795

Query: 688 VSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEA 745
           +   +++  +  ++ I +L N G + E G + ++ A   S LSKL+ E   + +  E+
Sbjct: 796 ILTTNKIPVLSIADSITLLEN-GEITEQGTYFDVMATEGSSLSKLITEYGKKKDSSES 852

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  152 bits (385), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 135/511 (26%), Positives = 232/511 (45%), Gaps = 35/511 (6%)

Query: 238  ILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDG 297
            +L  +L  R   ++   ++ +TLH    FFD   +G +++R   D   V + LT  +   
Sbjct: 1128 VLNFVLGIRASRKIFESLLYRTLHAKLGFFDATPIGRIMNRFSKDIESVDQELTPYLEAA 1187

Query: 298  FKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRV 357
            F  ++             PQ  S  ++      +    +    R++      +   + + 
Sbjct: 1188 FFCLVQCIATMALITFITPQFLSVAILVGCLYYLVGYFYMAASRELKRFESISKSPIYQH 1247

Query: 358  SEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVV 417
              E L GV T++++  E + +    + I +         V N   S    +IG     V+
Sbjct: 1248 FSETLVGVATIRAYGDESRFMLENLHKIDENNKPFFYLWVFNRWLSFRIDMIGA---FVI 1304

Query: 418  LAYGSYLVLH-GSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDR- 475
               G +++ +  ++  G     + Y          L  FY+++   + + +RL +  +  
Sbjct: 1305 FGAGVFILTNIKNIDSGMAGISLTYAISFTEGALWLVRFYADVEMNMNSVERLKEYMEIE 1364

Query: 476  ---IPAIRPTIGEKFIPGDGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPS 531
                   + T+     P +G IE ++L   Y P  P  +V KN++F +EP T + IVG +
Sbjct: 1365 QEPYDEYKDTLLHDEWPSNGKIEVKDLSLRYAPNLP--KVIKNVSFVVEPKTKIGIVGRT 1422

Query: 532  GRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIR---- 587
            G GKSTI   + R+ NP SG I ID+ +I  +N   LR+ + I+ Q+P L +G+I+    
Sbjct: 1423 GAGKSTIITAMFRFLNPESGYIKIDDVNIASINLTKLRRSITIIPQDPTLFTGTIKLNLD 1482

Query: 588  -------DNITYGLKRE--ATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQ 638
                   D I   LKR    T +E++    Q        KF +  E  I   G+ LS GQ
Sbjct: 1483 PYNEFTDDAIFEALKRVNLVTEEELQNNGTQTGTSENANKFLNL-ENEITEGGSNLSHGQ 1541

Query: 639  KQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIR 698
            +Q + +AR+L++ PKI++LDEAT+++D  S+  I  T  K       TI++IAHRL ++ 
Sbjct: 1542 RQLVCLARSLLRNPKIILLDEATASIDYASDAKIQETIRKEFSQS--TILTIAHRLRSVI 1599

Query: 699  RSEYIIVLGNDGSVVETGKFKELYADPTSEL 729
              + IIV+       + G+ KE Y  P S L
Sbjct: 1600 DYDKIIVM-------DAGEVKE-YDHPYSLL 1622

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 116/230 (50%), Gaps = 13/230 (5%)

Query: 494 IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI 553
           I F+N+   +    E+   ++LN + +PG    ++GP+G GK+++ L LL       G+I
Sbjct: 711 IAFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEI 770

Query: 554 LID----NQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQ 609
           ++      QD++ ++   L   +    Q   L++ ++R+NI +        +    V   
Sbjct: 771 IVPALNPRQDLV-IDKFGLTNSIAYCSQAAWLLNETVRNNILFN--SPYNEERYNAVIDA 827

Query: 610 CFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESE 669
           C     +     +  T IG  G  LSGGQKQR+++ARAL    K ++LD+  SA+D  + 
Sbjct: 828 CGLRRDLKILKASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTA 887

Query: 670 GAI--NYTFGKLMKSKSVTIVSIAHRLS-TIRRSEYIIVLGNDGSVVETG 716
             I  N   G LM  ++  +VS  H ++ T++ +E +++L N G V + G
Sbjct: 888 LWIYDNCITGPLMSGRTCILVS--HNIALTLKNAELVVILEN-GRVKDQG 934

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  152 bits (385), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 149/559 (26%), Positives = 253/559 (45%), Gaps = 68/559 (12%)

Query: 215  LYPFLGAFAGALVIGTMCNYGRYILLRLLSE-RVVARLRSHVIKKTLHQDAEFFDQNKVG 273
            ++ F+G +A   V     N  R I+L L    R  A+L   + K  L     FF+   VG
Sbjct: 993  VWKFVGIYAAIGVFSAAFNNLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVG 1052

Query: 274  DLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVIS- 332
             +I+R  SD   V  +L    +  F++IL             P    FL++ A  ++I  
Sbjct: 1053 RIINRFSSDVQAVDSTLQWVFAFFFRSILNYAVTVILISYNMPW---FLIVNAVLLIIYI 1109

Query: 333  --ASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYN 390
               + +    R++  +   +T  +  +  E L G   + +F    K   R+     D  N
Sbjct: 1110 YYQAFYITLSRELKRLTSVSTSPIMSLFSETLGGHAVINAF----KHFDRF-----DFIN 1160

Query: 391  IGKMSAVVNSKFS-TSTSVIGDMSFLVVLAYGSYLVLHGSL----TI--------GDLTA 437
               +   +N  F+  ST+    +    +   G+++VL  +L    TI        G +  
Sbjct: 1161 FNNVQFNINCSFNFRSTNRWLSVRLQTI---GAFIVLATALLALSTINSERRLSPGMVGL 1217

Query: 438  FMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIP-------AIRPTIGEKFIPG 490
             M Y     +S+  +     +I   + + +R+++  +  P       + RP   +K  P 
Sbjct: 1218 LMSYALQVTSSLMWIVRMSVQIETNIVSVERIYEYCNLTPEAPEVIESCRP---KKTWPS 1274

Query: 491  DGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSS 550
            +G I F+N    Y T+ +    K +N  I+P   + +VG +G GKST++L L R    + 
Sbjct: 1275 EGEIIFKNYSTKYKTKGD-LALKGINLSIKPQEKIGVVGRTGAGKSTLSLALFRLLEATE 1333

Query: 551  GQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNI----TYGLKREATPDEIREV 606
            G I ID  DI K+  K LR ++GI+ Q+     G++R N+     Y  +      E+  +
Sbjct: 1334 GTIEIDGLDISKMGLKDLRSHLGIIPQDAQAFEGTVRSNLDPFEQYSTEELWASIELSHL 1393

Query: 607  SK---QCFCHNFITKFPDAYETI----IGPHGTLLSGGQKQRIAIARALIKKPKILILDE 659
                 + F     ++ P + E +    I  +G  LS GQ+Q + ++RAL+   K+L+LDE
Sbjct: 1394 KPHIVEMFRKEDNSELPASKEKMLDVKISENGGNLSVGQRQLLCLSRALLNTSKVLVLDE 1453

Query: 660  ATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFK 719
            AT+A+D+E++  I  T    +K K  TI++IAHR+ T+  S+ IIVL       + G+ K
Sbjct: 1454 ATAAVDMETDKIIQETIRSELKEK--TILTIAHRIDTVLDSDKIIVL-------DAGQVK 1504

Query: 720  ELYADPTSELSKLLNEKQS 738
            E +  P      LL+ KQS
Sbjct: 1505 E-FDTP----ENLLSNKQS 1518

 Score =  110 bits (276), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 112/436 (25%), Positives = 204/436 (46%), Gaps = 54/436 (12%)

Query: 334 SIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNA-----IRDI 388
           S   K++  +  I  +      + + E LN +K+++ +  E+  ++R ++      + + 
Sbjct: 442 SFLSKRVEKLYKIQMKYKDARIKTTTEILNSMKSIKLYAWEEAMLKRLDHVRNGLELENY 501

Query: 389 YNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANS 448
             IG +S ++   ++    ++   +F  + ++ +   L   +    L+ F +  D    +
Sbjct: 502 KRIGVVSNLIYFAWNCVPLMVTCSTF-AIFSFFNKTPLSPEVVFPSLSLFNILND----A 556

Query: 449 IFGLSNFYSEIMQGVGAAKRL------FDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFA 502
           I+ L N  + I++   +  R+       +L D    I  T  +K  P    +E  N  F 
Sbjct: 557 IYSLPNTINSIIETKVSINRIKEFLLSEELDDSFIEIDKTPSDKVSP---VVEIINATFL 613

Query: 503 Y-------------PTRPENQ--VFKNLN-FKIEPGTSVCIVGPSGRGKSTIALLLLRYY 546
           +              +R E+     +N+N F+ + G   CIVG  G GKST+   +L   
Sbjct: 614 WKSPKILFSEGSDEESRIESSQVALENINGFQAKKGELTCIVGRVGSGKSTMLRAIL--- 670

Query: 547 NPSSGQILIDNQDIMKLNPKSL--RQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIR 604
               GQ+   N  +  L PK L     +    QEP +M+ SI+DNIT+G + + T     
Sbjct: 671 ----GQLPCVNASVGGLEPKVLIRASTVAYCPQEPWIMNASIKDNITFGFRYDET--YYN 724

Query: 605 EVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSAL 664
              K C     +   P+   T++G  G  LSGGQK RI++ARA+  +  + +LD+  SA+
Sbjct: 725 ATIKACQLLPDLDILPERDNTLVGEKGISLSGGQKARISLARAVYSRADLFLLDDILSAV 784

Query: 665 DVE-SEGAINYTFGK---LMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKE 720
           D E S+  +     K   L+++K+V + + A  +S + RS+ I +L   GS+VE G F E
Sbjct: 785 DAEVSKNIVEMVLDKKMGLLRNKTVVLTTNA--ISVLNRSQKIYML-EGGSIVEEGSFTE 841

Query: 721 LYADPT-SELSKLLNE 735
           + + P  S+L K+++E
Sbjct: 842 VTSSPEPSKLKKMIDE 857

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  151 bits (381), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 150/556 (26%), Positives = 256/556 (46%), Gaps = 56/556 (10%)

Query: 215  LYPFLGAFAGALVIGTMCNYGRYILLRLL-SERVVARLRSHVIKKTLHQDAEFFDQNKVG 273
            L  FLG +A   + G  CN  R + + L  S R   +L + + K  +     FF+    G
Sbjct: 991  LLWFLGVYAAIGLGGAFCNNMRSLTMLLYGSLRGSRKLHNKMAKTIMRSPMSFFETTPTG 1050

Query: 274  DLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVIS- 332
             +I+R  SD   V  +L    S  F++IL             P    F ++ A  +VI  
Sbjct: 1051 RIINRFSSDMDSVDTTLQNVFSLFFRSILDYIITVILVTFNMPL---FFLLNAGLLVIYL 1107

Query: 333  --ASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYN 390
               S +    R++  +   +   +  +  E L+G  T+ ++    ++IRR+++      N
Sbjct: 1108 YYQSFYIVLSRELKRLTSISYSPIMSLMGESLSGHFTISAY----EQIRRFSHL-----N 1158

Query: 391  IGKMSAVVNSKFSTSTS------VIGDMSFLVVLAYG----SYLVLHGSLTIGDLTAFML 440
              ++   +N  F+  +S       +  +  L+VL+ G    S L     L+ G +   M 
Sbjct: 1159 YERIQFSINCFFNYRSSNRWLSVRLQSIGALIVLSTGLLALSSLGTDHQLSSGLVGLLMS 1218

Query: 441  YTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKF-----IPGDGCIE 495
            Y     +S+  +      I   + + +R+ +  D  P   P + E+       P  G IE
Sbjct: 1219 YALQVTSSLIWIIRSSVLIETNIVSVERIVEYCDISPE-APEVKEEHRLDDNWPNQGQIE 1277

Query: 496  FRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILI 555
            F+N   +Y    +  V K++N  I PG  + +VG +G GKST+++ L R   P++G I I
Sbjct: 1278 FKNYSTSYRENLD-PVLKHINLVISPGEKIGVVGRTGAGKSTLSMALFRLLEPTAGTISI 1336

Query: 556  DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIR-----------DNITYGLKREATPDEIR 604
            DN DI  +  + LR ++ I+ Q+     G+IR           D++ + ++       + 
Sbjct: 1337 DNIDITSIGLRDLRSHIAIIPQDAQAFEGTIRSNLDPFEKFSDDDLWHAIELSHLKFHLE 1396

Query: 605  EVSKQCFCHNFITKFPDA------YETIIGPHGTLLSGGQKQRIAIARALIKKPKILILD 658
             ++K+    N  +++ D        +  +   G+ LS GQKQ + +ARAL+ K KIL+LD
Sbjct: 1397 TIAKEI---NDDSEYSDRSRLESPLDIPVREAGSNLSVGQKQLLCLARALLNKSKILVLD 1453

Query: 659  EATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKF 718
            EAT+++DVE++  I  T  K    +  TI++IAHRL T+  S+ IIVL + G V E  K 
Sbjct: 1454 EATASVDVETDKIIQETIRKEFADR--TILTIAHRLDTVFDSDRIIVL-DGGEVKEFDKP 1510

Query: 719  KELYADPTSELSKLLN 734
            + L     S   KL +
Sbjct: 1511 ETLLEQKDSIFYKLCD 1526

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 114/225 (50%), Gaps = 15/225 (6%)

Query: 516 NFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIV 575
           NF++   + +C+VG  G GKSTI   +L      SG     N D +    +     +   
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCILGQLPCISG-----NNDHLSPQFQINATTVAYC 693

Query: 576 QQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLS 635
            QE  +M+ S++DNI +G K +      +   K C     I   PD  ET++G  G +LS
Sbjct: 694 PQEAWIMNASVKDNILFGHKYDEAF--YKATIKACQLLPDIKVLPDGDETMVGEKGIVLS 751

Query: 636 GGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGK---LMKSKSVTIVSIA 691
           GGQK R+++ARA+  +  + +LD+  SA+D E  +  I     +   L+K KS+ + +  
Sbjct: 752 GGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDKSIVLAT-- 809

Query: 692 HRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPT-SELSKLLNE 735
           + +S ++ S  I +L N  S+ + G + ++  +   S+L  +L+E
Sbjct: 810 NTISVLKHSTKIYLLENK-SIAQEGNYDDIMNNQQDSKLKNILHE 853

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 150/557 (26%), Positives = 246/557 (44%), Gaps = 59/557 (10%)

Query: 211  FGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQN 270
            + L LY  +G FA AL+       G+ IL  +       ++ + ++ K LH    FFD  
Sbjct: 1103 YYLVLYLIIG-FAQALL-----GAGKTILNFVAGINASRKIFNMILNKVLHSKIRFFDAT 1156

Query: 271  KVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVV 330
              G +++R   D   + + LT  +   F +++             PQ  S  ++ +    
Sbjct: 1157 PTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSILYY 1216

Query: 331  ISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAE----QKEIRRYNNAIR 386
                 +    R++      +   + +   E L GV T+++F  E    Q+ + + +   +
Sbjct: 1217 FVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLHKIDENNK 1276

Query: 387  DIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GSLTIGDLTAFMLYTDYT 445
              + +     V N   +    +IG    LV+   G +++ +  +L  G     + Y    
Sbjct: 1277 PFFYLW----VANRWLAFRIDMIGS---LVIFGAGLFILFNINNLDSGMAGISLTYAISF 1329

Query: 446  ANSIFGLSNFYSEI---MQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFA 502
                  L   YSE+   M  V   K   ++          I     P DG IE  +L   
Sbjct: 1330 TEGALWLVRLYSEVEMNMNSVERVKEYMEIEQEPYNEHKEIPPPQWPQDGKIEVNDLSLR 1389

Query: 503  Y-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIM 561
            Y P  P  +V KN++F ++  + + IVG +G GKSTI   L R+  P +G I IDN DI 
Sbjct: 1390 YAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDIS 1447

Query: 562  KLNPKSLRQYMGIVQQEPVLMSGSIRDN-----------ITYGLKREATPDE-------I 603
             ++ + LR+ + I+ Q+P L SG+I+ N           I   LKR     E        
Sbjct: 1448 GVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQIFEALKRVNLISEEQLQQGAT 1507

Query: 604  REVSKQCFCHNF--ITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEAT 661
            RE S +    N   + KF D   + I   G+ LS GQ+Q + +AR+L++ PKI++LDEAT
Sbjct: 1508 RETSNEASSTNSENVNKFLDL-SSEISEGGSNLSQGQRQLMCLARSLLRSPKIILLDEAT 1566

Query: 662  SALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
            +++D  S+  I  T  K  +    TI++IAHRL ++   + I+V+       + G+ KE 
Sbjct: 1567 ASIDYSSDAKIQETIRKEFQGS--TILTIAHRLRSVIDYDKILVM-------DAGEVKE- 1616

Query: 722  YADPTSELSKLLNEKQS 738
            Y  P S    LL  KQS
Sbjct: 1617 YDHPYS----LLLNKQS 1629

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 126/268 (47%), Gaps = 28/268 (10%)

Query: 489 PGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNP 548
           P      F N   ++    ++   K+LN + + G    ++GP+G GK+++ + LL     
Sbjct: 689 PNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 549 SSGQILI---DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIRE 605
            +G++++   + +  + ++       +    Q   L++ ++++NI +           + 
Sbjct: 749 LNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFN--SPFNEARYKA 806

Query: 606 VSKQC-FCHNF-ITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSA 663
           V + C    +F I K  D  E  IG  G  LSGGQKQR+++ARAL    + ++LD+  SA
Sbjct: 807 VVEACGLKRDFEILKAGDLTE--IGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSA 864

Query: 664 LDVESEGAI--NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
           +D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G     
Sbjct: 865 VDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG----- 917

Query: 722 YADPTSELSK-LLNEKQ-------SRAN 741
             DP   L K L  E +       SRAN
Sbjct: 918 --DPIDMLQKGLFGEDELVKSSILSRAN 943

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  149 bits (377), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 140/542 (25%), Positives = 253/542 (46%), Gaps = 55/542 (10%)

Query: 218  FLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLIS 277
            +L  + G  V   +C+  + I+  +   R   ++ + ++K  L+    FFD   +G +++
Sbjct: 1099 YLSIYLGIGVFQALCSSSKAIINFVAGIRASRKIFNLLLKNVLYAKLRFFDSTPIGRIMN 1158

Query: 278  RLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVI---SAS 334
            R   D   + + LT  +   F +++             PQ   FL++ A  +++    A 
Sbjct: 1159 RFSKDIESIDQELTPYMEGAFGSLIQCVSTIIVIAYITPQ---FLIVAAIVMLLFYFVAY 1215

Query: 335  IFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQK----EIRRYNNAIRDIYN 390
             +    R++  +   +   + +   E L G+ T+++F  E++     +++ ++  R  + 
Sbjct: 1216 FYMSGARELKRLESMSRSPIHQHFSETLVGITTIRAFSDERRFLVDNMKKIDDNNRPFFY 1275

Query: 391  IGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFML-YTDYTANSI 449
            +     V N   S    +IG    L+VLA GS+++L+       L    L +     +  
Sbjct: 1276 LW----VCNRWLSYRIELIGA---LIVLAAGSFILLNIKSIDSGLAGISLGFAIQFTDGA 1328

Query: 450  FGLSNFYSEIMQGVGAAKRLFDLT------DRIPAIRPTIGEKFIPGDGCIEFRNLGFAY 503
              +   YS +   + + +RL + T        + A+ P       P +G IE ++L   Y
Sbjct: 1329 LWVVRLYSNVEMNMNSVERLKEYTTIEQEPSNVGALVPPCE---WPQNGKIEVKDLSLRY 1385

Query: 504  PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKL 563
                  +V KN+ F ++    V IVG +G GKSTI   L R+ +P +G I ID+ DI  +
Sbjct: 1386 AAGLP-KVIKNVTFTVDSKCKVGIVGRTGAGKSTIITALFRFLDPETGYIKIDDVDITTI 1444

Query: 564  NPKSLRQYMGIVQQEPVLMSGSIRDN-----------ITYGLKRE--ATPDEIRE--VSK 608
              K LRQ + I+ Q+P L +G+++ N           I   LKR    + +E+     S 
Sbjct: 1445 GLKRLRQSITIIPQDPTLFTGTLKTNLDPYNEYSEAEIFEALKRVNLVSSEELGNPSTSD 1504

Query: 609  QCFCHNF-ITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE 667
                H+  + KF D  E  +   G+ LS GQ+Q I +AR+L++ PK+++LDEAT+++D  
Sbjct: 1505 STSVHSANMNKFLD-LENEVSEGGSNLSQGQRQLICLARSLLRCPKVILLDEATASIDYN 1563

Query: 668  SEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTS 727
            S+  I  T  +   +   TI++IAHRL +I   + I+V+       + G+ KE Y  P S
Sbjct: 1564 SDSKIQATIREEFSNS--TILTIAHRLRSIIDYDKILVM-------DAGEVKE-YDHPYS 1613

Query: 728  EL 729
             L
Sbjct: 1614 LL 1615

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 117/239 (48%), Gaps = 25/239 (10%)

Query: 496 FRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILI 555
            +N  F +    ++   KNL    + G    IVGP+G GK+++ + LL      +G++ +
Sbjct: 701 LQNATFTWDKNNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTSLLMGLLGEMELLNGKVFV 760

Query: 556 DNQDIMKLNPKS--------LRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIR--E 605
            +     LNP+         +   +    Q   L++ ++R+NI +     A  +E R   
Sbjct: 761 PS-----LNPREELVVEADGMTNSIAYCSQAAWLLNDTVRNNILFN----APYNENRYNA 811

Query: 606 VSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALD 665
           V   C             +T IG  G  LSGGQKQR+++AR+L    + L+LD+  SA+D
Sbjct: 812 VISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLYSSSRHLLLDDCLSAVD 871

Query: 666 VESEGAI--NYTFGKLMKSKSVTIVSIAHRLS-TIRRSEYIIVLGNDGSVVETGKFKEL 721
             +   I  N   G LM+ ++  +VS  H ++ T++ ++++I++ N G V E G+  EL
Sbjct: 872 SHTALWIYENCITGPLMEGRTCVLVS--HNVALTLKNADWVIIMEN-GRVKEQGEPVEL 927

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  149 bits (377), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 133/495 (26%), Positives = 228/495 (46%), Gaps = 36/495 (7%)

Query: 255  VIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXX 314
            +++K LH    FFD   +G +++R   D   V + LT      F +++            
Sbjct: 1182 LLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFFEGAFYSLVTCLSTVVLITFI 1241

Query: 315  XPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAE 374
             PQ     VI A         +    R++  +   +   + +   E L GV T+++F  E
Sbjct: 1242 TPQFLIVAVIVAVLYYFIGYFYLAGSRELKRLDSISRSPIYQHFSETLVGVTTIRAFGDE 1301

Query: 375  QKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GSLTIG 433
             + I+   + I +         V N   +    +IG    LVV   G +++L+   +  G
Sbjct: 1302 SRFIQENLHKIDENNRPFFYLWVANRWLAMRIDLIGS---LVVFGAGVFILLNIDHIDAG 1358

Query: 434  DLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL--FDLTDRIPAIRPTIGE-KFIPG 490
                 + Y          L   YS +   + + +RL  + + ++ P  +P +      P 
Sbjct: 1359 MAGISLTYAITFTEGALWLVRLYSNVEMNMNSVERLKEYMVVEQEPYNQPIMTPPSDWPQ 1418

Query: 491  DGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
             G +E  ++   Y P  P  +V KN++F +EP + V +VG +G GKSTI   L R+ +P 
Sbjct: 1419 HGRVEMSDVSLRYAPGLP--RVIKNVSFTVEPKSKVGVVGRTGAGKSTIITALFRFLDPE 1476

Query: 550  SGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDN-----------ITYGLKRE- 597
            +G I IDN DI  ++ + LR+ + I+ Q+P L +G+I+ N           I   LKR  
Sbjct: 1477 TGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNLDPYDEYSDEDIFAALKRVN 1536

Query: 598  -ATPDEI--REVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKI 654
              + +E+    +         + KF D   + I   G  LS GQ+Q + +AR+L++ PKI
Sbjct: 1537 LVSQEELDRSNIDAASVGSENVNKFLDL-NSEINEGGGNLSQGQRQLVCLARSLLRSPKI 1595

Query: 655  LILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
            ++LDEAT+++D +S+  I  T  K  +    TI++IAHRL ++   + I+V+       +
Sbjct: 1596 ILLDEATASIDYQSDAKIQETIRKEFQGN--TILTIAHRLRSVIDYDKILVM-------D 1646

Query: 715  TGKFKELYADPTSEL 729
             G+ KE Y  P S L
Sbjct: 1647 QGEVKE-YDHPYSLL 1660

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 67/248 (27%), Positives = 119/248 (47%), Gaps = 16/248 (6%)

Query: 489 PGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNP 548
           PG   + F N   ++ +  ++   +NLN   + G    ++GP+G GK++I + LL     
Sbjct: 741 PGGQKLGFENATISWDSEKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKL 800

Query: 549 SSGQILI---DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIRE 605
            +G I++   D + ++ ++   +   +    Q   L++ ++R+NI +      +     +
Sbjct: 801 LNGNIVVPSLDPRALLPIDADGMTNSIAYCSQAAWLLNDTVRNNILFN--SPYSEARYND 858

Query: 606 VSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALD 665
           V + C              T IG  G  LSGGQKQRI++AR+L    + L+LD+  SA+D
Sbjct: 859 VIEACGLKRDFEILSAGDMTEIGERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVD 918

Query: 666 VESEGAI--NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYA 723
             +   I  N   G LM+ +  T + I+H ++   R+  ++VL  +G V E G       
Sbjct: 919 SHTASWIYDNCITGPLMQGR--TCILISHNIALTLRNAELVVLLENGQVKEQG------- 969

Query: 724 DPTSELSK 731
           DP + L K
Sbjct: 970 DPLTLLHK 977

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  148 bits (374), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 169/589 (28%), Positives = 267/589 (45%), Gaps = 91/589 (15%)

Query: 184  GLVLDALK-NVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRL 242
            G  +D L    MTDS  +   +      + LT+Y  +G      +I  M    + ++  L
Sbjct: 1017 GFAMDTLPLKGMTDSSKNKHNA-----FYYLTVYFLIG------IIQAMLGGFKTMMTFL 1065

Query: 243  LSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAIL 302
               R   ++ ++++   LH    FFD   VG +++R   D   V + L   +      ++
Sbjct: 1066 SGMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFCLI 1125

Query: 303  CXXXXXXXXXXXXPQLSSFLVI------FAPAVVISASIFGKKIRDI--STILQEATGQL 354
                         P+  +  VI      F     ++AS   K++  I  S I Q  +   
Sbjct: 1126 QCASIIFLITVITPRFLTVAVIVFVLYFFVGKWYLTASRELKRLDSITKSPIFQHFS--- 1182

Query: 355  TRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSF 414
                 E L GV T+++F  E++ I    N I          +V    FS    +IG    
Sbjct: 1183 -----ETLVGVCTIRAFGDERRFILENMNKIDQNNRAFFYLSVTVKWFSFRVDMIGA--- 1234

Query: 415  LVVLAYGSYLVLH-----GSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL 469
             +VLA GS+++L+       L    LT  +L+TD        L   YS     + + +RL
Sbjct: 1235 FIVLASGSFILLNIANIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMNMNSVERL 1290

Query: 470  FDLTD------------RIPAIRPTIGEKFIPGDGCIEFRNLGFAY-PTRPENQVFKNLN 516
             + +             RI  +     E   P DG IE  NL   Y P  P   V +N++
Sbjct: 1291 KEYSSIEQENYLGHDEGRILLL----NEPSWPKDGEIEIENLSLRYAPNLPP--VIRNVS 1344

Query: 517  FKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQ 576
            FK++P + + IVG +G GKSTI   L R   P +G I ID QDI K++  +LR+ + I+ 
Sbjct: 1345 FKVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIP 1404

Query: 577  QEPVLMSGSIRDNI----TYGLKR---------EATPDEIREV--SKQCF--CHNFITKF 619
            Q+P+L +G+I+ N+     Y  K+           +  E  EV  S++ F   HN   KF
Sbjct: 1405 QDPILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHN---KF 1461

Query: 620  PDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVES----EGAINYT 675
             + + T I   G  LS G++Q + IAR+L+++PKI++LDEATS++D +S    +G I   
Sbjct: 1462 LNLH-TEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSE 1520

Query: 676  FGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYAD 724
            F K       TI++IAHRL ++   + IIV+ + G V E  +  EL  D
Sbjct: 1521 FNK------STILTIAHRLRSVIDYDRIIVM-DAGEVKEYDRPSELLKD 1562

 Score = 92.4 bits (228), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 129/460 (28%), Positives = 205/460 (44%), Gaps = 63/460 (13%)

Query: 320 SFLVIFAPAVVISASIFGKKIRDISTILQEATGQLT--RVSE--EQLNGVKTVQSFVAEQ 375
           S +++  P   + A++ GK         Q+ T + T  R+S+  E L  ++ V+ F  E+
Sbjct: 496 SIILVMFPLNFLLANLLGK--------FQKQTLKCTDQRISKLNECLQNIRIVKYFAWER 547

Query: 376 KEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLV-VLAYGSYLVLHGSLTIGD 434
                  N I +I +I +       K S   SV   + F+   L  G    +   +   D
Sbjct: 548 -------NIINEIKSIRQKELRSLLKKSLVWSVTSFLWFVTPTLVTGVTFAICTFVQHED 600

Query: 435 LTAFMLYTDYTANSIFG-----LSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKF-- 487
           L A + +T  +  ++       LSN  S I Q   + KR+ D       +R    EK+  
Sbjct: 601 LNAPLAFTTLSLFTLLKTPLDQLSNMLSFINQSKVSLKRISDF------LRMDDTEKYNQ 654

Query: 488 ---IPGDGCIEFRNLGFAYPTRPEN-QVFK--NLNFKIEPGTSVCIVGPSGRGKSTIALL 541
               P    IEF+N    +     +   FK   LN K + G    I+G +G GKS + L 
Sbjct: 655 LTISPDKNKIEFKNATLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLG 714

Query: 542 LLRYYNPSSGQILIDN----QDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKRE 597
           LL   N  SG I++ +     D++  + + L        Q   L++ ++++NI +     
Sbjct: 715 LLGELNLISGSIIVPSLEPKHDLIP-DCEGLTNSFAYCSQSAWLLNDTVKNNIIF--DNF 771

Query: 598 ATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILIL 657
              D   +V   C     +   P    T IG  G  LSGGQKQRI++ARA+    K ++L
Sbjct: 772 YNEDRYNKVIDACGLKRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLL 831

Query: 658 DEATSALDVESEGAI--NYTFGKLMKSKSVTIVSIAHRLS-TIRRSEYIIVL-----GND 709
           D+  SA+D  +   I  N   G LMK+++  +V+  H +S T+R + + IVL      N 
Sbjct: 832 DDCLSAVDSHTAVWIYENCITGPLMKNRTCILVT--HNVSLTLRNAHFAIVLENGKVKNQ 889

Query: 710 GSVVE---TGKFKELYADPTSELSKLLNEKQSRANKKEAP 746
           G++ E    G FKE Y   +S  S  +NEK   AN+ +AP
Sbjct: 890 GTITELQSKGLFKEKYVQLSSRDS--INEKN--ANRLKAP 925

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  148 bits (373), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 145/539 (26%), Positives = 242/539 (44%), Gaps = 36/539 (6%)

Query: 209  IAFGLTLYPFLGAFAGALVIGTMCNY-GRYILLRLLSERVVARLRSHVIKKTLHQDAEFF 267
            I FGL  +  L      +++   C   G   L  L++   VA LR+ +          FF
Sbjct: 992  IYFGLGCFSALSTLIQTIILWVYCTIRGSKYLHNLMT---VAVLRAPM---------TFF 1039

Query: 268  DQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAP 327
            +   +G +++R  +D Y V   L +  S  F   +              Q    ++    
Sbjct: 1040 ETTPIGRILNRFSNDVYKVDSVLGRTFSQFFVNAVKVSFTIIVICFTTWQFIFIIIPLGV 1099

Query: 328  AVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRD 387
              +     F +  R++  +       +    +E L G+ T++ +  +Q+    + N  R 
Sbjct: 1100 FYIYYQQYFLRTSRELRRLDSITKSPIFSHFQETLGGITTIRGY--QQQHRFTHINQCRV 1157

Query: 388  IYNIGKMSAVVNSK--FSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYT 445
              N+      VN+    +     IG +  L       + +  G+LT G +   + Y    
Sbjct: 1158 DNNMSAFYPSVNANRWLAYRLETIGSLIILGAATLSVFRLRQGTLTAGMVGLSLSYALQI 1217

Query: 446  ANSIFGLSNFYSEIMQGVGAAKRL---FDLTDRIPAI----RPTIGEKFIPGDGCIEFRN 498
              S+  +     E+   + + +R+    DL    PA+    RP   E + P +G I+F +
Sbjct: 1218 TQSLNWIVRMTVEVETNIVSVERIKEYSDLKSEAPAVIEDHRP--AETW-PDEGDIKFEH 1274

Query: 499  LGFAYPTRPE-NQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDN 557
                Y  RPE + + K++N  I+P   V IVG +G GKS++ L L R    SSG+I+IDN
Sbjct: 1275 YSTRY--RPELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRIIEASSGRIVIDN 1332

Query: 558  QDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFIT 617
              I ++    LR  + I+ Q+  +  G++R+NI      E T ++I  V       + I 
Sbjct: 1333 VPINEIGLYDLRHKLSIIPQDSQVFEGTVRENI--DPTNEYTDEQIWNVLALSHLKDHII 1390

Query: 618  KFPD-AYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTF 676
               D      +   G  LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++  I  T 
Sbjct: 1391 SMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAVDVETDKVIQETI 1450

Query: 677  GKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNE 735
                K +  TI++IAHR++TI  S+ IIVL N G++ E    ++L  +P+S    L  E
Sbjct: 1451 RTAFKDR--TILTIAHRINTIMDSDRIIVLDN-GTIKEFDSPEKLLENPSSLFYSLCQE 1506

 Score =  103 bits (257), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 106/425 (24%), Positives = 192/425 (45%), Gaps = 66/425 (15%)

Query: 355 TRVSEEQLNGVKTVQSFVAE----QK-EIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVI 409
           TRV  E LN +K+++ +  E    QK E  R N  ++++  +G   A+++ +F+    ++
Sbjct: 481 TRVISEMLNNIKSLKLYAWEVPYRQKLENVRNNKELKNLTKLGCYMALMSFQFNVVPFLV 540

Query: 410 GDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL 469
              +F     Y     L   L    LT F L        +  + N  + I++   +  RL
Sbjct: 541 SCCTF-AAFIYTENRPLTTDLVFPALTLFNL----LHFPLMVIPNVLTMIIETSVSIGRL 595

Query: 470 F----------DLTDRIPAIRPTIGEKFIP-GDGCIEFRNLGFAYPTRPENQV-FKNLNF 517
           F          D   R+P +   IG+  I  GD      +  F +  +PE +V  KN+NF
Sbjct: 596 FSFLTNEELQKDAVQRLPKV-TNIGDVAINVGD------DATFLWQRKPEYKVALKNINF 648

Query: 518 KIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP-KSLRQYMGIVQ 576
           + + G   CIVG  G GKS +   +L               D+ ++    ++   +  V 
Sbjct: 649 QAKKGELTCIVGKVGSGKSAMIQSIL--------------GDLFRVKGFATIHGNVAYVS 694

Query: 577 QEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSG 636
           Q   +M+G++++NI +G K +   D  ++  K C     +    D  +T++G  G  LSG
Sbjct: 695 QVAWIMNGTVKENILFGHKYD--EDFYQKTIKACALTIDLAVLMDGDQTLVGEKGISLSG 752

Query: 637 GQKQRIAIARALIKKPKILILDEATSALD----------VESEGAINYTFGKLMKSKSVT 686
           GQK R+++ARA+  +    +LD+  +A+D          V     + +T  K++ +  V+
Sbjct: 753 GQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGPNGLLHTKTKVLATNKVS 812

Query: 687 IVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEAP 746
           ++SIA  +S          L  +G +V+ G + E+  D +S LSKL+ E   ++    + 
Sbjct: 813 VLSIADSVS----------LLENGEIVQQGTYDEIMKDDSSPLSKLITEYGKKSTDSTSN 862

Query: 747 LPPQS 751
           + P +
Sbjct: 863 VTPST 867

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 144/545 (26%), Positives = 243/545 (44%), Gaps = 56/545 (10%)

Query: 226  LVIG---TMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSD 282
            L+IG   ++   G+ IL  +       ++ + ++ K LH    FFD    G +++R   D
Sbjct: 1109 LIIGLAQSLLGAGKTILNFVAGINASRKIFNMILNKVLHSKLRFFDATPTGRIMNRFSKD 1168

Query: 283  AYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRD 342
               + + LT  +   F +++             PQ  S  ++ +         +    R+
Sbjct: 1169 IEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSIMYYFIGYFYMAGSRE 1228

Query: 343  ISTILQEATGQLTRVSEEQLNGVKTVQSFVAE----QKEIRRYNNAIRDIYNIGKMSAVV 398
            +      +   + +   E L GV T+++F  E    Q+ +++ +   +  + +     V 
Sbjct: 1229 LKRYESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYLW----VA 1284

Query: 399  NSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GSLTIGDLTAFMLYTDYTANSIFGLSNFYS 457
            N   +    +IG    LV+   G +++ +   L  G     + Y          L   YS
Sbjct: 1285 NRWLAFRIDMIGS---LVIFGAGLFILSNIDHLDSGMAGISLTYAISFTEGALWLVRLYS 1341

Query: 458  EI---MQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAY-PTRPENQVFK 513
            E+   M  V   K   ++          +     P DG IE  +L   Y P  P  +V K
Sbjct: 1342 EVEMNMNSVERVKEYMEIEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRYAPNLP--RVIK 1399

Query: 514  NLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMG 573
            N++F ++  + V IVG +G GKSTI   L R+  P +G I IDN DI  ++ + LR+ + 
Sbjct: 1400 NVSFSVDAQSKVGIVGRTGAGKSTIITALFRFLEPDTGHIKIDNIDISNVDLQRLRRSIT 1459

Query: 574  IVQQEPVLMSGSIRDN-----------ITYGLKREATPDE-------IREVSKQCFCHNF 615
            I+ Q+P L SG+I+ N           I   LKR     E       +REV+      + 
Sbjct: 1460 IIPQDPTLFSGTIKTNLDPYNEFSNQKIFEALKRVNLVSEEQLQQGTVREVATDTSSADS 1519

Query: 616  --ITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAIN 673
              + KF D  E+ +   G+ LS GQ+Q + +AR+L++ PKI++LDEAT+++D  S+  I 
Sbjct: 1520 ENVNKFLDL-ESEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQ 1578

Query: 674  YTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLL 733
             T  K  +    TI++IAHRL ++   + I+V+       + G+ KE Y  P S    LL
Sbjct: 1579 ETIRKEFQGS--TILTIAHRLRSVIDYDKILVM-------DAGEVKE-YDHPYS----LL 1624

Query: 734  NEKQS 738
              KQS
Sbjct: 1625 LNKQS 1629

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/268 (27%), Positives = 127/268 (47%), Gaps = 28/268 (10%)

Query: 489 PGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNP 548
           P      F N   ++    ++   K+LN + + G    ++GP+G GK+++ + LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 549 SSGQILI---DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIRE 605
            +G++++   D +  + +        +    Q   L++ ++++NI +  +   T    + 
Sbjct: 749 LNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILFNSQFNET--RYKA 806

Query: 606 VSKQC-FCHNF-ITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSA 663
           V + C    +F I K  D  E  IG  G  LSGGQKQR+++ARAL    + ++LD+  SA
Sbjct: 807 VVEACGLKRDFEILKAGDLTE--IGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSA 864

Query: 664 LDVESEGAI--NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
           +D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G     
Sbjct: 865 VDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG----- 917

Query: 722 YADPTSELSK-LLNEKQ-------SRAN 741
             DP   L K L  E +       SRAN
Sbjct: 918 --DPIDMLQKGLFGEDELVKSSILSRAN 943

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 135/511 (26%), Positives = 229/511 (44%), Gaps = 43/511 (8%)

Query: 255  VIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXX 314
            ++KK +H    FFD   +G +++R   D   + + L   V   F +++            
Sbjct: 1145 LLKKVMHSKLRFFDSTPIGRIMNRFSKDIEAIDQELAPVVQGAFYSLVSCVTTILLITFI 1204

Query: 315  XPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAE 374
             PQ  S  ++      +    +    R+           + +   E L GV T+++F  E
Sbjct: 1205 TPQFLSVAILVTGLYYLIGYFYLAASREFKRFDSITKSPIYQHFSETLVGVTTIRAFGDE 1264

Query: 375  ----QKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GS 429
                Q+ + + +   R  + +     V N   S    ++G    LVV   GS+++ +  +
Sbjct: 1265 GRFMQENLSKIDENNRPFFYLW----VANRWLSFRIDMVGA---LVVFGSGSFIIWNIKN 1317

Query: 430  LTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLT--DRIPAIRPTIGEK- 486
            +  G     + Y          L   YS +   + + +RL +    ++ P    T     
Sbjct: 1318 IDAGMAGISLTYAISFTEGALWLVRLYSNVEMNMNSVERLKEYMKIEQEPYEDATCTPPP 1377

Query: 487  FIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYY 546
              P +G IE  +L   Y      +V KN+ F + P   + IVG +G GKSTI   L R+ 
Sbjct: 1378 EWPQEGKIEVCDLSLRY-AEGLPRVIKNVTFTVAPKAKIGIVGRTGAGKSTIITALFRFL 1436

Query: 547  NPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT-YG----------LK 595
            +P +G I IDN DI  +N   LR+ + I+ Q+P L +G+I+ N+  YG          L+
Sbjct: 1437 DPETGYIKIDNIDITSINLNKLRRSINIIPQDPTLFTGTIKSNLDPYGEYSDEDMFTALR 1496

Query: 596  R-EATPDEI-REVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPK 653
            R    P+++   +  +      + KF +     I   G+ LS GQ+Q + +AR+L++ PK
Sbjct: 1497 RVNLVPEDVSSNIETESISSQNVNKFLNLNNE-ISEGGSNLSQGQRQLVCLARSLLRSPK 1555

Query: 654  ILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVV 713
            I++LDEAT+++D  S+  I  T  K   S   TI++IAHRL ++   + I+V+       
Sbjct: 1556 IMLLDEATASIDYNSDAKIQETIRKEFNSS--TILTIAHRLRSVIDYDKILVM------- 1606

Query: 714  ETGKFKELYADPTSELSKLLNEKQSRANKKE 744
            + G+ KE Y  P    S LLN+K    N  E
Sbjct: 1607 DAGEVKE-YDHP---YSLLLNKKSIFYNMCE 1633

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 111/441 (25%), Positives = 200/441 (45%), Gaps = 61/441 (13%)

Query: 322 LVIFAPAVVISASIFGKKIRDISTILQEATGQLT--RVSE--EQLNGVKTVQSFVAEQKE 377
           ++I APA    A++ GK        +Q+AT  +T  R+ +  E L  ++ ++ F  E   
Sbjct: 543 ILIAAPANYYFATLLGK--------IQKATLLVTDKRIQKLNESLQAIRIIKFFSWEDN- 593

Query: 378 IRRYNNAIRDIYN------IGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSL- 430
              +  +I D+        + +  A V S F    +     S +   A+  Y+ +   + 
Sbjct: 594 ---FEKSINDVREQELQLLLKRSMAWVCSSFVWFVTP----SLVTAAAFAFYIYVQKEVL 646

Query: 431 -TIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDL---TDRIPAIRPTIGEK 486
            T    TA  L+T    N +  LS+  S ++Q   +  R+ D    TD     + T+   
Sbjct: 647 TTPIAFTALSLFT-LLRNPLDQLSDMLSFVIQSKVSLDRIRDFLLETDTAKYDQLTVA-- 703

Query: 487 FIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYY 546
             P    +EF+N   ++ +  ++   K+LN   + G    ++GP+G GK+++ + LL   
Sbjct: 704 --PQGDQLEFKNTTVSWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEM 761

Query: 547 NPSSGQILI---DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEI 603
               G+I++   D ++ + ++       +    Q   L++ ++R+NI +     +  +E 
Sbjct: 762 KIMEGEIIVPSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFN----SPYNEA 817

Query: 604 REVSKQCFC---HNF-ITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDE 659
           R  S    C    +F I K  D  E  IG  G  LSGGQKQR+++ARA+    + ++LD+
Sbjct: 818 RYTSVIEACGLKRDFEILKAGDMTE--IGEKGITLSGGQKQRVSLARAMYSNSRHILLDD 875

Query: 660 ATSALDVESEGAI--NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGK 717
             SA+D  +   I  N   G LM  ++  +VS  H ++   ++  ++V+  DG V + G 
Sbjct: 876 CLSAVDSHTALWIYDNCITGPLMDGRTCILVS--HNIALTLKNADLVVILEDGKVKDQG- 932

Query: 718 FKELYADPTSELSK-LLNEKQ 737
                 DP   L K LL E +
Sbjct: 933 ------DPMELLQKGLLGEDE 947

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  147 bits (370), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 137/541 (25%), Positives = 241/541 (44%), Gaps = 30/541 (5%)

Query: 212  GLTLYPFLGAFAGALVIGTMCNYGR-YILLRLLSERVVARLRSHVIKKTLHQDAEFFDQN 270
             + ++ F+G +A   +     N  R  ILL   + R   +L  ++    ++   +FF+  
Sbjct: 1000 NIDVWKFVGIYALIGIASAAFNNLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFETT 1059

Query: 271  KVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVV 330
             +G +++R  +D   V  +L       FK+I              P    F +      +
Sbjct: 1060 PIGRILNRFSADIDTVDSTLQMVFMVFFKSIFSYLITVILITISMPLFLVFCLFLMVIYI 1119

Query: 331  ISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYN 390
                +F  + R++  +   +   +  +  E L G+  ++++  +   + +Y N  R  +N
Sbjct: 1120 YYQKLFIVQSRELKRMTSISYSPIMSLVGESLGGLAVIRAY--KHFSMFKYLNNERVQFN 1177

Query: 391  IGKMSAV--VNSKFSTSTSVIGDMSFLVV-LAYGSYLVLHGSLTIGDLTAFMLYTDYTAN 447
            I  +      N   S     IG +  L+  +   S +     LT G +   M Y      
Sbjct: 1178 INCVFDYRSTNRWLSIRLQTIGALMVLITGMLSLSTISSSKPLTAGMVGLLMSYVLQVTT 1237

Query: 448  SIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKF-----IPGDGCIEFRNLGFA 502
            S+  +      I  G+ + +R+ +  + +P+    I + +      P  G I+F+N    
Sbjct: 1238 SLMWIVRSSVMIETGIVSVERIMEYCE-LPSEAEQIVDDYRPASNWPSKGAIQFKN---- 1292

Query: 503  YPTRPE---NQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQD 559
            Y TR     + V KN++  I PG  V IVG +G GKST+ L L R   P  G I+ID  D
Sbjct: 1293 YSTRYRANLDPVLKNISININPGEKVGIVGRTGAGKSTLTLALFRLLEPIEGTIIIDGMD 1352

Query: 560  IMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT-YGLKREATPDEIREVSK-----QCFCH 613
            I K+    LR ++ I+ Q+     G++R N+  + +  +   D    +S      +    
Sbjct: 1353 ISKIGISDLRSHLAIIPQDAQAFEGTVRSNLDPFNMFSDKELDTAITLSHLKPHLKKLME 1412

Query: 614  NFITKFP--DAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGA 671
               ++ P  D  E  I   G+ LS GQ+Q + +ARAL+ + KIL+LDEAT+++DVE++  
Sbjct: 1413 ESGSELPLNDYLELGIKESGSSLSVGQRQLLCLARALLNRSKILVLDEATASVDVETDKI 1472

Query: 672  INYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSK 731
            I  T  +    +  TI++IAHR+ T+  S+ I+VL   G V E      L AD ++   +
Sbjct: 1473 IQATIRESFSDR--TIITIAHRIDTVLDSDRILVL-EQGEVKEFNSPASLLADKSTLFYQ 1529

Query: 732  L 732
            L
Sbjct: 1530 L 1530

 Score = 77.4 bits (189), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 114/236 (48%), Gaps = 20/236 (8%)

Query: 517 FKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSL--RQYMGI 574
           F+ +     C+VG  G GK+T+   +L       GQ+   +     + PK +   + +  
Sbjct: 654 FRAKKNVLTCVVGRVGSGKTTLLKSIL-------GQLPCTSGSQKAIPPKLIIRGESVAY 706

Query: 575 VQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLL 634
             QE  +M+ SI++NI +G + + T   +    K C         PD   T++G  G  L
Sbjct: 707 CPQEAWIMNDSIKENILFGHRYDETFYNL--TVKACELRPDFKILPDGDNTLVGEKGITL 764

Query: 635 SGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTF----GKLMKSKSVTIVSI 690
           SGGQK R+++ARA+  +  I +LD+  SA+D     +I +        L+K+K++ + + 
Sbjct: 765 SGGQKARLSLARAVYSRSDIYLLDDVLSAVDAGVRKSIIHRVLDSDTGLLKNKAIILTT- 823

Query: 691 AHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSE--LSKLLNEKQSRANKKE 744
            + +S +  S+ I VL  DG ++E   + E   D   +  L KLL E +++    E
Sbjct: 824 -NDISVLEHSDRIYVL-QDGRIIEESTYAEAIEDNDVKPFLYKLLKEFRAKFGSLE 877

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  146 bits (369), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 134/484 (27%), Positives = 223/484 (46%), Gaps = 29/484 (5%)

Query: 266  FFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIF 325
            FF+   +G +++R  +D Y V   L +  S  F   +              Q    +V  
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDSVLGRTFSQFFVNAVKVSFTIGVICVTTWQFIFVIVPL 1102

Query: 326  APAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAI 385
                +     + +  R++  +       +    +E L G+ T++ +  +QK   + N   
Sbjct: 1103 GVFYIYYQQYYLRTSRELRRLDSITRSPVYSHFQETLGGIVTIRGY-GQQKRFSQINQCR 1161

Query: 386  RDIYNIGKMSAV-----VNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFML 440
             D      MSA       N   +    +IG +  L         +  G+LT G +   + 
Sbjct: 1162 VD----NNMSAFYPSVNANRWLAYRLELIGSIIILGAATLSVMRLKQGTLTAGMVGLSLS 1217

Query: 441  YTDYTANSIFGLSNFYSEIMQGVGAAKRL---FDLTDRIPAI----RPTIGEKFIPGDGC 493
            Y      S+  +     E+   + + +R+    DL    P I    RP   ++  P +G 
Sbjct: 1218 YALQITQSLNWIVRMTVEVETNIVSVERIKEYADLKSEAPEIIEDHRP---QETWPEEGD 1274

Query: 494  IEFRNLGFAYPTRPE-NQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQ 552
            I+F +    Y  RPE + V K++NF I+P   + IVG +G GKS++ L L R    S G 
Sbjct: 1275 IKFEHYSTRY--RPELDLVLKDINFHIKPKEKIGIVGRTGAGKSSLTLALFRIIEASEGN 1332

Query: 553  ILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFC 612
            I+IDN DI  +    LR  + I+ Q+  +  G+IR+NI      + T ++I  V +    
Sbjct: 1333 IIIDNVDISDIGLYDLRHKLSIIPQDSQVFEGTIRENI--DPTNQYTDEQIWRVLELSHL 1390

Query: 613  HNFI-TKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGA 671
             + I T   D  +T +   G+ LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++  
Sbjct: 1391 RDHIATMGGDGLDTKLNEGGSNLSVGQRQLMCLARALLVPSKILVLDEATAAVDVETDKV 1450

Query: 672  INYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSK 731
            +  T     K +  TI++IAHR++TI  ++ I+VL N GS+ E  + K+L  + +S    
Sbjct: 1451 LQETIRTSFKDR--TILTIAHRINTIMDNDRIMVLDN-GSIKEFDEPKKLLENKSSLFYS 1507

Query: 732  LLNE 735
            L  E
Sbjct: 1508 LCEE 1511

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 105/419 (25%), Positives = 191/419 (45%), Gaps = 66/419 (15%)

Query: 355 TRVSEEQLNGVKTVQSFVAE-----QKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVI 409
           TRV  E LN +K+++ +  E     + E  R N  ++++  +G   A+++ +F+    ++
Sbjct: 483 TRVISEILNNIKSLKLYAWETPYKAKLENVRNNKELKNLTKLGCYMALMSFQFNVVPFLV 542

Query: 410 GDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL 469
              +F  V  Y     L   L    LT F L        +  + N  + +++   +  RL
Sbjct: 543 SCSTF-AVFVYTEDRPLTTDLVFPALTLFNLL----HFPLMVIPNVLTALIECSVSVGRL 597

Query: 470 F----------DLTDRIPAIRPTIGEKFIP-GDGCIEFRNLGFAYPTRPENQV-FKNLNF 517
           F          D   R+P +   IG+  I  GD      +  F +  +PE +V  KN+NF
Sbjct: 598 FSFLTNEELQKDSVQRLPKV-TEIGDVAINVGD------DATFLWQRKPEYKVALKNVNF 650

Query: 518 KIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP-KSLRQYMGIVQ 576
           + + G   CIVG  G GKS +   +L               D+ ++    ++   +  V 
Sbjct: 651 QAKKGELTCIVGRVGSGKSALIQSIL--------------GDLFRVKGFATIHGNVAYVS 696

Query: 577 QEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSG 636
           Q   +M+G+++DNI +G K +A   E  +  K C     ++   D  +T++G  G  LSG
Sbjct: 697 QVAWIMNGTVKDNILFGHKYDAEFYE--KTIKACALTIDLSVLVDGDQTLVGEKGISLSG 754

Query: 637 GQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFG---------KLMKSKSVT 686
           GQK R+++ARA+  +    +LD+  +A+D   +   I +  G         K++ +  V+
Sbjct: 755 GQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKVS 814

Query: 687 IVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEA 745
           ++S+A  +S          L  +G +V+ G + E+  D  S+L+KL+ E   ++N   A
Sbjct: 815 VLSVADSVS----------LLENGEIVQQGSYDEIMKDGASQLNKLIMEYGKKSNGNPA 863

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  145 bits (365), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 137/499 (27%), Positives = 219/499 (43%), Gaps = 42/499 (8%)

Query: 255  VIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXX 314
            V+KK L+    FFD   +G +++R   D   V + LT  V   F +++            
Sbjct: 1138 VLKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1197

Query: 315  XPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAE 374
             P      +       +    +    R++      +   + +   E L G+ T+++F  E
Sbjct: 1198 TPGFLVVAIFIGFLYYLVGYFYMAGSRELKRFESVSRSPIHQHFSETLVGITTIRAFGDE 1257

Query: 375  QKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GSLTIG 433
            ++ +      I +         V N   +    +IG     VV A G +++L+   L  G
Sbjct: 1258 RRFMLENLQKIDENNKPFFYLWVANRWLAFRIDMIGAC---VVFAAGVFILLNIKKLDSG 1314

Query: 434  DLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL--FDLTDRIP----AIRPTIGEKF 487
                 + Y          L   YS +   + + +RL  + + ++ P    A  P I    
Sbjct: 1315 LAGISLTYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMVIEQEPSNDGAFNPPIE--- 1371

Query: 488  IPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYN 547
             P  G IE  +L   Y T    +V KN++F ++P   V IVG +G GKSTI   L R+ +
Sbjct: 1372 WPDQGKIEVNDLSLRYATNLP-RVIKNVSFTVDPKCKVGIVGRTGAGKSTIITALFRFLD 1430

Query: 548  PSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDN-----------ITYGLKR 596
            P +G I IDN DI  +  K LRQ + I+ Q+P L SG+++ N           I   LKR
Sbjct: 1431 PETGHIKIDNVDITSIGLKRLRQSITIIPQDPTLFSGTVKSNLDPYDEYTDEQIFKALKR 1490

Query: 597  E--ATPDEIREV----SKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIK 650
                T DE+  V             + KF D    I    G  LS GQ+Q + +AR+L++
Sbjct: 1491 VNLVTADELDHVPDSADNASVNSENVNKFLDLRNEIT-EGGANLSQGQRQLVCLARSLLR 1549

Query: 651  KPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDG 710
             PKI++LDEAT+++D  S+  I  T  +       TI++IAHRL +I   + I+V+    
Sbjct: 1550 SPKIILLDEATASIDYSSDAKIQQTIREEFGDS--TILTIAHRLRSIIDYDKILVM---- 1603

Query: 711  SVVETGKFKELYADPTSEL 729
               + G+ +E Y  P S L
Sbjct: 1604 ---DAGEVRE-YDHPYSLL 1618

 Score = 87.4 bits (215), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 117/230 (50%), Gaps = 11/230 (4%)

Query: 494 IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI 553
           I F N  FA+  +  +   KNLN + + G    ++G +G GK+++ + LL   +   G++
Sbjct: 692 IAFENATFAWDKKNPSFKLKNLNVEFKLGKLNVVIGSTGSGKTSLLMGLLGEMDLIEGKV 751

Query: 554 LI---DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQC 610
            +   D ++ + +    +   +    Q   L++ ++R+NI +      T    + V + C
Sbjct: 752 YVPSLDPREELVIESDGMTNSIAYCSQAAWLLNDTVRNNILFNSPYNET--RYKAVVEAC 809

Query: 611 FCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEG 670
                        +T IG  G  LSGGQKQR+++ARAL    + ++LD+  SA+D  +  
Sbjct: 810 GLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHVLLDDCLSAVDSHTAL 869

Query: 671 AI--NYTFGKLMKSKSVTIVSIAHRLS-TIRRSEYIIVLGNDGSVVETGK 717
            I  N   G LM+ ++  +VS  H ++ T++ +E+++VL N G + + G+
Sbjct: 870 WIYENCITGPLMQGRTCILVS--HNVALTLKNAEWVVVLDN-GRIKDQGE 916

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  145 bits (365), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 135/500 (27%), Positives = 222/500 (44%), Gaps = 40/500 (8%)

Query: 255  VIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXX 314
            ++ K LH    FFD   +G +++R   D   + + L       F + +            
Sbjct: 1134 LLDKVLHAKLRFFDSTPIGRIMNRFSKDMEGIDQDLAPYFQGAFYSFIECITTIILITFI 1193

Query: 315  XPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAE 374
             PQ  S  +I      +    +    R++  +       + +   E L GV T+++F  E
Sbjct: 1194 TPQFLSVAIIVGMLYYMIGYFYLTGSRELKRLDSITKSPIYQHFSETLVGVTTIRAFGDE 1253

Query: 375  QKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GSLTIG 433
             + +R     I +         V N   S    VIG    LVV   G +++ +  ++  G
Sbjct: 1254 SRFLRENLLKIDENNRPFFYLWVANRWLSFRIDVIGA---LVVFGSGIFILTNINTIDSG 1310

Query: 434  DLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLT--DRIPAIRPTIGEKFIPGD 491
                 + Y          L  FYSE+   + + +R+ +    ++ P     + +  +P D
Sbjct: 1311 MAGISLTYAISFTEGALWLVRFYSEVEMNMNSVERVHEYMTIEQEPYDEVQVSDSKVPAD 1370

Query: 492  ----GCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYN 547
                G IE  +L   Y      +V KN+ F ++P   V +VG +G GKSTI   L R+  
Sbjct: 1371 WPEEGRIEVSDLSLRYAAHLP-KVIKNVTFNVDPRAKVGVVGRTGAGKSTIITALFRFLE 1429

Query: 548  PSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT-YG-LKREATPDEIRE 605
              +G I ID  DI  +N   LR+ + I+ Q+P L SG+I+ N+  Y   K E   + +R 
Sbjct: 1430 AETGYIKIDGLDITSVNLTRLRRSITIIPQDPTLFSGTIKSNLDPYDEYKDEEVFEALRR 1489

Query: 606  VS----------------KQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALI 649
            V+                +       I +F D  E+ I   GT  S GQ+Q I +AR+L+
Sbjct: 1490 VNLVTEEELSSRTENNNDEASVSSKNINRFLDL-ESEIAEGGTNFSQGQRQLICLARSLL 1548

Query: 650  KKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGND 709
            + PKIL+LDEAT+++D +S+  +  T  +   S+S TI++IAHRL ++   + I+V+G  
Sbjct: 1549 RSPKILLLDEATASIDYDSDAKVQETI-RTEFSES-TILTIAHRLRSVIDYDKILVMG-- 1604

Query: 710  GSVVETGKFKELYADPTSEL 729
                  G+ KE Y  P S L
Sbjct: 1605 -----AGEVKE-YDHPYSLL 1618

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 114/230 (49%), Gaps = 13/230 (5%)

Query: 494 IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI 553
           I F+N   A+    ++   +NLN   + G    I+GP+G GK+++ + LL   N   GQI
Sbjct: 701 IAFKNTTVAWDNSRDSFKLRNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMNLLEGQI 760

Query: 554 LI---DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQC 610
           ++   + +  + +        +    Q   L++ ++R+NI +      T      V + C
Sbjct: 761 VVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVRNNILFNSPYNET--RYHNVVEAC 818

Query: 611 -FCHNF-ITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
               +F I K  D  E  IG  G  LSGGQKQRI++ARAL    + ++LD+  SA+D  +
Sbjct: 819 GLRRDFEILKAGDMTE--IGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSAVDAHT 876

Query: 669 EGAI--NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETG 716
              +  N   G LM+ ++  +VS  H ++   R+  ++V+  DG V + G
Sbjct: 877 ALWVYDNCITGPLMEGRTCILVS--HNIALTLRNADLVVMLEDGQVKDQG 924

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 131/485 (27%), Positives = 217/485 (44%), Gaps = 38/485 (7%)

Query: 255  VIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXX 314
            ++KK L+    FFD    G +++R   D   +   L       F +++            
Sbjct: 1163 LLKKVLYAKLRFFDSTPTGRIMNRFSRDVEAIDEELIPFFEGAFASLVQCITTILLIGYI 1222

Query: 315  XPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAE 374
             P    F ++   +  I    +    R++          + +   E L GV T+++F  E
Sbjct: 1223 TPVFLFFAIVICVSYYIVGYFYLVGSRELQRFESITKSPIHQHFSETLVGVTTIRAFGDE 1282

Query: 375  QK----EIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GS 429
            ++     + + +   R  + +     V N   +     IG     V+LA G +++L+  S
Sbjct: 1283 RRFLADNLSKVDTHNRPFFYLW----VTNRWLAFRIDFIGA---FVILASGIFILLNVNS 1335

Query: 430  LTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLT--DRIPAIRPTIGEKF 487
            L  G     ++Y          L   YS +   + + +RL +    ++ P+         
Sbjct: 1336 LDAGLAGISLIYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMKIEQEPSTGLYEPPPE 1395

Query: 488  IPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYN 547
             P  G IE  NL   Y +    +V KN+ F +EP + V IVG +G GKSTI   L R+ +
Sbjct: 1396 WPDRGKIEVNNLSLRYASNLP-KVIKNVTFTVEPQSKVGIVGRTGAGKSTIITALFRFLD 1454

Query: 548  PSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIR-----------DNITYGLKR 596
            P +G I +DN DI  +  K LRQ + I+ Q+PVL +G+I+           D I   LKR
Sbjct: 1455 PDTGTIKLDNVDITSIRLKRLRQSITIIPQDPVLFAGTIKSNLDPYSEYADDRIFEALKR 1514

Query: 597  -------EATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALI 649
                   E TP +I   S      N + KF D    I    G+ LS GQ+Q + +AR+L+
Sbjct: 1515 VNLIVQEELTPTDIPSSSSSLSFEN-VNKFLDLTSEIT-EGGSNLSQGQRQLVCLARSLL 1572

Query: 650  KKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGND 709
            + PK ++LDEAT+++D  S+  I  T  +       TI++IAHRL +I   + ++V+ + 
Sbjct: 1573 RNPKAILLDEATASIDYASDAKIQQTIREEFSGS--TILTIAHRLRSIIDYDKVLVI-DS 1629

Query: 710  GSVVE 714
            G + E
Sbjct: 1630 GELAE 1634

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 113/216 (52%), Gaps = 9/216 (4%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILI---DNQDIMKLNPKSL 568
            KNLN   + G    IVGP+G GK+++ + LL   N S G+I +   + ++ + ++   +
Sbjct: 730 LKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLLGEINLSEGKIYVPALNPREDLVVDADGM 789

Query: 569 RQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIG 628
              +G   Q   L++ ++R+NI +    EA  +    V   C     +       +T +G
Sbjct: 790 TDSIGYCSQSAWLLNDTLRNNILFSAPYEA--NRYNAVIHACGLTRDLEILNAGDQTEVG 847

Query: 629 PHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTFGKLMKSKSVT 686
             G  LSGGQKQR+++ARA+  + + ++LD+  SA+D  +   I  +   G LM+ ++  
Sbjct: 848 EKGITLSGGQKQRVSLARAMYSRARHILLDDCLSAVDSHTAQWIYKHCITGPLMEGRTCV 907

Query: 687 IVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELY 722
           +VS    L T++ ++++++L N   V   G+  EL+
Sbjct: 908 LVSHNTAL-TLKNADWVVILEN-AKVTAQGEPLELF 941

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  144 bits (363), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 137/526 (26%), Positives = 242/526 (46%), Gaps = 38/526 (7%)

Query: 215  LYPFLGAFAGALVIGTMCNYGRYILLRL-LSERVVARLRSHVIKKTLHQDAEFFDQNKVG 273
            ++ F+G ++   V     N  R I++ L  S R   +L   + K  +     FF+   VG
Sbjct: 1017 VWMFVGVYSLIGVGSAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFFETTPVG 1076

Query: 274  DLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISA 333
             +I+R  SD   V  SL    S  FK+IL             P    F +      +   
Sbjct: 1077 RIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLLGIYIYYQ 1136

Query: 334  SIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTV------QSFVAEQKEIRRYNNAIRD 387
            + +    R++  ++  +   +  +  E LNG   +      + F+    E  +YN  I  
Sbjct: 1137 TFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYN--IDF 1194

Query: 388  IYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTAN 447
            ++N    +  ++ +  T  + I   + ++ LA    +     L+ G +   M Y+     
Sbjct: 1195 VFNFRSTNRWLSVRLQTIGATIVLATAMLTLAT---MNTKKQLSSGMVGLLMSYSLEVTG 1251

Query: 448  SIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIG-----EKFIPGDGCIEFRNLGFA 502
            S+  +      I   + + +R+ +  + +P+   +I      +K  P  G IEF++    
Sbjct: 1252 SLTWIVRTTVMIETNIVSVERIVEYCE-LPSEAQSINPEKRPDKNWPSRGSIEFKDYSTK 1310

Query: 503  YPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMK 562
            Y    +  V K++N KIEP   V IVG +G GKST++L L R   P+ G+I+ID  +I  
Sbjct: 1311 YRENLD-PVLKDINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGINISD 1369

Query: 563  LNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKF--- 619
            L    LR ++ I+ Q+     G+++ N+     R  + DE+++  +       + K    
Sbjct: 1370 LGLFDLRSHLAIIPQDAQAFEGTVKTNLD-PFNR-YSEDELKKAVELAHLKPHLEKMLEN 1427

Query: 620  -----------PDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
                        D  +  I  +G+ LS GQ+Q + +ARAL+ + KIL+LDEAT+++D+E+
Sbjct: 1428 EPSDSEESCDIKDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASIDMET 1487

Query: 669  EGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
            +  I  T  +  K +  TI++IAHR+ T+  S+ IIVL ++GSV E
Sbjct: 1488 DKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGSVKE 1530

 Score =  108 bits (271), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 123/462 (26%), Positives = 205/462 (44%), Gaps = 84/462 (18%)

Query: 334 SIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRD--IYNI 391
           +   +K++ +S           +   E LN +K+++ +  E+  ++R N+   D  + N 
Sbjct: 451 AFLSRKVKKLSKTQMRYKDMRIKTITELLNAIKSIKLYAWEEPMMKRLNHVRNDMELKNF 510

Query: 392 GKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTD-------- 443
            K               IG +S L+  A+    ++    T G    F L+ D        
Sbjct: 511 RK---------------IGIVSNLIYFAWNCVPLMVACSTFG---LFSLFNDSPLSPAIV 552

Query: 444 YTANSIFGLSN--FYS------EIMQGVGAAKRL--FDLTDRI-----PAIRPTIGEKFI 488
           + + S+F + N   YS       I++   + KRL  F L+D I       I P++ E+ +
Sbjct: 553 FPSLSLFNILNSAIYSVPSMINTIIETSVSMKRLKSFLLSDEIDDSFIERIDPSVDERTL 612

Query: 489 PGDGCIEFRNLGFAYPTRP-------ENQ--------------VFKNLN-FKIEPGTSVC 526
           P    IE  N+ F + ++        EN                 KN++ F+ + G  VC
Sbjct: 613 P---VIEMNNITFLWKSKEALASSQLENNSRADEESAMGSSQIALKNIDHFEAKRGNLVC 669

Query: 527 IVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSL--RQYMGIVQQEPVLMSG 584
           IVG  G GKST    +L       GQ+   +     + PK +     +    QE  +M+ 
Sbjct: 670 IVGRVGAGKSTFLKAIL-------GQLPCMSGSKESIPPKLIIRSSSLAYCSQESWIMNA 722

Query: 585 SIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAI 644
           S+++NI +G K +    ++    K C     +   PD  ET++G  G  LSGGQK R+++
Sbjct: 723 SVKENILFGHKFDKAYYDL--TIKACQLLPDLRILPDGDETLVGEKGISLSGGQKARLSL 780

Query: 645 ARALIKKPKILILDEATSALDVE-SEGAINYTF-GKLMKSKSVTIVSIAHRLSTIRRSEY 702
           ARA+  +  I +LD+  SA+D E S+  I Y   GK    K+ TI+   + +S ++ S+ 
Sbjct: 781 ARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKKALLKNKTIILTTNTVSILKHSQM 840

Query: 703 IIVLGNDGSVVETGKFKELY--ADPTSELSKLLNEKQSRANK 742
           I  L N G +VE G +  +    + TS+L KLL E  S  +K
Sbjct: 841 IYALEN-GEIVEQGNYDSVMNRENSTSKLKKLLEEFDSPIDK 881

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  144 bits (362), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 137/511 (26%), Positives = 228/511 (44%), Gaps = 39/511 (7%)

Query: 250  RLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXX 309
            R+   ++ K LH    F D   +G +++R   D   V + LT  +   F  ++       
Sbjct: 1141 RIFKKLLSKVLHSRLRFIDSTPIGRIMNRFSKDIEAVDQELTPFLEAAFFCLVQCISTII 1200

Query: 310  XXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQ 369
                  PQ     V+      +    +    R++  I       + +   E L GV T++
Sbjct: 1201 LITFITPQFLFVAVLVCVLYYLVGYFYINTSRELKRIESITKSPIYQHFSETLTGVATIR 1260

Query: 370  SFVAEQKEIRRYNNAIRDIYNIGK---MSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVL 426
            +F     EIR   + +  I    K      V N   +    +IG    L++   G +++L
Sbjct: 1261 AF---GDEIRFIMHNLEKIDENNKPFFYLWVANRWLAFRIDMIGA---LIIFGSGVFILL 1314

Query: 427  HGSLTIGDLTAFML-YTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTD--RIPAIRPTI 483
            + +     +    L Y          L  FYS +   + + +RL +  D  + P    TI
Sbjct: 1315 NLNRIDSGMAGISLTYAISFTEGALWLVRFYSTVEMNMNSVERLKEYMDVPQEPYNEGTI 1374

Query: 484  GEKF-IPGDGCIEFRNLGFAYPTRPEN--QVFKNLNFKIEPGTSVCIVGPSGRGKSTIAL 540
                  P +G IE ++L   Y    EN  +V K ++F IEP   V IVG +G GKSTI  
Sbjct: 1375 TTSTNWPTEGKIEVKDLSLRYA---ENLPRVIKEVSFDIEPHNMVGIVGRTGAGKSTIIT 1431

Query: 541  LLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT-YG------ 593
             L R+  P +G I ID  DI  ++ ++LR+ + I+ Q+P L +G+IR N+  +G      
Sbjct: 1432 ALFRFLEPETGSIKIDGIDITSIDLQTLRRSITIIPQDPTLFTGTIRSNLDPFGKYPDEE 1491

Query: 594  ----LKREATPDEIREVSKQ-----CFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAI 644
                L R    D+  E++ Q         + + KF +  E  I   G  LS GQKQ + +
Sbjct: 1492 IFRVLHRVNLIDD-DEMTAQSSDNNSLSSDNVNKFLNL-ENEITEGGNNLSQGQKQLMCL 1549

Query: 645  ARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYII 704
            ARAL++ PK+++LDEAT+++D  S+  I  T   +      T+++IAHRL ++   + I+
Sbjct: 1550 ARALLRNPKVILLDEATASIDYASDAKIQQTIRNVFDKS--TVLTIAHRLRSVIDYDKIL 1607

Query: 705  VLGNDGSVVETGKFKELYADPTSELSKLLNE 735
            V+ + G V+E  +   L  D  S    +  +
Sbjct: 1608 VM-DAGEVIEYDQPYTLLLDKNSHFYSMCEQ 1637

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 79/284 (27%), Positives = 134/284 (47%), Gaps = 19/284 (6%)

Query: 452 LSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQV 511
           LSN  S ++Q   +  R+ +  D     +     K  P    + F N   A+    ++  
Sbjct: 672 LSNMLSYVIQSKVSLDRVQNFLDEEDTQKYN-QLKVAPDGNKLAFENATIAWSNNNQDFK 730

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILI---DNQDIMKLNPKSL 568
            K+L+   + G    ++GP+G GK+++ L LL      SG+I++   D +  M ++   +
Sbjct: 731 LKDLDINFKIGKLNVVIGPTGSGKTSLLLALLGEMQLLSGRIVVPSLDARHEMLIDSDGM 790

Query: 569 RQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIG 628
              +    Q   L++ ++R+NI +        D  +EV   C        F    +T IG
Sbjct: 791 TNSIAYCSQSAWLLNDTVRNNILF--YSPYNEDRYKEVIIACGLKRDFELFDAGDQTEIG 848

Query: 629 PHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTFGKLMKSKSVT 686
             G  LSGGQKQRI++ARAL    + L+LD+  SA+D  +   I  N   G LM+ ++  
Sbjct: 849 EKGITLSGGQKQRISLARALYSNCRHLLLDDCLSAVDSHTAAWIYDNCITGPLMEGRTCV 908

Query: 687 IVSIAHRLS-TIRRSEYIIVLGNDGSVVETGKFKELYADPTSEL 729
           +VS  H ++ T++ +E +++L N G +   G       DP S L
Sbjct: 909 LVS--HNIALTLKNAELVVMLEN-GRITNRG-------DPISLL 942

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  143 bits (361), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 135/504 (26%), Positives = 222/504 (44%), Gaps = 51/504 (10%)

Query: 255  VIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXX 314
            ++KK L+    FFD   +G +++R   D   V + LT  V   F +++            
Sbjct: 1133 ILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1192

Query: 315  XPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAE 374
             P      +       +    +    R++      +   + +   E L G+ T+++F  E
Sbjct: 1193 TPDFFFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSETLVGITTIRAFGDE 1252

Query: 375  QKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GSLTIG 433
            ++ ++     I +         V N   +    +IG     V+ A G +++L+  SL  G
Sbjct: 1253 RRFMQENLTKIDENNKPFFYLWVANRWLAFRIDMIGAC---VIFAAGIFVLLNIKSLDSG 1309

Query: 434  DLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDL--TDRIPAIRPTIGEK-FIPG 490
                 + Y          L   YS +   + + +RL +    ++ P  + T       P 
Sbjct: 1310 LAGISLTYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQSTHNPPPEWPS 1369

Query: 491  DGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
             G IE  +L   Y P+ P  +V KN+ F ++P   V IVG +G GKSTI   L R+ +P 
Sbjct: 1370 QGKIEVNDLSLRYAPSLP--KVIKNVTFTVDPNCKVGIVGRTGAGKSTIITALFRFLDPE 1427

Query: 550  SGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDN-----------ITYGLKR-- 596
            SG I IDN DI  +  K LRQ + I+ Q+P L +G+++ N           I   LKR  
Sbjct: 1428 SGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDKQIFEALKRVN 1487

Query: 597  -----------EATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIA 645
                         +PD    VS+       + KF    E  I   G+ LS GQ+Q + +A
Sbjct: 1488 LVTQEELDHAANPSPDNASAVSEN------VNKFL-FLENEISEGGSNLSQGQRQLVCLA 1540

Query: 646  RALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIV 705
            R+L++ PK+++LDEAT+++D +S+  I  T          TI++IAHRL +I   + I+V
Sbjct: 1541 RSLLRSPKVMLLDEATASIDYQSDARIQQTIRSEFSDS--TILTIAHRLRSIIDYDKILV 1598

Query: 706  LGNDGSVVETGKFKELYADPTSEL 729
            +       + G+ KE Y  P S L
Sbjct: 1599 M-------DAGEVKE-YDHPYSLL 1614

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/235 (26%), Positives = 117/235 (49%), Gaps = 11/235 (4%)

Query: 494 IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI 553
           I F N  F++  +  +   KN+N   + G    ++GP+G GK+++ + LL   +   G++
Sbjct: 689 IGFENATFSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKV 748

Query: 554 ---LIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQC 610
               +D ++ M +    +   +    Q   L++ ++++NI +             V + C
Sbjct: 749 YAPCLDPREDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILFS--SPFNEGRYNAVIEAC 806

Query: 611 FCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEG 670
                        +T IG  G  LSGGQKQR+++ARAL    + L+LD+  SA+D  +  
Sbjct: 807 GLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTAL 866

Query: 671 AI--NYTFGKLMKSKSVTIVSIAHRLS-TIRRSEYIIVLGNDGSVVETGKFKELY 722
            I  N   G LM+ ++  +VS  H ++ T++ +E+++ + N G V + G+  ELY
Sbjct: 867 WIYENCISGPLMEGRTCILVS--HNVALTLKNAEWVVFMEN-GRVKDQGEPLELY 918

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  143 bits (361), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 144/552 (26%), Positives = 253/552 (45%), Gaps = 60/552 (10%)

Query: 210  AFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQ 269
            +F + LY F   FAG L   +     ++ LL  +  R    L    + + LH    + D 
Sbjct: 949  SFYMGLYSFF-VFAGYLFTSS-----QFTLLCAIGIRASKWLNLKAVHRILHTPMSYLDT 1002

Query: 270  NKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAV 329
              +G +++R   D    + SL  ++++  + +L                  +  I  P +
Sbjct: 1003 TPLGRILNRFTKD----TDSLDNELTESIRLMLFQTANIVGVCVMCIIYLPWFAIAIPFL 1058

Query: 330  VISASIF-------GKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYN 382
             I  ++        G++++ +  I +     +     E L G+ T++S+ +E++ + + +
Sbjct: 1059 FIGFTLITDHYQSTGREVKRLEAIQRSF---VYNNFNEILGGMDTIKSYGSEERFLAKSD 1115

Query: 383  NAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GSLTIGDLTAFMLY 441
              I  +   G +S  +    +    ++     L++         H  ++++G L  ++L 
Sbjct: 1116 YLINKMNEAGYLSVALQRWVAIFLDLVAVCFALIITLLCVTRAFHISAVSVGVLLTYVLQ 1175

Query: 442  TDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAI----RPTIG--EKFIPGDGCIE 495
                 N   G+    ++    + +A+RL      +P      RP +   E + P +G IE
Sbjct: 1176 LPGLLN---GVLRALTQTENDMNSAERLVSYATELPLEAAYRRPEVSPPENW-PSEGKIE 1231

Query: 496  FRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQIL 554
            F+++ F+Y P  P   V K+L+  I+ G  + I G +G GKSTI   L R    S G+IL
Sbjct: 1232 FKHVDFSYRPGLP--IVLKDLDLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISQGEIL 1289

Query: 555  IDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDN----------------ITYGLKREA 598
            IDN DI KL    LR+ + I+ Q+PVL  G+IR N                +  G    A
Sbjct: 1290 IDNVDISKLGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHDDDLLWDSLVRGGAIERA 1349

Query: 599  TPDEIR--EVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI 656
              ++I+  +V K    H  + KF    + ++   G   S G++Q +A+ RAL+++ K+LI
Sbjct: 1350 ALNKIKNQKVDKDG-THADMFKF--HLDQLVEEEGANFSLGERQLLALTRALVRQAKVLI 1406

Query: 657  LDEATSALDVESEGAINYTFGKLMKS-KSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVET 715
            LDEATS++D E++G I     +++K     TI+ IAHRL+TI   + I+VL   G V E 
Sbjct: 1407 LDEATSSVDYETDGKIQ---ARIVKEFGDCTILCIAHRLNTILNYDRILVL-EKGEVAEF 1462

Query: 716  GKFKELYADPTS 727
             K K L+    S
Sbjct: 1463 EKPKVLFDQEDS 1474

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 102/201 (50%), Gaps = 19/201 (9%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           F ++   I+ G  + +VGP G GK++    L  + N + G+I + N D++      L  Y
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQV-NGDLL------LCGY 679

Query: 572 MGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHG 631
                  P + + ++RDNI +G   +    E  EV + C     +   P    T IG  G
Sbjct: 680 -------PWIQNATVRDNILFGSPYDKKKYE--EVLRCCSLEADLDILPAGDSTEIGERG 730

Query: 632 TLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGKLMKSKSVTIVSI 690
             LSGGQK RI +AR + KK  I + D+  SA+D    +  ++  F  L+K+++  + + 
Sbjct: 731 ITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNETRILAT- 789

Query: 691 AHRLSTIRRSEYIIVLGNDGS 711
            H+LS + R+  +IVLG DGS
Sbjct: 790 -HQLSLLERASRVIVLGTDGS 809

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  142 bits (359), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 140/545 (25%), Positives = 240/545 (44%), Gaps = 56/545 (10%)

Query: 226  LVIG---TMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSD 282
            L+IG   ++   G+ IL  +       ++ + ++ K LH    FFD    G +++R   D
Sbjct: 1109 LIIGLAQSLLGAGKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKD 1168

Query: 283  AYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRD 342
               + + LT  +   F +++             PQ  S  ++ +         +    R+
Sbjct: 1169 IEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYFYMAGSRE 1228

Query: 343  ISTILQEATGQLTRVSEEQLNGVKTVQSFVAE----QKEIRRYNNAIRDIYNIGKMSAVV 398
            +      +   + +   E L GV T+++F  E    Q+ +++ +   +  + +     V 
Sbjct: 1229 LKRFESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLQKIDENNKPFFYLW----VA 1284

Query: 399  NSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GSLTIGDLTAFMLYTDYTANSIFGLSNFYS 457
            N   +    +IG    LV+   G +++ +   L  G     + Y          L   Y+
Sbjct: 1285 NRWLAFRIDMIGS---LVIFGAGLFILFNINHLDSGMAGISLTYAISFTEGALWLVRLYA 1341

Query: 458  EI---MQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAY-PTRPENQVFK 513
            E+   M  V   K   ++          +     P DG IE  +L   Y P  P  +V K
Sbjct: 1342 EVEMNMNSVERVKEYMEIEQEPYNQHKEVPPPQWPQDGKIEVNDLSLRYAPNLP--RVIK 1399

Query: 514  NLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMG 573
            N++F ++  + + IVG +G GKSTI   L R+  P +G I IDN DI  ++ + LR+ + 
Sbjct: 1400 NVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSIT 1459

Query: 574  IVQQEPVLMSGSIRDN-----------ITYGLKR-------EATPDEIREVSKQCFCHNF 615
            I+ Q+P L SG+I+ N           I   LKR       ++     RE        N 
Sbjct: 1460 IIPQDPTLFSGTIKTNLDPYDEFSDRKIFEALKRVNLISEEQSQQGTTREADNDNSSTNS 1519

Query: 616  --ITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAIN 673
              + KF D   + +   G+ LS GQ+Q + +AR+L++ PKI++LDEAT+++D  S+  I 
Sbjct: 1520 ENVNKFLDL-SSEVSEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYGSDAKIQ 1578

Query: 674  YTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLL 733
             T  K  +    TI++IAHRL ++   + I+V+       + G+ KE Y  P S    LL
Sbjct: 1579 ETIRKEFQGS--TILTIAHRLRSVIDYDKILVM-------DAGEVKE-YDHPYS----LL 1624

Query: 734  NEKQS 738
              KQS
Sbjct: 1625 LNKQS 1629

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 126/268 (47%), Gaps = 28/268 (10%)

Query: 489 PGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNP 548
           P      F N   ++    ++   K+LN + + G    ++GP+G GK+++ + LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 549 SSGQILI---DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIRE 605
            SG++++   + +  + ++       +    Q   L++ ++++NI +           + 
Sbjct: 749 LSGKVVVPALEPRQELVVDANGTTNAIAYCSQGAWLLNDTVKNNILFN--SPFNEARYKA 806

Query: 606 VSKQC-FCHNF-ITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSA 663
           V + C    +F I K  D  E  IG  G  LSGGQKQR+++ARAL    + ++LD+  SA
Sbjct: 807 VVEACGLKRDFEILKAGDLTE--IGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSA 864

Query: 664 LDVESEGAI--NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
           +D  +   I  N   G LM+ ++  +VS  H ++   R+  ++VL  DG V + G     
Sbjct: 865 VDSHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG----- 917

Query: 722 YADPTSELSK-LLNEKQ-------SRAN 741
             DP   L + L  E +       SRAN
Sbjct: 918 --DPIDMLQRGLFGEDELVKSSILSRAN 943

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  142 bits (358), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 133/518 (25%), Positives = 229/518 (44%), Gaps = 53/518 (10%)

Query: 250  RLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXX 309
            ++ + ++ K LH    FFD    G +++R   D   + + LT  +   F +++       
Sbjct: 1136 KIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVI 1195

Query: 310  XXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQ 369
                  PQ  S  ++ +         +    R++      +   + +   E L GV T++
Sbjct: 1196 LITFITPQFLSIAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIR 1255

Query: 370  SFVAE----QKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLV 425
            +F  E    Q+ +++ +   +  + +     V N   +    +IG    LV+   G +++
Sbjct: 1256 AFGDEGRFMQENLQKIDENNKPFFYLW----VANRWLAFRIDMIGS---LVIFGAGLFIL 1308

Query: 426  LH-GSLTIGDLTAFMLYTDYTANSIFGLSNFYSEI---MQGVGAAKRLFDLTDRIPAIRP 481
             +   +  G     + Y          L   YSE+   M  V   K    +         
Sbjct: 1309 FNIDHIDSGMAGISLTYAISFTEGALWLVRLYSEVEMNMNSVERVKEYMKIEQEPYNQHK 1368

Query: 482  TIGEKFIPGDGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIAL 540
             +     P DG IE  +L   Y P  P  +V  N++F ++  + + IVG +G GKSTI  
Sbjct: 1369 EVPPSQWPQDGKIEVNDLSLRYAPNLP--RVINNVSFSVDAQSKIGIVGRTGAGKSTIIT 1426

Query: 541  LLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDN----------- 589
             L R+  P +G I IDN DI  ++ + LR+ + I+ Q+P L SG+I+ N           
Sbjct: 1427 ALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDKK 1486

Query: 590  ITYGLKR-------EATPDEIREVSKQCFCHNF--ITKFPDAYETIIGPHGTLLSGGQKQ 640
            I   LKR       ++    +RE       ++   I KF D   + +   G+ LS GQ+Q
Sbjct: 1487 IFEALKRVNLISEEQSHQGAVREADNDTSSNSSENINKFLDL-SSEVSEGGSNLSQGQRQ 1545

Query: 641  RIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRS 700
             + +AR+L++ PKI++LDEAT+++D  S+  I  T  K  +    TI++IAHRL ++   
Sbjct: 1546 LMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGS--TILTIAHRLRSVIDY 1603

Query: 701  EYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQS 738
            + I+V+       + G+ KE Y  P S    LL  KQS
Sbjct: 1604 DKILVM-------DAGEVKE-YDHPYS----LLLNKQS 1629

 Score = 78.6 bits (192), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 72/251 (28%), Positives = 122/251 (48%), Gaps = 30/251 (11%)

Query: 508 ENQVFK--NLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILI---DNQDIMK 562
           +NQ FK  +LN + + G    ++GP+G GK+++ + LL      +G+I++   + +  + 
Sbjct: 706 DNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLNGKIVVPALEPRQELV 765

Query: 563 LNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQC-FCHNF-ITKFP 620
           ++       +    Q   L++ +I+ NI +           + V + C    +F I K  
Sbjct: 766 VDANGTTNSIAYCSQGAWLLNDTIKHNILFN--SPFNEARYKAVVEACGLKRDFEILKAG 823

Query: 621 DAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTFGK 678
           D  E  IG  G  LSGGQKQR+++ARAL    + ++LD+  SA+D  +   I  N   G 
Sbjct: 824 DLTE--IGEKGIALSGGQKQRVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGP 881

Query: 679 LMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSK-LLNEKQ 737
           LM+ ++  +VS  H ++   R+  ++VL  DG + + G       DP   L K L  E +
Sbjct: 882 LMEDRTCILVS--HNIALTLRNAELVVLLEDGRIKDQG-------DPIDMLQKGLFGEDE 932

Query: 738 -------SRAN 741
                  SRAN
Sbjct: 933 LVKSSILSRAN 943

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  142 bits (357), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 148/545 (27%), Positives = 244/545 (44%), Gaps = 51/545 (9%)

Query: 211  FGLTLYPFLGAFAGALVIG--TMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFD 268
            + L +Y F+G F  ALV    T+ N+    +  L + R +  L   ++KK L+    FFD
Sbjct: 882  YYLLIYFFIG-FTQALVASSKTIINF----MAGLNASRKIFNL---ILKKVLYAKLRFFD 933

Query: 269  QNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPA 328
               +G +++R   D   V + LT  V   F +++             P      +  A  
Sbjct: 934  STPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYITPGFFVVAIFIAIL 993

Query: 329  VVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDI 388
              +    +    R++      +   + +   E L G+ T+++F  E++ ++     I + 
Sbjct: 994  YYLVGYFYMAGSRELKRFESISRSPIHQHFSETLVGITTIRAFGDERRFMQENLEKIDEN 1053

Query: 389  YNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GSLTIGDLTAFMLYTDYTAN 447
                    V N   +    +IG     V+ A G +++L+  SL  G     + Y      
Sbjct: 1054 NKPFFYLWVANRWLAFRIDMIGAC---VIFAAGIFVLLNIKSLDSGLAGISLTYAISFTE 1110

Query: 448  SIFGLSNFYSEIMQGVGAAKRLFDL--TDRIPAIRPT-IGEKFIPGDGCIEFRNLGFAY- 503
                L   YS +   + + +RL +    ++ P  + T       P  G IE  +L   Y 
Sbjct: 1111 GALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQSTHTPPPEWPSQGKIEVNDLSLRYA 1170

Query: 504  PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKL 563
            P+ P  +V KN++F ++P   V IVG +G GKSTI   L R+ +P SG I IDN DI  +
Sbjct: 1171 PSLP--KVIKNVSFTVDPNCKVGIVGRTGAGKSTIITALFRFLDPESGYIKIDNVDITSV 1228

Query: 564  NPKSLRQYMGIVQQEPVLMSGSIRDN-----------ITYGLKRE--ATPDEIREV---- 606
              K LRQ + I+ Q+P L +G+++ N           I   LKR    T +E+       
Sbjct: 1229 ELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDGQIFEALKRVNLLTEEELNSAGSPA 1288

Query: 607  -SKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALD 665
                      + KF    +  I   G  LS GQ+Q + +AR+L++ PK+++LDEAT+++D
Sbjct: 1289 PGNSSIHSENVNKFL-RLDNEITEGGANLSQGQRQLVCLARSLLRSPKVMLLDEATASID 1347

Query: 666  VESEGAINYTF-GKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYAD 724
              S+  I  T  G+   S   TI++IAHRL +I   + I+V+       + G+ KE Y  
Sbjct: 1348 YTSDARIQQTIRGEFSNS---TILTIAHRLRSIIDYDKILVM-------DAGEVKE-YDH 1396

Query: 725  PTSEL 729
            P S L
Sbjct: 1397 PYSLL 1401

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/327 (24%), Positives = 155/327 (47%), Gaps = 35/327 (10%)

Query: 413 SFLVVLAYGSYLVLHGSL--TIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL- 469
           S +  +++ +Y+ + G +  T    TA  L+T    N +  LS+  S ++Q   +  R+ 
Sbjct: 396 SIVTTVSFATYIYIQGEVLTTPVAFTALSLFT-LLRNPLDMLSDMLSYVIQSKVSLDRVQ 454

Query: 470 -------FDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPG 522
                   +  D+I   R  IG           F N  F++  +  +   KN++ +   G
Sbjct: 455 VFLEEDETEKYDQITVSRKRIG-----------FENATFSWDRKNPDFKLKNMSIEFRLG 503

Query: 523 TSVCIVGPSGRGKSTIALLLLRYYNPSSGQI---LIDNQDIMKLNPKSLRQYMGIVQQEP 579
               ++GP+G GK+++ + LL   +   G++    +D ++ + +    +   +    Q  
Sbjct: 504 KLNVVIGPTGSGKTSLLMGLLGEMDLLEGKVYAPCLDPREDLIVENDGMTNSIAYCSQGA 563

Query: 580 VLMSGSIRDNITYGLK-REATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQ 638
            L++ ++++NI +     EA  D + E    C             +T IG  G  LSGGQ
Sbjct: 564 WLLNDTVKNNILFSSPFNEARYDAVVEA---CGLKRDFEILSAGDQTEIGEKGITLSGGQ 620

Query: 639 KQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTFGKLMKSKSVTIVSIAHRLS- 695
           KQR+++ARAL    + L+LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++ 
Sbjct: 621 KQRVSLARALYSSSRHLLLDDCLSAVDSHTALWIYENCITGPLMEGRTCILVS--HNVAL 678

Query: 696 TIRRSEYIIVLGNDGSVVETGKFKELY 722
           T++ +++++ + N G V + G+  EL+
Sbjct: 679 TLKNADWVVFMEN-GKVKDQGEPLELF 704

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  141 bits (355), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 136/538 (25%), Positives = 239/538 (44%), Gaps = 32/538 (5%)

Query: 215  LYPFLGAFAGALVIGTMC--NYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKV 272
            ++ F+G ++  L +G+    N    I+L   S R   +L  ++ K  +     FF+   V
Sbjct: 1017 VWMFVGVYS-LLGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 1075

Query: 273  GDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVIS 332
            G +I+R  SD   V  SL    S  FK+IL             P    F +      +  
Sbjct: 1076 GRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVIYIYY 1135

Query: 333  ASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIG 392
             + +    R++  ++  +   +  +  E LNG   + ++   ++ I    + I+   ++ 
Sbjct: 1136 QTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYNHYERFIYLNYDKIQSNIDLV 1195

Query: 393  KMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLV-LHGSLTIGDLTAFMLYTDYTANSIFG 451
                 +N   S     IG    L         +     L+ G +   M Y+    +S+  
Sbjct: 1196 FNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTSSLTW 1255

Query: 452  LSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKF----IPGDGCIEFRNLGFAYPTRP 507
            +      I   + + +R+ +  +  P  +    EK      P +G IEF+N    Y    
Sbjct: 1256 IVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTKYRENL 1315

Query: 508  ENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKS 567
            +  V K++N  I+P   + IVG +G GKST++L L R   PS G+I+ID+ +I +L    
Sbjct: 1316 D-PVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISELGLFD 1374

Query: 568  LRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKF-------- 619
            LR  + I+ Q+     G++R N+     R  + DE++   +     + + K         
Sbjct: 1375 LRSNLAIIPQDAQAFEGTVRTNLD-PFNR-YSEDELKRAIELAHLKSHLEKMLGNEAENN 1432

Query: 620  ----------PDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESE 669
                       D  +  I  +G+ LS GQ+Q + +ARAL+   KIL+LDEAT+++D+E++
Sbjct: 1433 DINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASVDMETD 1492

Query: 670  GAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTS 727
              I  T  +  K +  TI++IAHR+ T+  S+ IIVL + G+V E     +L +D  S
Sbjct: 1493 KIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DKGNVKEFDSPSKLLSDKGS 1547

 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 121/231 (52%), Gaps = 17/231 (7%)

Query: 512 FKNL-NFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQ 570
            KN+ +F+ + G  +C+VG  G GKST    +L       GQ+   +     L PK + +
Sbjct: 654 LKNIEHFEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIR 706

Query: 571 Y--MGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIG 628
              +    QE  +M+ S+R+NI +G K +    ++    K C     +   PD  ET++G
Sbjct: 707 ASSLAYCSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVG 764

Query: 629 PHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTF-GKLMKSKSVT 686
             G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I +   GK    K+ T
Sbjct: 765 EKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKT 824

Query: 687 IVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELY--ADPTSELSKLLNE 735
           I+   + +S ++ S+ I  L N G +VE G ++ +    + +S+L KLL E
Sbjct: 825 IILTTNTVSILKHSQMIYALEN-GEIVEQGNYESVMKRENDSSKLKKLLEE 874

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  141 bits (355), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 141/546 (25%), Positives = 249/546 (45%), Gaps = 74/546 (13%)

Query: 210  AFGLTLYPFLGAFAGAL--VIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFF 267
            A+ L++Y  +G    ++  +   +C Y       L + R   ++ + ++K +LH    FF
Sbjct: 1135 AYYLSIYFGIGVLHSSIFAIKDILCTYAG-----LAASR---KMFNSLLKNSLHAKLRFF 1186

Query: 268  DQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQ---LSSFLVI 324
            D   +G +++R   D   V + +   +   F  ++             PQ   ++ F+ +
Sbjct: 1187 DSTPLGRIMNRFSKDIEAVDQEVPMYLGGTFACLVECFSIIVLITLITPQFLGVAIFIAV 1246

Query: 325  F---APAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRY 381
            F     AV IS S   ++++   +I +    Q      E L G+ TV+++  E + +R  
Sbjct: 1247 FYWFVGAVYISGS---RELKRFDSITKSPIYQHF---SETLAGITTVRAYGDESRFMREN 1300

Query: 382  NNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFML- 440
               I +         V N   S  T +IG     V+L  G + + + +     L    L 
Sbjct: 1301 LEKIDENNKPFFYMWVSNRWLSFRTQIIGA---FVILGAGGFSIWNINKIDSGLAGISLT 1357

Query: 441  YTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLT--DRIPAIRPTIGE-KFIPGDGCIEFR 497
            Y    +++   L  FY +    + + +R+ +    D+ P    T+      P +G IE  
Sbjct: 1358 YALTFSDAALWLVRFYGDTEMNMNSTERIQEYMNIDQEPYNEGTVEPPADWPENGKIEIN 1417

Query: 498  NLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILID 556
            ++   Y P  P  +V KN++F ++  + V IVG +G GKSTI   L R+  P +G I ID
Sbjct: 1418 DVSLRYAPNLP--RVIKNVSFTVDSKSKVGIVGRTGAGKSTIITALFRFLEPETGNIKID 1475

Query: 557  NQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFI 616
            N DI+ ++ + LR+ + I+ Q+P L +G+IR N+        T    +E+     C N +
Sbjct: 1476 NIDIVSIDLQKLRRSISIIPQDPTLFTGTIRSNLD-----PYTQYSDKEIFDSLICVNLV 1530

Query: 617  TK------------------------FPDAYETIIGPHGTLLSGGQKQRIAIARALIKKP 652
            ++                        F D  E  +   G+ +S GQ+Q + +AR+L+ KP
Sbjct: 1531 SREELAQVQSPSSNDTSSIVSENFNHFLDL-EYNVSEGGSNISQGQRQLLCLARSLLGKP 1589

Query: 653  KILILDEATSALDVESEGAINYT----FGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGN 708
            KI++LDEAT+++D ES+  I  T    FG      + TI++IAHRL ++   + I+V+  
Sbjct: 1590 KIILLDEATASIDYESDKKIQETIRNEFG------NSTILTIAHRLRSVIDYDKILVM-- 1641

Query: 709  DGSVVE 714
            D   VE
Sbjct: 1642 DAGEVE 1647

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 115/243 (47%), Gaps = 16/243 (6%)

Query: 494 IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI 553
           + F+N   ++    ++   +NL+   + G    ++GP+G GK+++ + LL     + GQI
Sbjct: 758 LSFKNATMSWGNDNDSFKLRNLDIDFKIGQLNVVIGPTGSGKTSLLMALLGEMTLTEGQI 817

Query: 554 LI---DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQC 610
            I   D +  + +        +    Q   L++ ++R+NI +         +   V+   
Sbjct: 818 NIPSLDPRHDLIIESDGHTNSIAYCSQAAWLLNDTVRNNILFNSPYNKDRYDAAIVAAGL 877

Query: 611 FCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEG 670
                I    D  E  IG  G  LSGGQKQRI++ARAL    + ++LD+  SA+D  +  
Sbjct: 878 KRDFEILAAGDLTE--IGERGITLSGGQKQRISLARALYSNARHVLLDDCLSAVDAHTAA 935

Query: 671 AI--NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSE 728
            I  N   G LM+ ++  +VS  H ++   ++  ++V+  +G V + G       DP + 
Sbjct: 936 WIYDNCISGPLMEGRTCVLVS--HNIALTLKNASLVVMLKNGRVADQG-------DPVTL 986

Query: 729 LSK 731
           L+K
Sbjct: 987 LNK 989

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 156/583 (26%), Positives = 258/583 (44%), Gaps = 67/583 (11%)

Query: 185  LVLDALKNVMTDSPSSLETSDLPPIAFGLTLYPFLG---AFAGALVIGTMCNYGRYILLR 241
            L L+ +K+   DS  +  T+      + L+LY  +G   A  G L   TM  +       
Sbjct: 1019 LALEGIKSKRVDSSENQYTA-----IYYLSLYFVIGIIQALLGGL--KTMVTF------- 1064

Query: 242  LLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAI 301
            L   +   ++ + ++   LH    FFD   VG +++R   D   + + L   +      +
Sbjct: 1065 LSGMQASKKIFNSMLDLVLHAKIRFFDVTPVGRIMNRFSKDIEGIDQELIPYLEVTVFCL 1124

Query: 302  LCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQ 361
            +             P+  S  VI           + K  RD+  I       + +   E 
Sbjct: 1125 IQCSSILLLIVVITPRFFSVAVIVFILYYFVGKWYLKASRDLKRIDSITKSPIFQHFSET 1184

Query: 362  LNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYG 421
            L GV T+++F  E++ I      I          +V    F+    +IG     +VL  G
Sbjct: 1185 LVGVCTIRAFGDEKRFILENMEKIDQNNKAFFYLSVAVKWFAFRVDMIGA---FIVLGSG 1241

Query: 422  SYLVLH-----GSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLT--- 473
            S+++ +       L    LT  +L+TD    S   L   YS     + + +RL + +   
Sbjct: 1242 SFILFNIDNIDSGLAGISLTYAILFTD----SALWLVQLYSRFEMNMNSVERLKEYSSIV 1297

Query: 474  ---------DRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTS 524
                     D I A+  +      P  G IE  NL   Y +     V KN+ FK++P + 
Sbjct: 1298 QEKYLGYDEDHIQALNDSSW----PKHGKIEVENLSLRYASNLP-LVLKNVCFKVDPQSK 1352

Query: 525  VCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSG 584
            V IVG +G GKSTI   L R   P +G I ID+QDI K++  +LR+ + I+ Q+PVL +G
Sbjct: 1353 VGIVGRTGAGKSTIIAALFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIPQDPVLFAG 1412

Query: 585  SIRDNI----TYGLKR---------EATPDEIREVSKQCFCHNFITKFPDAYETIIGPHG 631
            +I+ NI     Y  +R           +  E ++V       N   KF +    I+   G
Sbjct: 1413 TIKSNIDPHDEYDERRIFKVLLQVNLISSLEFKQVFNLKENFNIHNKFLNLQSEIV-EGG 1471

Query: 632  TLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSK--SVTIVS 689
              LS G++Q + IAR+L+++ KI++LDEATS++D +S+  I      +++SK    TI++
Sbjct: 1472 LNLSQGERQLLFIARSLLRESKIILLDEATSSIDYDSDHLIQ----SIIRSKFNKSTILT 1527

Query: 690  IAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKL 732
            IAHRL ++   + I+V+ + G + E G   EL  +  S   ++
Sbjct: 1528 IAHRLRSVIYYDKILVM-DAGEIKEYGHPYELLKNERSTFYRM 1569

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 80/283 (28%), Positives = 130/283 (45%), Gaps = 23/283 (8%)

Query: 452 LSNFYSEIMQGVGAAKRL---FDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPE 508
           LSN  S I Q   + +R+    +L D     + TI     P    IEF+     +    +
Sbjct: 623 LSNMLSFINQSKVSLRRIISFLNLDDTEKYNQLTIS----PDRNKIEFKKANLVW-NEND 677

Query: 509 NQVFK----NLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDN----QDI 560
           N + K    +LN     G    ++G +G GKS + + LL   +  SG I+I       D+
Sbjct: 678 NDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSLLGELDLVSGFIIIPGLEPRHDL 737

Query: 561 MKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFP 620
           +  +   L        Q   L+S +I++NI +    + +    ++V   C  +  +   P
Sbjct: 738 IP-DHDGLTNSFAYCSQSAWLVSDTIKNNIVFNGSYDKS--RYKKVIDACGLNRDLNILP 794

Query: 621 DAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTFGK 678
               T IG  G  LSGGQKQRI++ARA+    K ++LD+  SA+D  +   I  N   G+
Sbjct: 795 AGDLTEIGEKGITLSGGQKQRISLARAVYSHAKHVLLDDCLSAVDSHTAVWIYENCITGQ 854

Query: 679 LMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
           LMK+++  +V+  H +    R+ +  ++  DG V   G  KEL
Sbjct: 855 LMKNRTCILVT--HNVPLAIRNAHFAIILEDGKVKNQGTIKEL 895

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  140 bits (354), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 129/487 (26%), Positives = 219/487 (44%), Gaps = 42/487 (8%)

Query: 255  VIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXX 314
            ++ K +H    FFD   +G +++R   D     + LT  +   F +++            
Sbjct: 1128 LLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIEGAFYSLVQCVSTVVLITFI 1187

Query: 315  XPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAE 374
             PQ     ++ A         +    R++  +   +   + +   E L GV T+++F  E
Sbjct: 1188 TPQFLFVAILVAVLYYFVGYFYLTGSRELKRLESISRSPIYQHFSETLVGVTTIRAFGDE 1247

Query: 375  QKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GSLTIG 433
             + +R     I +         V N   S    +IG    LV+   G +++L+   +  G
Sbjct: 1248 SRFMRENLQKIDENNRPFFYLWVANRWLSFRIDMIGA---LVIFGAGIFVLLNIDHIDSG 1304

Query: 434  DLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTD--RIPAIRPTIGEKF-IPG 490
                 + Y          L   YS +   + + +RL +  D  + P  +  +      P 
Sbjct: 1305 KAGISLTYAITFTEGALWLVRLYSNVEMNMNSVERLKEYMDVEQEPYDQSILTPPVEWPQ 1364

Query: 491  DGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
             G IE  +L   Y P  P  +V KN++F ++P + V IVG +G GKSTI   L R+ +P 
Sbjct: 1365 QGRIEVNDLSLRYAPNLP--KVIKNVSFTVDPRSKVGIVGRTGAGKSTIITALFRFLDPE 1422

Query: 550  SGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT-YGLKREATPDEIREVSK 608
            +G I IDN DI  ++ + LR+ + I+ Q+P L +G+I+ N+  Y    E T  +I E  K
Sbjct: 1423 TGNIKIDNVDITSIDLQRLRRSITIIPQDPTLFTGTIKSNLDPYD---EYTDQQIFEALK 1479

Query: 609  QCFCHNFIT---------------------KFPDAYETIIGPHGTLLSGGQKQRIAIARA 647
            +    N +T                     KF D   + I   G  +S GQ+Q + +AR+
Sbjct: 1480 RV---NLVTQEELDRRPTSESSSVSSENINKFLDL-SSEISEGGGNISQGQRQLVCLARS 1535

Query: 648  LIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLG 707
            L++ PKI++LDEAT+++D  S+  I  T  K       TI++IAHRL ++   + I+V+ 
Sbjct: 1536 LLRSPKIILLDEATASIDYASDAKIQETIRKEFGGN--TILTIAHRLRSVIDYDKILVM- 1592

Query: 708  NDGSVVE 714
            + G V E
Sbjct: 1593 DAGEVKE 1599

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 114/491 (23%), Positives = 205/491 (41%), Gaps = 62/491 (12%)

Query: 257 KKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXP 316
           ++ ++ D E      +G +I+ +  DA+ VS     ++     A +              
Sbjct: 462 QEQINGDEESTTSANLGAIINLMAVDAFKVS-----EICAYLHAFVEAVVMALVAFVLLY 516

Query: 317 QLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLN----GVKTVQSFV 372
            L  F  I   A++++      K+      LQ+ T  +T    ++LN     ++ ++ F 
Sbjct: 517 HLLGFAAIVGAALIVAMMPLNFKLATWLGHLQKETLSVTDKRIQKLNEAFQAIRIIKFFS 576

Query: 373 AEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTI 432
            E       NN  +DI ++ +       KF    S++           GS  V + + TI
Sbjct: 577 WE-------NNFEKDIRDVRETEL----KFLMKRSLVWA---------GSSFVWYITPTI 616

Query: 433 GDLTAFMLYT-----------DYTANSIFGLS----NFYSEIMQGVGAAKRLFDLTDRIP 477
               AF  Y             +TA S+F L     +  S+++  V  +K   D      
Sbjct: 617 VTSCAFWFYIYIQGEVLTTPIAFTALSLFSLLRTPLDQLSDMLSFVIQSKVSLDRVQEFL 676

Query: 478 AIRPTIGEKFIPGDGCIEFRNLGFAYPT------RPENQVFKNLNFKIEPGTSVCIVGPS 531
             + T  EK+       + + +GF   T      RP+ ++ KNLN   + G    I+GP+
Sbjct: 677 EEKDT--EKYNQLSTAKDKKKIGFENATITWDAERPDFKL-KNLNIDFKVGKLNVIIGPT 733

Query: 532 GRGKSTIALLLLRYYNPSSGQILI---DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRD 588
           G GK+++ + LL   +  SG+I++   D +  + +    +   M    Q   L++ ++++
Sbjct: 734 GSGKTSLLMALLGEMHLVSGKIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKN 793

Query: 589 NITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARAL 648
           NI +             V + C      +       T IG  G  LSGGQKQRI++AR+L
Sbjct: 794 NILFN--SPYNEGRYEAVVEACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISLARSL 851

Query: 649 IKKPKILILDEATSALDVESEGAI--NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVL 706
               + ++LD+  SA+D  +   I  N   G LM+ ++  +VS    L T+R +E ++ +
Sbjct: 852 YSNARHVLLDDCLSAVDSHTASWIYDNCITGPLMEGRTCILVSHNTAL-TLRNAELVVTM 910

Query: 707 GNDGSVVETGK 717
            N G V   G+
Sbjct: 911 EN-GQVKNQGE 920

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  140 bits (353), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 159/587 (27%), Positives = 255/587 (43%), Gaps = 70/587 (11%)

Query: 182  VIGLVLDALKNVMTDSPSSLETS--DLPPIAFGLTLYPFLGAFAGAL--VIGTMCNYGRY 237
            V+ + L  + NV     S + T     P     L +Y  LG F  AL  +I T+      
Sbjct: 958  VVSMFLSVMGNVWLKHWSEINTERGSNPNAIHYLFIYFALG-FGSALSTLIQTV------ 1010

Query: 238  ILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAY----VVSRSLTQK 293
            IL    + R    L   +    L     FF+   +G +++R  +D Y    ++ R+ +Q 
Sbjct: 1011 ILWVFCTIRGSRYLHDLMTDAVLKAPMSFFETTPIGRILNRFSNDIYKIDSILGRTFSQF 1070

Query: 294  VSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIF-----------GKKIRD 342
              +  K +                 +++  IF   V+I   +F            +++R 
Sbjct: 1071 FVNAVKVVFVMAVICA---------TTWQFIF---VIIPLGVFYIYYQQYYLRTSRELRR 1118

Query: 343  ISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAV----- 397
            + +I +     +    +E L G+ T++ +  ++K     N    D      MSA      
Sbjct: 1119 LDSITRSP---VYSHFQETLGGITTIRGY-NQEKRFGHINQCRVD----NNMSAFYPSIN 1170

Query: 398  VNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLT---IGDLTAFMLYTDYTANSIFGLSN 454
             N   +    +IG +  L       + +  G+LT   +G   ++ L    T N I  ++ 
Sbjct: 1171 ANRWLAFRLELIGSIIILGAATLSIFRLKEGTLTPGMVGLSLSYALQITQTLNWIVRMTV 1230

Query: 455  FYSEIMQGVGAAKRLFDLTDRIPAI----RPTIGEKFIPGDGCIEFRNLGFAYPTRPE-N 509
                 +  V   K    L    P I    RP   ++  P +G I+F N    Y  RPE +
Sbjct: 1231 EVETNIVSVERVKEYAQLESEAPRIVEEKRP---DEMWPTEGDIKFENYSTRY--RPELD 1285

Query: 510  QVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLR 569
             V KN+N  I P   V IVG +G GKS++ L L R    ++G I+ID   I ++    LR
Sbjct: 1286 LVLKNINVHIRPTEKVGIVGRTGAGKSSLTLALFRIIEATAGNIIIDGIPINEIGLYDLR 1345

Query: 570  QYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKF-PDAYETIIG 628
              + I+ Q+  +  G++R+NI        T +EI  V +       +     D  +  + 
Sbjct: 1346 HKLSIIPQDSQVFEGTLRENI--DPTNLFTDEEIWRVLELSHLKEHVLSMGADGLDVQLT 1403

Query: 629  PHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIV 688
              G+ LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++  +  T     K +  TI+
Sbjct: 1404 EGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAVDVETDKIVQETIRTAFKDR--TIL 1461

Query: 689  SIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNE 735
            +IAHRL+TI  S+ IIVL + G +VE     EL A P S    L NE
Sbjct: 1462 TIAHRLNTIMDSDRIIVL-DKGEIVEFDTPDELLAKPESLFYSLCNE 1507

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 104/411 (25%), Positives = 187/411 (45%), Gaps = 50/411 (12%)

Query: 355 TRVSEEQLNGVKTVQSFVAE---QKEIRRYNNAIRDIYNIGKMS---AVVNSKFSTSTSV 408
           T V  E LN +K+++ +  E   Q ++    N  ++++N+ K+    AV + +F+    +
Sbjct: 481 TGVISEILNNIKSLKLYAWEVPYQTKLNHVRND-KELHNLTKLGCYMAVTSFQFNIVPFL 539

Query: 409 IGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKR 468
           +   +F  V  Y     L   L    LT F L     +  +  + N  +  ++   +  R
Sbjct: 540 VSCATF-AVFVYTENKPLTTDLVFPALTLFNL----LSFPLMVVPNVITSFVEASVSVNR 594

Query: 469 LF----------DLTDRIPAIRPTIGEKFIPGDGCIEF-RNLGFAYPTRPENQV-FKNLN 516
           LF          D   R+P +          GD  I    N  F +  +PE +V  KN+N
Sbjct: 595 LFSFLTNEELQKDSIQRLPKVEN-------KGDVAINLGDNATFLWKRKPEYKVALKNIN 647

Query: 517 FKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP-KSLRQYMGIV 575
           F+ + G   CIVG  G GKS +   +L               D+ ++    ++   +  V
Sbjct: 648 FQAKKGDLTCIVGKVGSGKSALIQSIL--------------GDLFRVKGFATVHGNVAYV 693

Query: 576 QQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLS 635
            Q P +M+G++++NI +G K +    E  +  K C     +    D  +T++G  G  LS
Sbjct: 694 SQVPWIMNGTVKENILFGHKYDQEFYE--KTIKACALTIDLGILVDGDQTLVGEKGISLS 751

Query: 636 GGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGKLMKSKSVTIVSIAHRL 694
           GGQK R+++ARA+  +    +LD+  +A+D   S+  + +  G      S T V   +++
Sbjct: 752 GGQKARLSLARAVYSRADTYLLDDPLAAVDEHVSKHLVEHVLGPTGLLHSKTKVLCTNKI 811

Query: 695 STIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEA 745
           S +  ++ I +L N G +V+ G ++E+ +D  S L KL+ E   + NK + 
Sbjct: 812 SVLSIADSITLLEN-GEIVQQGSYEEVNSDEDSPLFKLIKEYGRKENKSKG 861

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 138/544 (25%), Positives = 249/544 (45%), Gaps = 44/544 (8%)

Query: 215  LYPFLGAFAGALVIGTMCNYGRYILLRL-LSERVVARLRSHVIKKTLHQDAEFFDQNKVG 273
            ++ F+G ++   V     N  R I++ L  S R   +L  ++ K  +     FF+   VG
Sbjct: 1017 VWMFVGVYSLIGVGSAAFNNLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVG 1076

Query: 274  DLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISA 333
             +I+R  SD   V  SL    S  FK+IL             P    F +      +   
Sbjct: 1077 RIINRFSSDMDAVDSSLQYIFSFFFKSILTYLVTVILVGYNMPWFFVFNMFLLVIYIYYQ 1136

Query: 334  SIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTV------QSFVAEQKEIRRYNNAIRD 387
            + +    R++  ++  +   +  +  E LNG   +      + F+    E  +YN  I  
Sbjct: 1137 TFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYN--IDF 1194

Query: 388  IYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTAN 447
            ++N    +  ++ +  T  + I   + ++ L   + +     L+ G +   M Y+     
Sbjct: 1195 VFNFRSTNRWLSVRLQTIGATIVLATAMLAL---TTMNTKKQLSSGMVGLLMSYSLEVTG 1251

Query: 448  SIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIG-----EKFIPGDGCIEFRNLGFA 502
            S+  +      I   + + +R+ +  + +P+   +I      ++  P  G IEF+N    
Sbjct: 1252 SLTWIVRTTVMIETNIVSVERIVEYCE-LPSEARSINPENRPDESWPSKGSIEFKNYSTK 1310

Query: 503  YPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMK 562
            Y    +  V K++N +I+P   + IVG +G GKST++L L R   P+ G I+ID+ +I  
Sbjct: 1311 YRENLD-PVLKDINVRIKPCEKIGIVGRTGAGKSTLSLALFRILEPTEGSIVIDDINISD 1369

Query: 563  LNPKSLRQYMGIVQQEPVLMSGSIRDNI------TYGLKREAT-------------PDEI 603
            L    LR ++ I+ Q+     G++R N+      + G  ++A               +EI
Sbjct: 1370 LGLFDLRSHLAIIPQDAQAFEGTVRTNLDPFNRYSEGELKKAVDLAHLGPHLEKMLDNEI 1429

Query: 604  REVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSA 663
            R        +  ++   D     I  +GT LS GQ+Q + +ARAL+ + KIL+LDEAT++
Sbjct: 1430 RGADGAAEENGNVS---DVLNVKINENGTNLSVGQRQLLCLARALLNRSKILVLDEATAS 1486

Query: 664  LDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYA 723
            +D+E++  I  T  +  K +  TI++IAHR+ T+  S+ IIVL ++G+V E     +L +
Sbjct: 1487 VDMETDKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DEGTVKEFDSPSKLLS 1543

Query: 724  DPTS 727
            D  S
Sbjct: 1544 DKAS 1547

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 114/456 (25%), Positives = 210/456 (46%), Gaps = 57/456 (12%)

Query: 322 LVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRY 381
           L+  A  + I+A +  +K++ +S    +      +   E LN +K+++ +  E+  + R 
Sbjct: 440 LITMAIMMPINAYL-SRKVKKLSKTQMKYKDLRIKTITEILNAIKSIKLYAWEEPMMERL 498

Query: 382 NNAIRD--IYNIGKMSAVVNSKFSTSTSV--IGDMSFLVVLAYGSYLVLHGSLTIGDLTA 437
           N+   D  + N  K+  V N  +     V  +   S   + +  S   L  ++    L+ 
Sbjct: 499 NHVRNDMELQNFRKIGIVSNLIYFAWNCVPLMVTCSTFGLFSLFSDTPLSPAIVFPSLSL 558

Query: 438 FMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL--FDLTDRI-----PAIRPTIGEKFIPG 490
           F +      ++I+ + +  + I++   + +RL  F L+D I       I P++ E+ +P 
Sbjct: 559 FNILN----SAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFIERIDPSMSERTLP- 613

Query: 491 DGCIEFRNLGFAYPTRP--------------------ENQV-FKNLN-FKIEPGTSVCIV 528
              IE  N+ F + ++                      +Q+  KN++ F+ + G  VC+V
Sbjct: 614 --VIEMNNITFLWKSKEALASGQFEGNSNADEESIIGSSQIALKNIDHFEAKRGDLVCVV 671

Query: 529 GPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY--MGIVQQEPVLMSGSI 586
           G  G GKST    +L       GQ+   +     + PK + +   +    QE  +M+ S+
Sbjct: 672 GRVGAGKSTFLKGIL-------GQLPCMSGSKGSIPPKLIIRASSLAYCSQESWIMNSSV 724

Query: 587 RDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIAR 646
           R+NI +G K +    ++    K C     +   PD  ET++G  G  LSGGQK R+++AR
Sbjct: 725 RENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLAR 782

Query: 647 ALIKKPKILILDEATSALDVE-SEGAINYTF-GKLMKSKSVTIVSIAHRLSTIRRSEYII 704
           A+  +  I +LD+  SA+D E S+  + Y   GK    K+ TI+   + +  ++ S+ I 
Sbjct: 783 AVYSRADIYLLDDVLSAVDAEVSKNIVEYVLIGKAALLKNKTIILATNTVPILKHSQMIY 842

Query: 705 VLGNDGSVVETGKFKELY--ADPTSELSKLLNEKQS 738
            L N G ++E G ++ +    +  S+L KLL E  S
Sbjct: 843 ALEN-GEIIEQGNYEGVMNRENTNSKLKKLLEEFDS 877

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 145/561 (25%), Positives = 247/561 (44%), Gaps = 65/561 (11%)

Query: 209  IAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFD 268
            IA  L +Y  +G  +   +IG++  +       L   R    +   ++ + LH    FFD
Sbjct: 1089 IAKFLVVYCLIGVMSS--IIGSIKTFVN----SLFGIRASKLIFDSLLDRVLHARVRFFD 1142

Query: 269  QNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPA 328
               +G +++R   D   + + +   +   F + +             P      +I    
Sbjct: 1143 STPIGRIMNRFSKDIESIDQEIPPNIQSVFYSAIEVFATLLLISYITPAFFPVAIIIVLG 1202

Query: 329  VVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDI 388
              I    +    R++  +   +   + +   E L GV T+++F  EQ+ I+   + I   
Sbjct: 1203 YSIVGFFYLTTSRELKRLDSISKSPIFQHFSETLVGVTTIRAFGDEQRFIKENLSMIDQN 1262

Query: 389  YNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GSLTIGDLTAFMLYTDYTAN 447
                    VVN   S    +IG    LV+ + G +++L+  ++  G     + Y      
Sbjct: 1263 SMPFFYLWVVNRWLSFRIDLIGA---LVIFSSGVFILLNINNIDAGLAGISLTYAISFTE 1319

Query: 448  SIFGLSNFYSEIMQGVGAAKRLFD---------LTDRIPAIRPTIGEKFIPGDGCIEFRN 498
            +   L   YSE+   + + +R+ +         + D   A+ P       P  G +E  N
Sbjct: 1320 AALWLVRQYSELEMNMNSVERVLEYMNIEQEPLIADPANAVTPPPQ---WPDSGKVEVNN 1376

Query: 499  LGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDN 557
            L   Y P  P   V K++ F IEP   V IVG +G GKSTI   L R+    +G I +D 
Sbjct: 1377 LSLKYAPHLP--YVIKDVTFTIEPLEKVGIVGRTGAGKSTIITALFRFLEADTGSIKLDG 1434

Query: 558  QDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDN-----------ITYGLKR---------E 597
             +I  ++ K LR+ + I+ Q+P L +GSIR N           I   LKR         E
Sbjct: 1435 VNIANIDLKRLRRSITIIPQDPTLFAGSIRSNLDPYDEYSDEEIFTALKRVNLVSTEEME 1494

Query: 598  ATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILIL 657
            A+  EI+  S +      + KF +  E+ I   G+  S GQ+Q + +AR+L++ PK+++L
Sbjct: 1495 ASTSEIQSNSSKN-----VNKFLNL-ESEIAEGGSNFSQGQRQLMCLARSLLRMPKVILL 1548

Query: 658  DEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGK 717
            DEAT+++D  S+  I  T  +   +   T+++IAHRL +I   + I+V+       + G+
Sbjct: 1549 DEATASIDYNSDAKIQETIRQEFNNS--TVLTIAHRLRSIVDYDKILVM-------DAGE 1599

Query: 718  FKELYADPTSELSKLLNEKQS 738
             KE +  P S    LL EK+S
Sbjct: 1600 VKE-FDHPYS----LLLEKKS 1615

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 122/244 (50%), Gaps = 27/244 (11%)

Query: 494 IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI 553
           + F N+   + +  ++ V +NL+ +   G    IVG +G GK++I + LL     S G+I
Sbjct: 706 LAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGKI 765

Query: 554 LIDNQDIMKLNPKSLRQ-YMGIVQ-------QEPVLMSGSIRDNITYGLKREATPDEIR- 604
           ++ +     L+P+   Q   G++        Q   L++ ++R+NI +     A  D+ R 
Sbjct: 766 IVPS-----LSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNILFN----APFDQARY 816

Query: 605 -EVSKQC-FCHNF-ITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEAT 661
             V + C    +F I K  D+ E  IG  G  LSGGQKQR+++ARAL      L+LD+  
Sbjct: 817 DAVVEACSLKRDFQILKAGDSTE--IGEKGITLSGGQKQRVSLARALYSSAGHLLLDDCL 874

Query: 662 SALDVESEGAI--NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFK 719
           SA+D  +   I      G LM+ ++  +V+  H ++   ++   +V+  DG V E G   
Sbjct: 875 SAVDSHTALWIYDKCISGPLMEGRTCILVT--HNIALTMKNADFVVMIEDGKVKEKGTPI 932

Query: 720 ELYA 723
           EL A
Sbjct: 933 ELLA 936

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  140 bits (352), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 147/568 (25%), Positives = 245/568 (43%), Gaps = 32/568 (5%)

Query: 182  VIGLVLDALKNVMTDSPSSLET--SDLPPIAFGLTLYPFLG-AFAGALVIGTMCNYGRYI 238
            VI + L  + NV     S + +     P  A  L +Y  LG   A A +I T+      +
Sbjct: 959  VISMFLSVMGNVWLKHWSEVNSRYGSNPNAARYLAIYFALGIGSALATLIQTI------V 1012

Query: 239  LLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGF 298
            L    +      L + +    L     FF+   +G +++R  +D Y V   L +  S  F
Sbjct: 1013 LWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFF 1072

Query: 299  KAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVS 358
               +              Q    ++  +   +     + +  R++  +       +    
Sbjct: 1073 VNAVKVTFTITVICATTWQFIFIIIPLSVFYIYYQQYYLRTSRELRRLDSITRSPIYSHF 1132

Query: 359  EEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAV-----VNSKFSTSTSVIGDMS 413
            +E L G+ TV+ + ++QK     N    D      MSA       N   +    +IG + 
Sbjct: 1133 QETLGGLATVRGY-SQQKRFSHINQCRID----NNMSAFYPSINANRWLAYRLELIGSII 1187

Query: 414  FLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLT 473
             L       + +  G+LT G +   + Y      ++  +     E+   + + +R+ +  
Sbjct: 1188 ILGAATLSVFRLKQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYA 1247

Query: 474  DRIPAIRPTIGE-----KFIPGDGCIEFRNLGFAYPTRPE-NQVFKNLNFKIEPGTSVCI 527
            D + +  P I E     K  P  G I+F N    Y  RPE + V K++N  I+P   V I
Sbjct: 1248 D-LKSEAPLIVEGHRPPKEWPSQGDIKFNNYSTRY--RPELDLVLKHINIHIKPNEKVGI 1304

Query: 528  VGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIR 587
            VG +G GKS++ L L R    S G I+IDN  I ++    LR  + I+ Q+  +  G++R
Sbjct: 1305 VGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVR 1364

Query: 588  DNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARA 647
            +NI   + +       R +       + ++   D  +  +   G  LS GQ+Q + +ARA
Sbjct: 1365 ENID-PINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARA 1423

Query: 648  LIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLG 707
            ++   KIL+LDEAT+A+DVE++  +  T     K +  TI++IAHRL+TI  S+ IIVL 
Sbjct: 1424 MLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD 1481

Query: 708  NDGSVVETGKFKELYADPTSELSKLLNE 735
            N G V E     +L +D  S    L  E
Sbjct: 1482 N-GKVAEFDSPGQLLSDNKSLFYSLCME 1508

 Score =  104 bits (259), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 107/408 (26%), Positives = 189/408 (46%), Gaps = 48/408 (11%)

Query: 355 TRVSEEQLNGVKTVQSFVAEQ------KEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSV 408
           TRV  E LN +K+++ +  E+      +E+R  N  ++++  +G   AV + +F+    +
Sbjct: 484 TRVISEILNNIKSLKLYAWEKPYREKLEEVRN-NKELKNLTKLGCYMAVTSFQFNIVPFL 542

Query: 409 IGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKR 468
           +   +F  V  Y     L   L    LT F L + +    I  + N + E    +G    
Sbjct: 543 VSCCTF-AVFVYTEDRALTTDLVFPALTLFNLLS-FPLMIIPMVLNSFIEASVSIGRLFT 600

Query: 469 LF-------DLTDRIPAIRPTIGEKFIP-GDGCIEFRNLGFAYPTRPENQV-FKNLNFKI 519
            F       D   R+P ++  IG+  I  GD         F +  +PE +V  KN+NF+ 
Sbjct: 601 FFTNEELQPDSVQRLPKVK-NIGDVAINIGDDAT------FLWQRKPEYKVALKNINFQA 653

Query: 520 EPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP-KSLRQYMGIVQQE 578
           + G   CIVG  G GK+ +   +L               D+ ++    ++   +  V Q 
Sbjct: 654 KKGNLTCIVGKVGSGKTALLSCML--------------GDLFRVKGFATVHGSVAYVSQV 699

Query: 579 PVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQ 638
           P +M+G++++NI +G + +A   E  +  K C     +    D  +T++G  G  LSGGQ
Sbjct: 700 PWIMNGTVKENILFGHRYDAEFYE--KTIKACALTIDLAILMDGDKTLVGEKGISLSGGQ 757

Query: 639 KQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFG--KLMKSKSVTIVSIAHRLS 695
           K R+++ARA+  +    +LD+  +A+D   +   I +  G   L+ +K  T V   +++S
Sbjct: 758 KARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTK--TKVLATNKVS 815

Query: 696 TIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKK 743
            +  ++ I +L N G + + G + E+  D  S L KLLN    + N K
Sbjct: 816 ALSIADSIALLDN-GEITQQGTYDEITKDADSPLWKLLNNYGKKNNGK 862

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  138 bits (348), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 136/538 (25%), Positives = 239/538 (44%), Gaps = 32/538 (5%)

Query: 215 LYPFLGAFAGALVIGTMC--NYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKV 272
           ++ F+G ++  L +G+    N    I+L   S R   +L  ++ K  +     FF+   V
Sbjct: 446 VWMFVGVYS-LLGVGSAAFNNLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPV 504

Query: 273 GDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVIS 332
           G +I+R  SD   V  SL    S  FK+IL             P    F +      +  
Sbjct: 505 GRIINRFSSDMDAVDSSLQYVFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVIYIYY 564

Query: 333 ASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIG 392
            + +    R++  ++  +   +  +  E LNG   + ++   ++ I    + I+   ++ 
Sbjct: 565 QTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYNHYERFIYLNYDKIQSNIDLV 624

Query: 393 KMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLV-LHGSLTIGDLTAFMLYTDYTANSIFG 451
                +N   S     IG    L         +     L+ G +   M Y+    +S+  
Sbjct: 625 FNFRSINRWLSVRLQTIGATIVLATALLALATINTKNQLSSGMVGLLMAYSFEVTSSLTW 684

Query: 452 LSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKF----IPGDGCIEFRNLGFAYPTRP 507
           +      I   + + +R+ +  +  P  +    EK      P +G IEF+N    Y    
Sbjct: 685 IVRTTVMIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTKYRENL 744

Query: 508 ENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKS 567
           +  V K++N  I+P   + IVG +G GKST++L L R   PS G+I+ID+ +I +L    
Sbjct: 745 D-PVLKDINVSIQPCEKIGIVGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISELGLFD 803

Query: 568 LRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKF-------- 619
           LR  + I+ Q+     G++R N+     R  + DE++   +     + + K         
Sbjct: 804 LRSNLAIIPQDAQAFEGTVRTNLD-PFNR-YSEDELKRAIELAHLKSHLEKMLGNEAENN 861

Query: 620 ----------PDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESE 669
                      D  +  I  +G+ LS GQ+Q + +ARAL+   KIL+LDEAT+++D+E++
Sbjct: 862 DINVEERGNAKDILDVKINENGSNLSVGQRQLLCLARALLSHSKILVLDEATASVDMETD 921

Query: 670 GAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTS 727
             I  T  +  K +  TI++IAHR+ T+  S+ IIVL + G+V E     +L +D  S
Sbjct: 922 KIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DKGNVKEFDSPSKLLSDKGS 976

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 120/231 (51%), Gaps = 17/231 (7%)

Query: 512 FKNL-NFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSL-- 568
            KN+ +F+ + G  +C+VG  G GKST    +L       GQ+   +     L PK +  
Sbjct: 83  LKNIEHFEAKRGDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIR 135

Query: 569 RQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIG 628
              +    QE  +M+ S+R+NI +G K +    ++    K C     +   PD  ET++G
Sbjct: 136 ASSLAYCSQESWIMNASVRENILFGHKFDKAYYDL--TIKACQLLPDLKILPDGDETLVG 193

Query: 629 PHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTF-GKLMKSKSVT 686
             G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I +   GK    K+ T
Sbjct: 194 EKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKT 253

Query: 687 IVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELY--ADPTSELSKLLNE 735
           I+   + +S ++ S+ I  L N G +VE G ++ +    + +S+L KLL E
Sbjct: 254 IILTTNTVSILKHSQMIYALEN-GEIVEQGNYESVMKRENDSSKLKKLLEE 303

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  138 bits (348), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 147/549 (26%), Positives = 235/549 (42%), Gaps = 36/549 (6%)

Query: 182  VIGLVLDALKNVMTDSPSSLET--SDLPPIAFGLTLYPFLG-AFAGALVIGTMCNYGRYI 238
            VI ++L  + NV     S + +     P  A  L +Y  LG   A A +I T+      I
Sbjct: 960  VISMLLSVMGNVWLKHWSEINSRYGGNPNAARYLAIYFALGIGSALATLIQTI------I 1013

Query: 239  LLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGF 298
            L    +      L + +    L     FF+   +G +++R  +D Y V   L +  S  F
Sbjct: 1014 LWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFF 1073

Query: 299  KAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVS 358
               +              Q    ++      +     + +  R++  +       +    
Sbjct: 1074 VNAVKVTFTITVICATTWQFIFIIIPLGVFYIYYQQYYLRTSRELRRLDSITRSPIYSHF 1133

Query: 359  EEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAV-----VNSKFSTSTSVIGDMS 413
            +E L G+ TV+ + ++QK     N    D      MSA       N   +    +IG + 
Sbjct: 1134 QETLGGLATVRGY-SQQKRFSHINQCRID----NNMSAFYPSINANRWLAYRLELIGSII 1188

Query: 414  FLVVLAYGSYLVLHGSLT---IGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLF 470
             L       + +  G+LT   +G   ++ L    T N I  ++      +  V   K   
Sbjct: 1189 ILGAATLSVFRLKQGTLTSGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYA 1248

Query: 471  DLTDRIPAI----RPTIGEKFIPGDGCIEFRNLGFAYPTRPE-NQVFKNLNFKIEPGTSV 525
            DL    P I    RP    K  P  G I F N    Y  RPE + V K +N  I+P   V
Sbjct: 1249 DLKSEAPLIIEGHRP---PKQWPAQGDIRFNNYSTRY--RPELDLVLKQINIHIKPNEKV 1303

Query: 526  CIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGS 585
             IVG +G GKS++ L L R    S G I+ID   I ++    LR  + I+ Q+  +  G+
Sbjct: 1304 GIVGRTGAGKSSLTLALFRMIEASEGNIVIDGVSINEIGLYDLRHKLSIIPQDSQVFEGT 1363

Query: 586  IRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIA 645
            +R+NI   + + +     R +       + ++   D  +  +   G+ LS GQ+Q + +A
Sbjct: 1364 VRENID-PINQYSDEAIWRALELSHLKEHVLSMSNDGLDAQLSEGGSNLSVGQRQLLCLA 1422

Query: 646  RALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIV 705
            RA++   KIL+LDEAT+A+DVE++  +  T     K +  TI++IAHRL+TI  S+ IIV
Sbjct: 1423 RAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDR--TILTIAHRLNTIMDSDRIIV 1480

Query: 706  LGNDGSVVE 714
            L N G V E
Sbjct: 1481 LDN-GKVAE 1488

 Score =  104 bits (259), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 193/410 (47%), Gaps = 48/410 (11%)

Query: 355 TRVSEEQLNGVKTVQSFVAEQ------KEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSV 408
           TRV  E LN +K+++ +  E+      +E+R  N  ++++  +G   AV + +F+    +
Sbjct: 485 TRVISEILNNIKSLKLYAWEKPYREKLEEVRN-NKELKNLTKLGCYMAVTSFQFNIVPFL 543

Query: 409 IGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKR 468
           +   +F  V  Y     L   L    LT F L + +    I  + N + E    +G    
Sbjct: 544 VSCCTF-AVFVYTEDRALTTDLVFPALTLFNLLS-FPLMIIPMVLNSFIEASVSIGRLFS 601

Query: 469 LF-------DLTDRIPAIRPTIGEKFIP-GDGCIEFRNLGFAYPTRPENQV-FKNLNFKI 519
            F       D   R+P +   IG+  I  GD      +  F +  +PE +V  KN++F+ 
Sbjct: 602 FFTNEELQPDSVQRLPNVE-NIGDIAINIGD------DATFLWQRKPEYKVALKNIDFQA 654

Query: 520 EPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP-KSLRQYMGIVQQE 578
             G   CIVG  G GK+ +   +L               D+ ++    ++   +  V Q 
Sbjct: 655 TKGNLTCIVGKVGSGKTALLSCML--------------GDLFRVKGFATVHGCIAYVSQV 700

Query: 579 PVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQ 638
           P +M+G++++NI +G K +A   E  +  K C     +    D  +T++G  G  LSGGQ
Sbjct: 701 PWIMNGTVKENILFGHKYDAEFYE--KTIKACALTIDLAILMDGDKTLVGEKGISLSGGQ 758

Query: 639 KQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFG--KLMKSKSVTIVSIAHRLS 695
           K R+++ARA+  +    +LD+  +A+D   +   I +  G   L+ +K+  + +  +++S
Sbjct: 759 KARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTRILAT--NKVS 816

Query: 696 TIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEA 745
            +  ++ I +L N G +++ G + ++  D  S L KLLN+   + N K++
Sbjct: 817 ALSIADSIALLDN-GEIIQQGAYSDITKDADSPLWKLLNDYGKKNNNKQS 865

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  138 bits (348), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 131/484 (27%), Positives = 217/484 (44%), Gaps = 29/484 (5%)

Query: 266  FFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIF 325
            FF+   +G +++R  +D Y V   L +  S  F  ++              Q   F+++ 
Sbjct: 1025 FFETTPIGRILNRFSNDIYKVDELLGRTFSQFFVNVVKVTFTIVVICTSTWQ---FILVV 1081

Query: 326  APAVVISASIFG---KKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYN 382
             P  V+         +  R++  +       +    +E L GV T++ +  +QK     N
Sbjct: 1082 LPLSVLYIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGVSTIRGY-GQQKRFAHIN 1140

Query: 383  NAIRDIYNIGKMSAVVNSK--FSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFML 440
             A  D  N+      VN+    +     +G +  L       + +  G+LT G +   + 
Sbjct: 1141 QARID-NNMSAFYPAVNANRWLAFRLEFLGSIIILGAATLSVFRLKQGTLTAGMIGLSLS 1199

Query: 441  YTDYTANSIFGLSNFYSEIMQGVGAAKRL---FDLTDRIPAI----RPTIGEKFIPGDGC 493
            Y      S+  +     E+   + + +R+    +L    PAI    RP  G    P  G 
Sbjct: 1200 YALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKPEAPAIIESSRPPKGW---PSQGD 1256

Query: 494  IEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQ 552
            I F +    Y  RPE Q + +++N  I+    V IVG +G GKS++ L L R    + G 
Sbjct: 1257 IRFEHYSTRY--RPELQLILRDVNLHIKAREKVGIVGRTGAGKSSLTLALFRIIEAAEGH 1314

Query: 553  ILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFC 612
            I ID      +    LR  + I+ Q+  + +G++R+N+      E T +EI    +    
Sbjct: 1315 IFIDGLSTDTIGLADLRHKLSIIPQDSQVFAGTLRENVDP--TEEFTDEEIWHALELSHL 1372

Query: 613  HNFITKF-PDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGA 671
               +     D  +T++   G+ LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++  
Sbjct: 1373 KEHVMSMGNDGLQTMLTECGSNLSVGQRQLLCLARALLIPSKILVLDEATAAVDVETDRV 1432

Query: 672  INYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSK 731
            I  T     K++  TI++IAHR++TI  S+ IIVL N+G V E    + L   P S    
Sbjct: 1433 IQETIRTAFKNR--TILTIAHRINTIMDSDKIIVL-NEGQVAEFDTPENLLQRPDSLFYS 1489

Query: 732  LLNE 735
            L  E
Sbjct: 1490 LCKE 1493

 Score =  103 bits (258), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 124/514 (24%), Positives = 230/514 (44%), Gaps = 68/514 (13%)

Query: 251 LRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQK----VSDGFKAILCXXX 306
           L S + KK+L    E    +  GD+++ +  D   + + LTQ      S  F+ ILC   
Sbjct: 372 LTSVIYKKSLVLSNEASGLSSTGDIVNLMSVDVQRL-QDLTQWGQIIWSGPFQIILCLIS 430

Query: 307 XXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVK 366
                    P +   ++I    + I+ SI  K  +++  I  +   + TRV  E LN +K
Sbjct: 431 LYSLLG---PCMWVGVIIMVVMIPIN-SIIMKYQKNLQKIQMKNKDERTRVISEILNNIK 486

Query: 367 TVQSFVAE---QKEIRRYNNAIRDIYNIGKMS---AVVNSKFSTSTSVIGDMSFLVVLAY 420
           +++ +  E   +K++    N  +++ N+ KM    A+ + +F+    ++   +F V +  
Sbjct: 487 SLKLYAWEVPYKKKLDYVRNE-KELKNLTKMGCTLALASFQFNIVPFLVSCSTFAVFVMT 545

Query: 421 GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLS---NFYSEIMQGVGAAKRLFDLTDRIP 477
                L   L    LT F L +       F L+   N  +  ++   +  RL        
Sbjct: 546 QKGRALTTDLVFPALTLFNLLS-------FPLAVVPNAITSFIEASVSVNRLHSFLTNEE 598

Query: 478 AIRPTIG-EKFIPGDGCIEFRNLG---FAYPTRPENQV-FKNLNFKIEPGTSVCIVGPSG 532
             + ++  E  +   G I  +  G   F +  +PE +V  KN+NF+ + G   CIVG  G
Sbjct: 599 LQKDSVSREPSVTSKGDIAVKVGGDATFLWQRKPEYKVALKNINFQAKKGELTCIVGRVG 658

Query: 533 RGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP-KSLRQYMGIVQQEPVLMSGSIRDNIT 591
            GKS +   +L               D+ ++    ++   +  V Q P +M+G++++NI 
Sbjct: 659 SGKSALIQSIL--------------GDLFRVKGFATIHGSVAYVSQIPWIMNGTVKENIL 704

Query: 592 YGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKK 651
           +G K +  P    +  K C  +  ++  P   +T++G  G  LSGGQK R+++ARA+  +
Sbjct: 705 FGHKYD--PSFYEKTVKACALNVDLSILPQGDQTLVGEKGISLSGGQKARLSLARAVYSR 762

Query: 652 PKILILDEATSALDVE-SEGAINYTFG---------KLMKSKSVTIVSIAHRLSTIRRSE 701
               +LD+  +A+D   ++  ++   G         K++ +  +T++SIA          
Sbjct: 763 ADTYLLDDPLAAVDEHVAKHLVDNVLGVTGLLHSKTKVLATNKITVLSIADS-------- 814

Query: 702 YIIVLGNDGSVVETGKFKELYADPTSELSKLLNE 735
             I L  +G +V+ G + E+  D  S LSKL++E
Sbjct: 815 --IALLENGEIVQQGSYDEVVRDDGSALSKLIHE 846

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  137 bits (344), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 129/481 (26%), Positives = 214/481 (44%), Gaps = 23/481 (4%)

Query: 266  FFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIF 325
            FF+   +G +++R  +D Y V   L +  S  F   +              Q    ++  
Sbjct: 1041 FFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVIFTITVICATTWQFIFIIIPL 1100

Query: 326  APAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAI 385
                +     + +  R++  +       +    +E L G+ TV+ + ++QK     N   
Sbjct: 1101 GVCYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGY-SQQKRFSHINQCR 1159

Query: 386  RDIYNIGKMSAV-----VNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFML 440
             D      MSA       N   +    +IG +  L       + +  G+LT G     + 
Sbjct: 1160 ID----NNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMAGISLS 1215

Query: 441  YTDYTANSIFGLSNFYSEIMQGVGAAKRL---FDLTDRIP-AIRPTIGEKFIPGDGCIEF 496
            Y      ++  +     E+   + + +R+    DL    P  I   +  K  P  G I+F
Sbjct: 1216 YALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLTIEGHMPPKEWPSQGDIKF 1275

Query: 497  RNLGFAYPTRPE-NQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILI 555
             N    Y  RPE + V K++N  I+P   + IVG +G GKS++ L L R    S+G I+I
Sbjct: 1276 NNYSTRY--RPELDLVLKHINIHIKPNEKIGIVGRTGAGKSSLTLALFRMIEASAGNIVI 1333

Query: 556  DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEI-REVSKQCFCHN 614
            D   I ++    LR  + I+ Q+  +  GS+R+NI      + T + I R +       +
Sbjct: 1334 DGIAINEIGLYDLRHRLSIIPQDSQVFEGSLRENI--DPTNQYTDEAIWRALELSHLKEH 1391

Query: 615  FITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINY 674
             ++   D  +  +   G  LS GQ+Q + +ARA++   KILILDEAT+A+DVE++  +  
Sbjct: 1392 VLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILILDEATAAVDVETDKVVQE 1451

Query: 675  TFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLN 734
            T     K +  TI++IAHRL+TI  S+ IIVL N G+V E     +L ++  S    L  
Sbjct: 1452 TIRTAFKDR--TILTIAHRLNTIMDSDRIIVLDN-GTVAEFDSPSQLLSNSESLFHSLCA 1508

Query: 735  E 735
            E
Sbjct: 1509 E 1509

 Score =  102 bits (253), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 107/413 (25%), Positives = 191/413 (46%), Gaps = 58/413 (14%)

Query: 355 TRVSEEQLNGVKTVQSFVAEQK-----EIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVI 409
           TRV  E LN +K+++ +  E+      E  R N  ++++  +G   AV + +F+    ++
Sbjct: 485 TRVISEILNNIKSLKLYAWEKPYREKLEDIRNNKELKNLTRLGCYMAVTSFQFNIVPFLV 544

Query: 410 GDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL 469
              +F  V  Y     L   L    LT F L + +    I  + N + E    +G   RL
Sbjct: 545 SCCTF-AVFVYTEDRALTTDLVFPALTLFNLLS-FPLMIIPMVLNSFIEASVSIG---RL 599

Query: 470 F----------DLTDRIPAIRPTIGEKFIPGDGCIEFRNLG----FAYPTRPENQV-FKN 514
           F          D   R+P +     E F  GD  I   N+G    F +  +PE +V  KN
Sbjct: 600 FTFFTNEELQPDSVQRLPKV-----ENF--GDVAI---NVGDDATFLWQRKPEYKVALKN 649

Query: 515 LNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP-KSLRQYMG 573
           +NF+ + G   C+VG  G GK+ +   +L               D+ ++    ++   + 
Sbjct: 650 INFQAKKGELTCVVGKVGSGKTALLSCML--------------GDLFRVKGFATVHGSVA 695

Query: 574 IVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTL 633
            V Q P +M+G++ +NI +G K +    E  +  K C     +    D  +T++G  G  
Sbjct: 696 YVSQVPWIMNGTVMENILFGHKYDVEFYE--KTIKACALTIDLAILMDGDKTLVGEKGIS 753

Query: 634 LSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFG--KLMKSKSVTIVSI 690
           LSGGQK R+++ARA+  +    +LD+  +A+D   +   I +  G   L+ +K+  + + 
Sbjct: 754 LSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTRLLAT- 812

Query: 691 AHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKK 743
            +++S +  ++ + +L N G +++ G + E+  D  S L KLLN+   + N K
Sbjct: 813 -NKVSALSIADSVALLDN-GEIIQKGTYDEITKDADSPLWKLLNDYGKKNNNK 863

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  137 bits (344), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 131/503 (26%), Positives = 220/503 (43%), Gaps = 47/503 (9%)

Query: 255  VIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXX 314
            ++   LH    FFD   +G +++R   D   V + LT  +   F  ++            
Sbjct: 1164 LLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCLVECVSTMLLIAFI 1223

Query: 315  XPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAE 374
             PQ     +       +    +    R++          + +   E L G+ T++++  E
Sbjct: 1224 TPQFLILAIFIGFLYYLVGYFYMAASRELKRFESVTKSPIYQHFSETLVGIVTIRAYGDE 1283

Query: 375  QKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GSLTIG 433
            ++ +    + I +           N   S    +IG    LVV   G +++L+  +L  G
Sbjct: 1284 KRFMLENLHKIDENNKPFFYLWAFNRWLSFRIDMIGS---LVVFGAGVFIILNIDNLDSG 1340

Query: 434  DLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLT--DRIPAIR-----PTIGEK 486
                 + Y      +   L  FY+++   + + +RL +    D+ P          +   
Sbjct: 1341 LAGISLTYAISFTEAALWLVRFYADVEMNMNSVERLKEYMEIDQEPYEEHLERSEVLAVD 1400

Query: 487  FIPGDGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRY 545
              P +G IE  NL   Y P  P  +V KN+ F +EP   V +VG +G GKSTI   L R+
Sbjct: 1401 NWPRNGKIEVNNLSLRYAPNLP--KVIKNVTFVVEPNCKVGVVGRTGAGKSTIITALFRF 1458

Query: 546  YNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT-YGLKREATPDEIR 604
             +  +G I ID+ DI  +N   LR+ + I+ Q+P L SG+IR N+  Y    E + D I 
Sbjct: 1459 LDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSGTIRSNLDPYN---EFSDDAIF 1515

Query: 605  EVSKQCFCHN------------------FITKFPDAYETIIGPHGTLLSGGQKQRIAIAR 646
            +  ++    N                   + KF +  +  I   G  LS GQ+Q + +AR
Sbjct: 1516 KALRRVNLINENESTGPASSETSPSSTENVNKFLNL-KNEITEGGNNLSHGQRQLVCLAR 1574

Query: 647  ALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVL 706
            +L++ PKI++LDEAT+++D  S+  I  T  K  K    TI++IAHRL ++   + I+V+
Sbjct: 1575 SLLRCPKIILLDEATASIDNASDAKIQETIRKEFKES--TILTIAHRLRSVCDYDKILVM 1632

Query: 707  GNDGSVVETGKFKELYADPTSEL 729
                   + G+ KE Y  P S L
Sbjct: 1633 -------DAGEVKE-YDHPYSLL 1647

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 87/293 (29%), Positives = 148/293 (50%), Gaps = 33/293 (11%)

Query: 452 LSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKF----IPGDGC-IEFRNLGFAYPTR 506
           LSN  S ++Q   +  R+ DL      ++    EK+    I  +G  I F+N   A+  +
Sbjct: 690 LSNMISFVIQSKVSLDRIQDL------LQEKETEKYSQLTIDKNGNRIAFQNATVAWDKK 743

Query: 507 PENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILI---DNQDIMKL 563
                 ++LN   +PG    ++GP+G GKS++ L LL   +  +G I++   D +D + +
Sbjct: 744 NSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHLENGNIIVPSLDPRDELVI 803

Query: 564 NPKSLRQYMGIVQQEPVLMSGSIRDNITYGL-KREATPDEIREVSKQCFCHNF-ITKFPD 621
           +   +   +    Q   L++ ++R+NI +     EA  + + E    C   +F I K  D
Sbjct: 804 DHDGMTNSIAYCSQGAWLLNDTVRNNILFNSPYNEARYNAVVEAC--CLKRDFEILKAGD 861

Query: 622 AYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTFGKL 679
             E  IG  G  LSGGQKQR+++ARAL    + ++LD+  SA+D  +   I  N   G L
Sbjct: 862 MTE--IGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVDSHTALWIYDNCITGPL 919

Query: 680 MKSKSVTIVSIAHRLS-TIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSK 731
           M++++  +VS  H ++ T+R +E +++L  DG V + G       DP + L K
Sbjct: 920 MENRTCILVS--HNIALTLRNAELVVIL-EDGRVKDQG-------DPVTILQK 962

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 143/538 (26%), Positives = 231/538 (42%), Gaps = 47/538 (8%)

Query: 218  FLGAFAGALVIGTMCNYGRYILLRLL-SERVVARLRSHVIKKTLHQDAEFFDQNKVGDLI 276
            F+G +    +     N  R I+L L+ S R   +L   +    L     FF+   VG +I
Sbjct: 1016 FVGIYVLISLGAAFFNSARSIVLLLVCSIRASRKLHDSMAVAVLRSPMSFFETTPVGRII 1075

Query: 277  SRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAP--AVVISAS 334
            +R  SD   V  ++   +S    +IL             P    FL++ A    + +   
Sbjct: 1076 NRFSSDMNSVDDNVQYVISFFLISILDYVVVVVIIGYQVPL---FLLVNAALLGIYLYYQ 1132

Query: 335  IFGKKI-RDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGK 393
            +F   + R++  ++  +   +  +  E L G   + +F        R+     D  NI  
Sbjct: 1133 VFYVTLSRELKRLMSTSFSPIMSMLSETLAGHMVINAF----NHFSRF-----DYLNIEA 1183

Query: 394  MSAVVNSKF---------STSTSVIGDMSFLVVLAYGSYLVLHG--SLTIGDLTAFMLYT 442
            +   +N  F         S     IG +  L   A  S     G  +L+ G +   M Y 
Sbjct: 1184 VQFNINCVFNFRSTNRWLSIRLESIGALMILTT-ALLSLATTTGDKALSTGMVGLLMSYA 1242

Query: 443  DYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIG----EKFIPGDGCIEFRN 498
                N +  +     ++   V + +R+ +  D  P   P I     EK  P  G + F++
Sbjct: 1243 LQVTNKLMWIVRMSVQLETNVVSVERIVEYCDLPPEAPPVIEDCRPEKNWPAQGHVVFKD 1302

Query: 499  LGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQ 558
                Y    +  V K LN +I P   + IVG +G GKST++L L R   P  G I+ID  
Sbjct: 1303 YSARYRENLD-PVLKKLNVEINPQEKIGIVGRTGAGKSTLSLALFRILEPCGGTIVIDGV 1361

Query: 559  DIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITK 618
            DI K+    LR ++ I+ Q+     GS+R N+      + + DEI    +       I K
Sbjct: 1362 DITKIGLADLRSHLSIIPQDAQAFEGSVRSNLDPF--EQYSDDEIWRALELSHLKPHILK 1419

Query: 619  FPDA---------YETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESE 669
              +           ET I  +G+ LS GQ+Q + ++RAL+ + +IL+LDEAT+A+D E++
Sbjct: 1420 MANEEGPEKTKNLLETKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSETD 1479

Query: 670  GAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTS 727
              I  T     K +  TI++IAHR+ T+  S+ I+VL + G V E      L AD  +
Sbjct: 1480 RLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DQGEVKEFDSPSNLLADKNT 1534

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 127/249 (51%), Gaps = 22/249 (8%)

Query: 512 FKNLN-FKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPK-SLR 569
            KN++ F+   G  VC+VG  G GKST    LL       GQ+   +    +  PK   R
Sbjct: 652 LKNIDGFQALKGQLVCVVGRVGAGKSTFLHALL-------GQLPCISSSHDQATPKMHFR 704

Query: 570 -QYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIG 628
              + +  Q+  +++ S++ N+ +G K +      +   + C     +    D  ET++G
Sbjct: 705 CDSVALCSQQAWILNASVKYNVLFGHKYDEA--SYKATIEACQLLPDLGILADGDETLVG 762

Query: 629 PHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGK---LMKSKS 684
             G  LSGGQK RI++ARA+  +  + +LD+  SA+D E  +  I++   +   L+K+K+
Sbjct: 763 EKGISLSGGQKARISLARAVYSRSDVYLLDDILSAVDAEVCKRIIDHVLSRKTGLLKNKT 822

Query: 685 VTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYA-DPTSELSKLLNE--KQSRAN 741
           V + +  + +S ++ S+ I  L N G +VE G F E+ + D  S+L  L+ E    S A 
Sbjct: 823 VILTT--NSISVLKHSQSIYALEN-GEIVERGSFDEIMSKDAESKLKTLIAEFGSDSSAV 879

Query: 742 KKEAPLPPQ 750
           K + P+P Q
Sbjct: 880 KDDEPIPEQ 888

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  135 bits (341), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 145/568 (25%), Positives = 245/568 (43%), Gaps = 32/568 (5%)

Query: 182  VIGLVLDALKNVMTDSPSSLETS--DLPPIAFGLTLYPFLG-AFAGALVIGTMCNYGRYI 238
            VI + L  + NV     S + +     P  A  L +Y  LG   A A +I T+      +
Sbjct: 960  VISMFLSVMGNVWLKHWSEVNSHYGANPHAARYLGIYFALGIGSALATLIQTI------V 1013

Query: 239  LLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGF 298
            L    +      L + +    L     FF+   +G +++R  +D Y V   L +  S  F
Sbjct: 1014 LWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFF 1073

Query: 299  KAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVS 358
               +              Q    +V      +     + +  R++  +       +    
Sbjct: 1074 VNAVKVTFTITVICVTTWQFIFIIVPLGVFYIYYQQYYLRTSRELRRLDSITRSPIYSHF 1133

Query: 359  EEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAV-----VNSKFSTSTSVIGDMS 413
            +E L G+ TV+ + ++QK     N    D      MSA       N   +    +IG + 
Sbjct: 1134 QETLGGLATVRGY-SQQKRFSHINQCRID----NNMSAFYPSVNANRWLAYRLELIGSVI 1188

Query: 414  FLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLT 473
             L       + +  G+LT G +   + Y      ++  +     E+   + + +R+ +  
Sbjct: 1189 ILGAATLSVFRLKQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYA 1248

Query: 474  DRIPAIRPTIGE-----KFIPGDGCIEFRNLGFAYPTRPE-NQVFKNLNFKIEPGTSVCI 527
            D I +  P + E     K  PG G I+F      Y  RPE + V K ++  I+P   + I
Sbjct: 1249 D-IKSEAPLVIEGHRPPKEWPGQGDIKFNQYSTRY--RPELDLVLKQIDIHIKPKEKIGI 1305

Query: 528  VGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIR 587
            VG +G GKS++ L L R    S+G I+ID   I ++    LR  + I+ Q+  +  G++R
Sbjct: 1306 VGRTGAGKSSLTLALFRIIEASAGNIVIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTVR 1365

Query: 588  DNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARA 647
            +NI   + +       R +       + ++   D  ++ +   G+ LS GQ+Q + +ARA
Sbjct: 1366 ENID-PINQYTDEAMWRALELSHLKEHILSMSNDGLDSQLTEGGSNLSVGQRQLLCLARA 1424

Query: 648  LIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLG 707
            ++ + KIL+LDEAT+A+DVE++  I  T     K +  TI++IAHRL+TI  S+ IIVL 
Sbjct: 1425 MLVQSKILVLDEATAAVDVETDKVIQETIRTAFKDR--TILTIAHRLNTIMDSDRIIVLD 1482

Query: 708  NDGSVVETGKFKELYADPTSELSKLLNE 735
            N G V E     +L  +  S    L  E
Sbjct: 1483 N-GKVAEFDSPAQLLTNTKSLFYSLCAE 1509

 Score =  100 bits (249), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 143/585 (24%), Positives = 247/585 (42%), Gaps = 86/585 (14%)

Query: 196 DSPSSLETSDLP----PIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVAR- 250
           D P SL   + P    PI  G     FL AFA  LV  T  +      L + +  +  + 
Sbjct: 326 DDPLSLGFGNKPDQKLPIIRG-----FLIAFAMFLVGFTQTSVLHQYFLNVFNTGMYVKS 380

Query: 251 -LRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKV----SDGFKAILCXX 305
            L + + +K+L    E    +  GD+++ +  D   + + LTQ +    S  F+ I+C  
Sbjct: 381 ALTALIYQKSLVLSNEASGLSSTGDIVNLMSVDVQKL-QDLTQWLNLIWSGPFQIIICLY 439

Query: 306 XXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGV 365
                           LVI  P      S   +  + +     +   + TRV  E LN +
Sbjct: 440 SLYKLLGNSMWVGVIILVIMMPL----NSFLMRIQKKLQKSQMKYKDERTRVISEILNNI 495

Query: 366 KTVQSFVAEQK-----EIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAY 420
           K+++ +  E+      E  R N  + ++  +G   AV + +F+    ++   +F  V  Y
Sbjct: 496 KSLKLYAWEKPYREKLEDVRNNKELNNLTKLGCYMAVTSFQFNIVPFLVSCCTF-AVFVY 554

Query: 421 GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLF-------DLT 473
                L   L    LT F L + +    I  + N + E    +G     F       D  
Sbjct: 555 TEDRALTTDLVFPALTLFNLLS-FPLMIIPMVLNSFIEASVSIGRLFSFFTNEELQPDSV 613

Query: 474 DRIPAIRPTIGEKFIPGDGCIEFRNLG----FAYPTRPENQV-FKNLNFKIEPGTSVCIV 528
            R+P +          GD  I   N+G    F +  +PE +V  KN+NF+ + G   C+V
Sbjct: 614 QRLPKVENV-------GDIAI---NIGDDATFLWQRKPEYKVALKNINFQAKKGELTCVV 663

Query: 529 GPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP-KSLRQYMGIVQQEPVLMSGSIR 587
           G  G GK+  ALL     + + G       D+ ++    S+   +  V Q P +M+G+++
Sbjct: 664 GKVGSGKT--ALL-----SSTLG-------DLFRVKGFASVHGSVAYVSQVPWIMNGTVK 709

Query: 588 DNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARA 647
           +NI +G K +A   E  +  K C     +    D  +T++G  G  LSGGQK R+++ARA
Sbjct: 710 ENILFGHKYDAEFYE--KTIKACALTIDLAILMDGDQTLVGEKGISLSGGQKARLSLARA 767

Query: 648 LIKKPKILILDEATSALD----------VESEGAINYTFGKLMKSKSVTIVSIAHRLSTI 697
           +  +    +LD+  +A+D          V     + +T  KL+ +  V+ +S+A      
Sbjct: 768 VYSRADTYLLDDPLAAVDEHVARHLVEHVLGSNGLLHTKTKLLATNKVSALSVADS---- 823

Query: 698 RRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANK 742
                 I L ++G +++ G + ++  D  S L KL+ +   + NK
Sbjct: 824 ------IALLDNGEIIQQGTYDDITKDADSPLWKLIKDYGKKNNK 862

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  135 bits (339), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 140/547 (25%), Positives = 245/547 (44%), Gaps = 50/547 (9%)

Query: 210  AFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQ 269
            +F + +Y F   F   L +       ++ LL  L  R    L    +++ LH    + D 
Sbjct: 898  SFYMGMYSFF-VFGAYLFMNL-----QFTLLCTLGLRASKWLNLKAVERILHTPMSYLDT 951

Query: 270  NKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLS---SFLVIFA 326
              +G +++R   D   +   LT+ +      +              P  +    FL+I  
Sbjct: 952  TPLGRILNRFTKDTDSLDNELTESIRLMLSQVGNLIGVIVMCIVYLPWFAIAVPFLLIIF 1011

Query: 327  PAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIR 386
              +       G++I+ +  + +     +     E L G+ T++++ ++++ + + +  I 
Sbjct: 1012 VLICDHYQSTGREIKRLEAVQRSF---VYNNFNEVLGGMDTIKAYGSQERFLAKTDYLIN 1068

Query: 387  DIYNIGKMSAVVNSKFST---STSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTD 443
             +   G +   V    +    S +V+  +   ++    ++ +  GS  +G L  ++L   
Sbjct: 1069 KMNEAGYLIVAVQRWVAILLDSVAVVFALIITLLCVTRAFPISAGS--VGVLLTYVLQLP 1126

Query: 444  YTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIP---AIR-PTIGE-KFIPGDGCIEFRN 498
               N+I       ++    + +A+RL      +P   A R P +   +  P  G I+F +
Sbjct: 1127 GLLNTIL---RALTQTENDMNSAERLVTYATELPLEAAYRKPEVSPPESWPEKGDIDFID 1183

Query: 499  LGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDN 557
            + FAY P  P   V KN+N KI  G  + I G +G GKSTI   L R    S G+I+ID 
Sbjct: 1184 VNFAYRPGLP--VVLKNMNLKINNGEKIGICGRTGAGKSTIMSALYRLNELSDGKIVIDG 1241

Query: 558  QDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNI-----------------TYGLKREATP 600
             DI K+    LR+ + I+ Q+PVL  G+IR N+                 T  ++RE   
Sbjct: 1242 VDIRKIGLYDLRKKLTIIPQDPVLFRGTIRKNLDPFKECSDDLLWDALIRTGVVERENLN 1301

Query: 601  DEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEA 660
            D   E   +   ++ + KF    + ++   G+  S G++Q +A+ RAL++  KILILDEA
Sbjct: 1302 DIKLEKPDENNSYSNMHKF--HLDELVEEEGSNFSLGERQMLALTRALVRNSKILILDEA 1359

Query: 661  TSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKE 720
            TS++D E++G I      + +    TI+ IAHRL TI   + I+VL   G + E  K  E
Sbjct: 1360 TSSVDYETDGKIQSRI--VSEFGDCTILCIAHRLKTILSYDKILVL-EKGVIAEYEKPWE 1416

Query: 721  LYADPTS 727
            L+ D  S
Sbjct: 1417 LFNDKNS 1423

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 114/230 (49%), Gaps = 22/230 (9%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           F +LN +I  G  + + GP G GK+++   +  +   +SG++ ++ + ++          
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGELLL---------- 630

Query: 572 MGIVQQEPVLMSGSIRDNITYGL-KREATPDEIREVSKQCFCHNFITKFPDAYETIIGPH 630
                  P +++ ++RDNI +G    EA  +EI EV   C     +   P    T IG  
Sbjct: 631 ----CGYPWILNATVRDNILFGSPYEEARYNEIVEV---CSLDADLKILPAGDRTEIGER 683

Query: 631 GTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGKLMKSKSVTIVS 689
           G  LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++     ++K K+  + +
Sbjct: 684 GITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGILKGKTRILAT 743

Query: 690 IAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSR 739
             H+LS I R++ IIV+G +GS  + G   EL     + +S L    Q++
Sbjct: 744 --HQLSVIERADRIIVVGPNGS-FDFGTLDELKGRNQTLVSLLQYSSQTK 790

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 137/542 (25%), Positives = 233/542 (42%), Gaps = 35/542 (6%)

Query: 213  LTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKV 272
            + +Y  +G  + A  I     +   I+L   S R    L   + K  +    +FF+   +
Sbjct: 1005 VAVYALIGLGSAAFNI-----FRTIIMLLYCSIRGSKTLHDSMAKAIIRSPVQFFETTPI 1059

Query: 273  GDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVIS 332
            G +I+R  SD   V  +L    S  F++IL             P    F  +        
Sbjct: 1060 GRVINRFSSDIDSVDVNLQNVFSIFFRSILDYILTVILVSVAMPWFLLFNALIMIIYFYY 1119

Query: 333  ASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIG 392
              ++  + R++  +   A   +  +  E L G   + ++     ++ ++ N  R  YN+ 
Sbjct: 1120 EKLYIVQSRELKRLTSIAYSPIISLMSETLGGQMVISAY--NHSKMFKFMNIERVQYNLN 1177

Query: 393  KMSAV--VNSKFSTSTSVIGDMSFLVVLAYG--SYLVLHGSLTIGD--LTAFMLYTDYTA 446
             +      N   S     IG     ++L  G  +   L  S  IG   +   M Y     
Sbjct: 1178 VLFTFRSTNRWLSIRLQSIGA---FIILCTGLLALTTLRTSSPIGSGLIGLLMSYVLQVT 1234

Query: 447  NSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIG----EKFIPGDGCIEFRNLGFA 502
            +++  +     +I   + + +R+ +     P     I     E+  P  G IEF+N    
Sbjct: 1235 SALTWIVRSTVQIETNIVSVERILEYCHLPPEAEDIIDSNRVERDWPQRGSIEFKNYTTT 1294

Query: 503  YPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMK 562
            Y     + V KN++  I P   V IVG +G GKST++L L R    + G I ID  DI +
Sbjct: 1295 YRANL-SPVLKNISVTINPSEKVGIVGRTGAGKSTLSLALFRILEAAEGTIFIDGVDISR 1353

Query: 563  LNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPD- 621
            +    LR  M I+ Q+     G++R N+    K   T  E+  V +       + +  + 
Sbjct: 1354 IGLTDLRGNMAIIPQDAQAFEGTVRSNLDPFQKH--TDVELWNVIELSHLKPHVLRMAED 1411

Query: 622  --------AYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAIN 673
                      +  I  +G+ LS GQ+Q + +ARAL+ + K+L+LDEAT+A+DVE++  I 
Sbjct: 1412 DNLSGNLSGLDAKINENGSNLSVGQRQLLCLARALLNQSKVLVLDEATAAVDVETDKIIQ 1471

Query: 674  YTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLL 733
             T     K +  TI++IAHRL TI  ++ I+VL + G V E    K L +D ++   +L 
Sbjct: 1472 ETIRTQFKDR--TILTIAHRLDTIMDNDKILVL-DAGGVKEFDSPKNLLSDESTLFYQLC 1528

Query: 734  NE 735
            ++
Sbjct: 1529 DK 1530

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 128/246 (52%), Gaps = 25/246 (10%)

Query: 512 FKNLN-FKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPK-SLR 569
            KN++ F   P +  C++G  G GK+T+   +L       GQ+   +     ++PK S+R
Sbjct: 641 LKNIDHFTASPKSLTCVIGKVGSGKTTLLKAIL-------GQLPCISGSKESISPKLSIR 693

Query: 570 -QYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIG 628
            + +    QE  +M+ +I++NI +G K + T   +   + +      I   PD  +T++G
Sbjct: 694 GESIAYCPQEAWIMNDTIKENILFGHKFDETYYTLTVAACELLADFDI--LPDGDQTLVG 751

Query: 629 PHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-----SEGAINYTFGKLMKSK 683
             G  LSGGQK R+++ARA+  +  I +LD+  SA+D        E  ++   G L+++K
Sbjct: 752 EKGISLSGGQKARVSLARAVYSRADIYLLDDILSAVDAGVSKKIVENVLDSNSG-LLRNK 810

Query: 684 SVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELY----ADPTSELSKLLNEKQSR 739
           +V + +  + +S ++ S+ I  L N G +VE G + ++     +D  S++S LL +    
Sbjct: 811 TVILST--NTVSVLKHSQLIYALEN-GIIVERGNYNDIIESANSDDESKISALLKQFDVS 867

Query: 740 ANKKEA 745
             K+E+
Sbjct: 868 LAKRES 873

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  134 bits (338), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 128/492 (26%), Positives = 213/492 (43%), Gaps = 35/492 (7%)

Query: 250  RLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXX 309
            ++ S ++ K LH +  FFD   +G +++R   D   V + L   +      I+       
Sbjct: 1139 KIFSLLLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLEAALYCIIDISSTIL 1198

Query: 310  XXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQ 369
                  P+     ++ A        ++    R++          + +   E L GV TV+
Sbjct: 1199 LITYITPEFLIIAILVAGLYYAIGVLYLAGSRELKRFDSITKSPIYQHFSETLVGVTTVR 1258

Query: 370  SFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGS 429
            ++  E + +R     I +         V N   +    V+G    LV+   G +++L+  
Sbjct: 1259 AYGDEARFMRENLKMIDENNKPFFYLWVSNRWLAFRIDVVGA---LVIFGSGVFVLLNID 1315

Query: 430  LTIGDLTAFML-YTDYTANSIFGLSNFYSEIMQGVGAAKRLFDL--TDRIPAIRPTIG-E 485
                 L    L +      S   L   YS +   + + +RL +    ++ P    ++   
Sbjct: 1316 KIDSGLAGISLSFAISFTESALWLVRHYSNLEMNMNSVERLMEYMEVEQEPYKSSSLDVP 1375

Query: 486  KFIPGDGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLR 544
               P +G IE  ++   Y P  P  +V KN  F ++P   V IVG +G GKSTI   L R
Sbjct: 1376 SSWPEEGKIEVNDVSLRYAPNLP--RVIKNATFTVDPKMKVGIVGRTGAGKSTIITALFR 1433

Query: 545  YYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDN-----------ITYG 593
            + +P +G I IDN DI  +  K LR+ + I+ Q+P L SG+I+ N           I   
Sbjct: 1434 FLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGTIKSNLDPYDEYSEKQIFEA 1493

Query: 594  LKREATPDEIREVS----KQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALI 649
            LKR     E    S    +Q        KF +     I   G+ LS GQ+Q + +AR+L+
Sbjct: 1494 LKRVNLVTEKELASGNSDQQSIASGNANKFLNVNNE-ISEGGSNLSQGQRQLVCLARSLL 1552

Query: 650  KKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGND 709
            + PK+++LDEAT+++D  S+  I  T          TI++IAHRL T+   + I+V+   
Sbjct: 1553 RCPKVILLDEATASIDYASDAKIQETIRNEFDDS--TILTIAHRLRTVIDYDKILVM--- 1607

Query: 710  GSVVETGKFKEL 721
                + G+ KE 
Sbjct: 1608 ----DAGEVKEF 1615

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 124/233 (53%), Gaps = 17/233 (7%)

Query: 494 IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI 553
           I F+N    +    ++   +N++   + G    I+GP+G GK+++ + LL   +   G+I
Sbjct: 703 IAFKNATTTWNKEKQDFKLRNIDIDFKIGKLNVIIGPTGSGKTSLLMALLGEMDLIDGEI 762

Query: 554 LI---DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKR-EATPDEIREVS-- 607
           ++   D ++ +KL+   L   +    Q   L++ ++R+NI +     E   + + E S  
Sbjct: 763 IVPCLDPREDLKLDANGLTNSIAYCSQAAWLLNDTVRNNILFNSPYCEERYNAVVEASGL 822

Query: 608 KQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE 667
           K+ F    I    D  E  IG  G  LSGGQKQR+++ARAL    K L+LD+  SA+D  
Sbjct: 823 KRDFE---ILNAGDMTE--IGERGITLSGGQKQRVSLARALYSNSKHLLLDDCLSAVDSH 877

Query: 668 SEGAI--NYTFGKLMKSKSVTIVSIAHRLS-TIRRSEYIIVLGNDGSVVETGK 717
           +   I  N   G LM++++  +VS  H ++ T+R ++Y++ L N G +VE G+
Sbjct: 878 TATWIYDNCISGPLMENRTCILVS--HNIALTLRNADYVVKLEN-GKIVEHGE 927

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 123/474 (25%), Positives = 210/474 (44%), Gaps = 21/474 (4%)

Query: 251  LRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXX 310
            L   ++   L     FF+   +G +++R  +D Y V   L +  S  F            
Sbjct: 1003 LHESMLAAVLRAPMSFFETTPIGRILNRFSNDIYKVDELLARTFSQFFANTTRVSFTIIV 1062

Query: 311  XXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQS 370
                  Q + F++  A   +     + K  R++  +       +    +E LNGV +++ 
Sbjct: 1063 ICVTTWQFTFFVIPLAMLYIYYQQYYLKTSRELRRLDSVTKSPVYAHFQETLNGVSSIRG 1122

Query: 371  FVAEQKEIR----RYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVL 426
            +    + I     R NN     Y     S  VN   +     IG            + + 
Sbjct: 1123 YGQLDRFIHINQARINNNTSAYYP----SMNVNRWLAYRLEFIGSCIIFFAATLSVFRLA 1178

Query: 427  HGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPA----IRPT 482
             GSLT G +   + Y      S+  +     E+   + + +R+ +  +  P     I  +
Sbjct: 1179 SGSLTSGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELEPEAPQFIANS 1238

Query: 483  IGEKFIPGDGCIEFRNLGFAYPTRPE-NQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALL 541
            +     P DG I+F N    Y  RP  + + + +N  I+P   V IVG +G GKS++AL 
Sbjct: 1239 VPSGDWPKDGEIKFENYSTRY--RPGLDLILRGINLHIKPHERVGIVGRTGAGKSSLALS 1296

Query: 542  LLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPD 601
            L R    + G I ID   I  +    LR+ + I+ Q+  +  G++RDNI     ++ T +
Sbjct: 1297 LFRIIEAAEGHISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRDNI--DPTKQYTDE 1354

Query: 602  EIREVSKQCFCHNFITKF-PDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEA 660
            +I +  +     + +     D  +T +   G  LS GQ+Q + +ARAL+   +IL+LDEA
Sbjct: 1355 QIWKALELSHLADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARALLIPFRILVLDEA 1414

Query: 661  TSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
            T+A+DVE++  I  T       +  TI++IAHR++TI  S+ I+VL + G+V E
Sbjct: 1415 TAAIDVETDKVIQDTIRSSFNDR--TILTIAHRINTIMDSDKIVVL-DKGTVAE 1465

 Score =  113 bits (283), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 122/519 (23%), Positives = 227/519 (43%), Gaps = 70/519 (13%)

Query: 253 SHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQK----VSDGFKAILCXXXXX 308
           S + KK LH   E    +  GD+++ +  DA  + R LTQ      S  F+  LC     
Sbjct: 364 SLIYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDLTQWGNVIWSGPFQLCLC----- 417

Query: 309 XXXXXXXPQLSSFLVIFAPAVVISA----------SIFGKKIRDISTILQEATGQLTRVS 358
                    L S   +  P + +            S   + ++ +     +   + TR+ 
Sbjct: 418 ---------LYSLHRLLGPCIWVGVVLLLFTLPLNSYISRVLKRLQKEQMKNKDERTRLI 468

Query: 359 EEQLNGVKTVQSFVAE-----QKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMS 413
            E LN +K+++ +  E     + +  R    ++ +  +G  +A  N +++    ++   +
Sbjct: 469 SEILNNIKSLKLYAWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQYNIIPFLVSCST 528

Query: 414 FLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYS------EIMQGVGAAK 467
           F V +       L   L    LT F L +   A     +++F         +   + A +
Sbjct: 529 FAVFVLTQKGRPLTTDLVFPALTLFNLLSFPLAVLPIAITSFIEASVAIGRLTNFLTAEE 588

Query: 468 RLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQV-FKNLNFKIEPGTSVC 526
              D   R PA++   G      D      N  F +  +PE +V  KN+NF+ +     C
Sbjct: 589 LQRDAITREPAVKAPGGVAVALAD------NATFLWQRKPEYKVALKNINFRAKKSELTC 642

Query: 527 IVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSL-RQYMGIVQQEPVLMSGS 585
           I+G  G GKS +   +L               D+ ++N  ++ R  +  V Q   +M+G+
Sbjct: 643 IIGKVGSGKSALIQAML--------------GDLFRVNGSAVVRGNVAYVSQVAWIMNGT 688

Query: 586 IRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIA 645
           +RDNI +G K +A     ++  K C     ++  PD   T +G  G  LSGGQK R+++A
Sbjct: 689 VRDNILFGHKYDA--KFYQQTIKACALTVDLSILPDGDNTFVGEKGISLSGGQKARLSLA 746

Query: 646 RALIKKPKILILDEATSALDVE-SEGAINYTFG--KLMKSKSVTIVSIAHRLSTIRRSEY 702
           RA+  +    +LD+  +A+D   ++  +   FG   L+KSK+  + +  ++++ +  +++
Sbjct: 747 RAVYARADTYLLDDPLAAVDEHVAKHLLQNVFGPNGLLKSKARVLTT--NKITALEIADH 804

Query: 703 IIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRAN 741
           I++L N G +V+ G F E+ +D  S +SKL+     + N
Sbjct: 805 IVLLEN-GEIVQQGTFSEVISDEDSAISKLVLHHGKKQN 842

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 139/536 (25%), Positives = 241/536 (44%), Gaps = 50/536 (9%)

Query: 208  PIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFF 267
            P +F + LY F   FA  + +      G+Y +L ++       L    +K+ LH    + 
Sbjct: 930  PPSFYMGLYSFF-VFAAFIFMN-----GQYTILCVMGIMASKWLNLKAVKRILHTPMSYI 983

Query: 268  DQNKVGDLISRLGSDAYVVSRSLTQKV---SDGFKAILCXXXXXXXXXXXXPQLSSFLVI 324
            D   +G +++R   D   +   LT+ +   +  F  I+                  FL++
Sbjct: 984  DTTPLGRILNRFTKDTDSLDNELTESLRLLTSQFANIVGVCVMCIVYLPWFAIAIPFLLV 1043

Query: 325  FAPAVVISASIFGKKIRDISTILQE-ATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNN 383
                +       G++I+ +  + +      L  V    L G+ T++++ ++++ + + + 
Sbjct: 1044 IFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEV----LGGMDTIKAYRSQERFLAKSDF 1099

Query: 384  AIRDIYNIGKMSAVVNSKFSTSTSVIGDM-SFLVVLAYGSYLVLHGSLTIGDLTAFMLYT 442
             I  +   G +  V+         ++  + + +V L   +      + ++G L  ++L  
Sbjct: 1100 LINKMNEAGYLVVVLQRWVGVFLDMVAIVFALIVTLLCVTRAFPISAASVGVLLTYVLQL 1159

Query: 443  DYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAI----RPTIGE-KFIPGDGCIEFR 497
                N+I       ++    + +A+RL      +P      +P +   +  P  G I   
Sbjct: 1160 PGLLNTIL---RAMTQTENDMNSAERLVSYATELPLEADYRKPEMTPPESWPSKGEIVLE 1216

Query: 498  NLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILID 556
            N+ F+Y P  P   V KNLN  IE G  + I G +G GKSTI   L R    S+G+ILID
Sbjct: 1217 NVCFSYRPGLP--VVLKNLNLNIESGEKIGICGRTGAGKSTIMSALYRLNELSAGKILID 1274

Query: 557  NQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIRE-------VSKQ 609
            + DI KL    LR+ + I+ Q+PVL  G+IR N+    +R  T DE+ +       ++K 
Sbjct: 1275 DVDISKLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFDER--TDDELWDALVRGGAIAKN 1332

Query: 610  CFCHNFITKFPDAYET-----------IIGPHGTLLSGGQKQRIAIARALIKKPKILILD 658
                  + K PD   T            +   G+  S G++Q +A+ RAL+++ KILILD
Sbjct: 1333 DLSEAKLQK-PDKNGTHGRMHKFHLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILD 1391

Query: 659  EATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
            EATS++D E++G I      + +    TI+ IAHRL TI   + I+VL   G V E
Sbjct: 1392 EATSSVDYETDGKIQARI--VEEFGDCTILCIAHRLQTIVNYDRILVL-EKGEVAE 1444

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 121/240 (50%), Gaps = 22/240 (9%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           FK+LNF+I+ G  + I GP G GKS++   +      + G+I ++   +M   P      
Sbjct: 604 FKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNGDLLMCGYP------ 657

Query: 572 MGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHG 631
              +Q  PV      RDNI +G       ++  EV + C     +   P    T IG  G
Sbjct: 658 --WIQNAPV------RDNIIFG--SPFIKEKYNEVIRVCSLKADLDILPAGDMTEIGERG 707

Query: 632 TLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGKLMKSKSVTIVSI 690
             LSGGQK RI +AR++ K+ +I + D+  SA+D    +  ++     ++ +K+  + + 
Sbjct: 708 ITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILAT- 766

Query: 691 AHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEAPLPPQ 750
            H+LS I R+  +IVLG DG  V+ G   EL A   + L KLL +  S+ +K+E  +P +
Sbjct: 767 -HQLSLIERASRVIVLGTDGQ-VDIGTVDELKARNQT-LIKLL-QFSSQNSKEEEDVPEE 822

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  134 bits (336), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 144/539 (26%), Positives = 241/539 (44%), Gaps = 35/539 (6%)

Query: 215  LYPFLGAFAGALVIGTMCNYGRYILLRL-LSERVVARLRSHVIKKTLHQDAEFFDQNKVG 273
            ++ F+G ++   V     N  R I++ L  S R   +L   + K  +     FF+   VG
Sbjct: 1017 VWMFVGVYSLIGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVG 1076

Query: 274  DLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISA 333
             +I+R  SD   V  +L    S  FK+IL             P    F +      +   
Sbjct: 1077 RIINRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLVVIYIYYQ 1136

Query: 334  SIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGK 393
            + +    R++  ++  +   +  +  E LNG   + ++   ++ I  Y N  +  YN+  
Sbjct: 1137 TFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFI--YLNYEKIQYNVDF 1194

Query: 394  MSAV--VNSKFSTSTSVIGDMSFLV--VLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSI 449
            +      N   S     IG    L   +LA  + +     L+ G +   M Y+     S+
Sbjct: 1195 VFNFRSTNRWLSVRLQTIGATIVLATAILALAT-MNTKRQLSSGMVGLLMSYSLEVTGSL 1253

Query: 450  FGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKF----IPGDGCIEFRNLGFAYPT 505
              +      I   + + +R+ +  +  P  +    EK      P  G IEF+N    Y  
Sbjct: 1254 TWIVRTTVTIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFKNYSTKYRE 1313

Query: 506  RPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP 565
              +  V  N+N KIEP   V IVG +G GKST++L L R   P+ G+I+ID  DI  +  
Sbjct: 1314 NLD-PVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIGL 1372

Query: 566  KSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKF------ 619
              LR ++ I+ Q+     G+++ N+     R  + DE++   +Q      + K       
Sbjct: 1373 FDLRSHLAIIPQDAQAFEGTVKTNLD-PFNR-YSEDELKRAVEQAHLKPHLEKMLHSKPR 1430

Query: 620  -----------PDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
                        D  +  I  +G+ LS GQ+Q + +ARAL+ + KIL+LDEAT+++D+E+
Sbjct: 1431 GDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDMET 1490

Query: 669  EGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTS 727
            +  I  T  +  K +  TI++IAHR+ T+  S+ IIVL + GSV E     +L +D TS
Sbjct: 1491 DKIIQDTIRREFKDR--TILTIAHRIDTVLDSDKIIVL-DQGSVREFDSPSKLLSDKTS 1546

 Score =  105 bits (261), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 126/470 (26%), Positives = 212/470 (45%), Gaps = 85/470 (18%)

Query: 322 LVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRY 381
           LV  A  + I+A    +K++ +S    +      +   E LN +K+++ +  E+  + R 
Sbjct: 440 LVTMAIMMPINA-FLSRKVKKLSKTQMKYKDMRIKTITELLNAIKSIKLYAWEEPMMARL 498

Query: 382 NNAIRD--IYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFM 439
           N+   D  + N  K               IG +S L+  A+    ++    T G    F 
Sbjct: 499 NHVRNDMELKNFRK---------------IGIVSNLIYFAWNCVPLMVTCSTFG---LFS 540

Query: 440 LYTD--------YTANSIFGLSN--FYS------EIMQGVGAAKRL--FDLTDRI----- 476
           L++D        + + S+F + N   YS       I++   + +RL  F L+D I     
Sbjct: 541 LFSDSPLSPAIVFPSLSLFNILNSAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFI 600

Query: 477 PAIRPTIGEKFIPGDGCIEFRNLGFAYPTRP--------------------ENQV-FKNL 515
             I P+  E+ +P    IE  N+ F + ++                      +Q+  KN+
Sbjct: 601 ERIDPSADERALPA---IEMNNITFLWKSKEVLTSSQSGDNLRTDEESIIGSSQIALKNI 657

Query: 516 N-FKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGI 574
           + F+ + G  VC+VG  G GKST    +L       GQ+   +     + PK + +   +
Sbjct: 658 DHFEAKRGDLVCVVGRVGAGKSTFLKAIL-------GQLPCMSGSRDSIPPKLIIRSSSV 710

Query: 575 V--QQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGT 632
               QE  +M+ S+R+NI +G K +   D      K C     +   PD  ET++G  G 
Sbjct: 711 AYCSQESWIMNASVRENILFGHKFDQ--DYYDLTIKACQLLPDLKILPDGDETLVGEKGI 768

Query: 633 LLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTF-GKLMKSKSVTIVSI 690
            LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I Y   GK    K+ TI+  
Sbjct: 769 SLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILT 828

Query: 691 AHRLSTIRRSEYIIVLGNDGSVVETGKFKELY--ADPTSELSKLLNEKQS 738
            + +S ++ S+ I  L N G +VE G ++++    + TS+L KLL E  S
Sbjct: 829 TNTVSILKHSQMIYALEN-GEIVEQGNYEDVMNRKNNTSKLKKLLEEFDS 877

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  133 bits (335), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 121/394 (30%), Positives = 193/394 (48%), Gaps = 35/394 (8%)

Query: 359  EEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAV-----VNSKFSTSTSVIGDMS 413
            +E L G+ T++ +  +QK     N A  D      MSA       N   +     IG + 
Sbjct: 1119 QETLGGISTIRGY-NQQKRFVHINQARVD----NNMSAYYPSVNANRWLAFRLEFIGSV- 1172

Query: 414  FLVVLAYGSYLVL---HGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL- 469
              ++LA  S  VL    G+LT G +   + Y      S+  +     E+   + + +R+ 
Sbjct: 1173 --IILAASSLSVLRLKQGALTPGMIGLSVSYALQITQSLNWIVRMTVEVETNIVSVERIK 1230

Query: 470  --FDLTDRIPAI----RPTIGEKFIPGDGCIEFRNLGFAYPTRPENQV-FKNLNFKIEPG 522
               +L    PA+    RP+  E + P  G I+F N    Y  RPE ++  K++N  I+P 
Sbjct: 1231 EYANLESEAPAVIESNRPS--EDW-PSQGSIKFENYSARY--RPELELSLKDINLDIKPQ 1285

Query: 523  TSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLM 582
              + IVG +G GKS++ L L R    +SG+I ID   I  +  + LR ++ I+ Q+  L 
Sbjct: 1286 ERIGIVGRTGAGKSSLTLALFRIIEAASGRIYIDGLPIDSIGLRDLRHHLSIIPQDSQLF 1345

Query: 583  SGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKF-PDAYETIIGPHGTLLSGGQKQR 641
             G+IR+NI      E T ++I    +     + +     +  +  +   G+ LS GQ+Q 
Sbjct: 1346 EGTIRENI--DPTNEYTDEQIWRALELSHLKDHVKGLGKEELDAPLTEGGSNLSVGQRQL 1403

Query: 642  IAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSE 701
            + +ARAL+   KIL+LDEAT+A+DVE++  I  T     K++  TI++IAHR++TI  S+
Sbjct: 1404 MCLARALLIPSKILVLDEATAAVDVETDQVIQETIRTAFKNR--TILTIAHRINTILDSD 1461

Query: 702  YIIVLGNDGSVVETGKFKELYADPTSELSKLLNE 735
             I+VL + G V E      L  +P S    L  E
Sbjct: 1462 RILVL-DSGKVAEFDTPDNLLKNPESLFYSLCYE 1494

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 124/239 (51%), Gaps = 24/239 (10%)

Query: 501 FAYPTRPENQV-FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQD 559
           F +  +PE +V  KN+NF  + G   C+VG  G GKS +   +L               D
Sbjct: 624 FLWQRKPEYKVALKNINFAAKKGKLTCVVGKVGSGKSALIQAIL--------------GD 669

Query: 560 IMKLNP-KSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITK 618
           + ++    S+   +  V Q P +M+G+++DNI +G K + +   +    K C     +  
Sbjct: 670 LFRVKGFASVHGSIAYVSQVPWIMNGTVKDNILFGHKYDESFYTM--TLKACALIVDLAV 727

Query: 619 FPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFG 677
            P   +T++G  G  LSGGQK R+++ARA+  +    +LD+  +A+D   ++  + +  G
Sbjct: 728 LPKGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVTKHLVEHVLG 787

Query: 678 --KLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLN 734
              L+ SK  T V   ++++ +  +++I +L N G +++ G + ++ +  +S LSK+++
Sbjct: 788 PNGLLASK--TKVLATNKITVLSIADHIALLEN-GEIIQQGSYDDVTSAKSSALSKIIS 843

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  132 bits (333), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 144/554 (25%), Positives = 241/554 (43%), Gaps = 50/554 (9%)

Query: 209  IAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFD 268
            + F + +Y F+   A  L      N    +LL + S +   +L   +    +     FF+
Sbjct: 1004 VLFYVGIYVFISLSAALL-----SNARTIVLLLVCSIKASRKLHDTMALAVIRSPMSFFE 1058

Query: 269  QNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPA 328
               VG +I+R  SD   +  S+   +S    +IL             P    FL++ A  
Sbjct: 1059 TTPVGRIINRFSSDMNSLDDSVQYVMSFFLVSILDYLVVVIIIGYQVPL---FLIVNAVL 1115

Query: 329  VVISASIFGKKI------RDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYN 382
            +VI    F  ++      R++  ++  +   +  +  E L G   + +F     +   Y 
Sbjct: 1116 LVI---YFYYQVYYVTLSRELKRLMSTSFSPIMSMLSETLAGHMIIDAF--RHSDRFDYL 1170

Query: 383  NAIRDIYNIGKMSAV--VNSKFSTSTSVIGDMSFLVVLAYGSYLVLHG--SLTIGDLTAF 438
            N     +NI  +      N   S     IG +  L   A  S    +G  +L+ G +   
Sbjct: 1171 NVENVQFNINCLFNFRSTNRWLSIRLESIGALMILTT-ALLSLATKNGGHALSTGMVGLL 1229

Query: 439  MLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGE----KFIPGDGCI 494
            M Y     N +  +     ++   + + +R+ +  D  P   P I +    K  P  G I
Sbjct: 1230 MSYALQVTNKLMWIVRMSVQLETNIVSVERIVEYCDLPPEAPPVIEDSRPPKNWPSQGLI 1289

Query: 495  EFRNLGFAYPTRPE---NQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSG 551
             F+N    Y TR     + V ++L+ +I+P   + IVG +G GKST++L L R   PS G
Sbjct: 1290 RFKN----YSTRYRANLDPVLRHLDLEIKPQEKIGIVGRTGAGKSTLSLALFRILEPSEG 1345

Query: 552  QILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCF 611
             I ID  DI K+  K LR  + I+ Q+     G++R N+      + + +EI +  +   
Sbjct: 1346 TIDIDGVDISKIGLKDLRSNLSIIPQDAQAFEGTVRTNLDPF--EQYSDEEIWKALELSH 1403

Query: 612  CHNFITKFP----------DAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEAT 661
                I K            D  +T I  +G+ LS GQ+Q + ++RAL+ + +IL+LDEAT
Sbjct: 1404 LKPHILKMAKDDADPEKKEDLLQTKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEAT 1463

Query: 662  SALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
            +A+D E++  I  T     K +  TI++IAHR+ T+  S+ I+VL + G V E      L
Sbjct: 1464 AAVDSETDRLIQETIRAEFKDR--TILTIAHRIDTVMDSDKIMVL-DKGEVKEFDSPSNL 1520

Query: 722  YADPTSELSKLLNE 735
             A   S    L ++
Sbjct: 1521 LAQKDSIFYNLCDQ 1534

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 122/444 (27%), Positives = 201/444 (45%), Gaps = 55/444 (12%)

Query: 334 SIFGKKIRDISTILQEATGQLTRVSE--EQLNGVKTVQSFVAEQKEIRRYNNAIRDI--Y 389
           S   +K++ +  I Q+ T +  R+    E LN VKTV+ +  E+  ++R ++   D+   
Sbjct: 446 SYLSRKVKTL--IQQQMTYKDARIKTITELLNSVKTVKLYAWEEPMLKRLDHVRNDLELQ 503

Query: 390 NIGKMSAVVNSKFSTSTSV---IGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTA 446
           N  K+S + N        V   +   +FL+  A    + L   +    L+ F +  D   
Sbjct: 504 NFKKISIITNLILFAWNCVPILVASSTFLIY-ALTMDVPLTPQIVFPSLSLFDILNDCIY 562

Query: 447 NSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDG---CIEFRNLGF-- 501
                ++NF   I  GV    RL D        +  I  + +P DG    IE  N  F  
Sbjct: 563 TIPRTITNF---IETGVSLG-RLKDFLLAKEIDKSFIEFESLPSDGKVPVIEVHNATFLR 618

Query: 502 ----------AYPTRP---ENQV-FKNLN-FKIEPGTSVCIVGPSGRGKSTIALLLLRYY 546
                     +Y        +QV  KN++ F++  G  VC+VG  G GKST    LL   
Sbjct: 619 KIPNDSTDDESYDEEAAVESSQVALKNIDGFQVFKGQLVCVVGRVGAGKSTFLQALL--- 675

Query: 547 NPSSGQI-LIDNQDIMKLNPKSLR-QYMGIVQQEPVLMSGSIRDNITYGLK-REATPDEI 603
               GQ+  I N           R   + +  Q+  +M+ S++DN+ +G +  EAT    
Sbjct: 676 ----GQLPCISNSPSHASPTVHFRANSVALCSQQSWIMNASVKDNVLFGHRFDEATYKAT 731

Query: 604 REVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSA 663
            E    C     +    D  ET++G  G  LSGGQK R+++ARA+  +  + +LD+  SA
Sbjct: 732 LEA---CQLVPDLEILADGDETLVGEKGISLSGGQKARLSLARAVYSRSDVYLLDDILSA 788

Query: 664 LDVE-SEGAINYTFGK---LMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFK 719
           +D E  +  I     K   L+K+K+V + +  + +S ++ S+ I  L  DG +VE+G F 
Sbjct: 789 VDAEVCKRIIEQVLSKKTGLLKNKTVILTT--NSISVLKHSQSIYAL-EDGEIVESGSFN 845

Query: 720 ELY-ADPTSELSKLLNEKQSRANK 742
           ++   D +S+L +L+ E +S   K
Sbjct: 846 DIMRRDDSSKLKRLIVECESENTK 869

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  132 bits (333), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 134/532 (25%), Positives = 232/532 (43%), Gaps = 50/532 (9%)

Query: 215  LYPFLGAFAGALVIGTMCNYGRYILLRLLSE-RVVARLRSHVIKKTLHQDAEFFDQNKVG 273
            L+ F+G +A   +     +  R +++ L S  R    L + +    L     FF+   +G
Sbjct: 1025 LWKFVGIYALLGISSAAFDNIRAVIILLYSSIRGSKVLHNKMAVSVLKSPMGFFESTPIG 1084

Query: 274  DLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISA 333
             +I+R  SD   V R+L    +  FK +L             P    F        V   
Sbjct: 1085 RIINRFSSDMSTVDRNLKYNFAFFFKCVLDYFVTILLIGYNMPWFLVFNAGLLVVYVYYQ 1144

Query: 334  SIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGK 393
              +    R++  +   A   +  +  E L G   + +F    +   R++       N  K
Sbjct: 1145 VFYVTLSRELKRLSSTAFSPIMSLFSETLGGHMVITAF----RHSERFH-----FLNFNK 1195

Query: 394  MSAVVNSKFSTSTS----------VIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTD 443
                ++++F+  ++          + G M  +  L   + +     +T G +   M Y  
Sbjct: 1196 TQFQIDAQFNLRSTNRWLSIRLQIIGGAMVLITALLTLATIGTKKQMTAGLVGLLMSYVL 1255

Query: 444  YTANSIFGLSNFYSEIMQGVGAAKRLFD---LTDRIPAI----RPTIGEKFIPGDGCIEF 496
               NS+  +    + I   + + +R+++   L    PAI    RP   EK  P  G I F
Sbjct: 1256 QVTNSLMWIVRMTTMIETNIISVERIYEYCQLPSEAPAIIESSRP---EKSWPSMGEIIF 1312

Query: 497  RNLGFAYPTRPE-NQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILI 555
            ++    Y  RPE + V K +N  I+P   + +VG +G GKS+++L L R    + G I I
Sbjct: 1313 KDYSTKY--RPELDPVLKKINLSIKPREKIGVVGRTGAGKSSLSLALFRLLESTGGSIEI 1370

Query: 556  DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNI----TYGLKREATPDEIREVSKQCF 611
            D  DI K+    LR ++ I+ Q+     G++R N+     Y ++      E+  + K   
Sbjct: 1371 DGVDISKIGLYDLRSHLSIIPQDAQAFEGTVRSNLDPFNQYSVQEIWKAVELAHL-KPHI 1429

Query: 612  CHNFITKFPD---------AYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATS 662
                  + PD         A +  I  +G  +S GQ+Q + ++RAL+ K K+L+LDEAT+
Sbjct: 1430 IKMMTDEDPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSRALLSKSKVLVLDEATA 1489

Query: 663  ALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
            A+D+E++  I  T     + K  TI++IAHR+ T+  S+ I+VL + G V E
Sbjct: 1490 AVDMETDQIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVL-DKGEVKE 1538

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 104/420 (24%), Positives = 191/420 (45%), Gaps = 68/420 (16%)

Query: 356 RVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRD--IYNIGKMSAVVNSKFSTSTSVIGDM- 412
           R + E LN +K+++ +  E+  ++R N+   D  I N  KM  VV +  + + + +  M 
Sbjct: 484 RATTEILNSMKSIKLYAWEKPMLQRLNHVRNDLEIKNFAKM-GVVETLITFAWNCVPLMV 542

Query: 413 --SFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKR-- 468
             S  ++ +  S   L   +    L+ F +  D    +I+ + N  ++I++   +  R  
Sbjct: 543 SCSTFLLFSLISSSPLSPEIVFPALSLFEILND----AIYSVPNAITDIIETKVSMGRVR 598

Query: 469 ------------LFDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRP--------- 507
                       + +L D +   +PTI           E  N  F + +           
Sbjct: 599 TFLQTENLDDSFIHELKDEVDGPKPTI-----------EVNNATFLWQSEKTLKSNDEEA 647

Query: 508 ---ENQV-FKNLN-FKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMK 562
               +QV  +N++ F+ + G   C+VG  G GKST+   +L       GQ+   +     
Sbjct: 648 NVGSSQVALENIDHFEAKKGALTCVVGRVGSGKSTLLRAIL-------GQLPCRSGPKEF 700

Query: 563 LNPKSLRQYMGIVQ--QEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFP 620
           ++P+ L +   +    Q P +M+ SI+DNI +G + + T   +    K C     +    
Sbjct: 701 ISPEILVRARSVAYCPQAPWVMNASIKDNILFGHRYDETYYNL--TIKACQLIPDLKILS 758

Query: 621 DAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGK- 678
           +  ET++G  G  LSGGQK R+++ARA+  +  + ++D+  SA+D E S+  I+   G+ 
Sbjct: 759 EGDETLVGEKGISLSGGQKARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEE 818

Query: 679 --LMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYA-DPTSELSKLLNE 735
             L+K K  TI+   + +S ++ S  I  L   G +VE G +++  +    S L KL+ E
Sbjct: 819 NGLLKHK--TIILTTNAVSVLKHSNMIYAL-QGGRIVEEGTYEQAVSRGDDSVLQKLIKE 875

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 121/463 (26%), Positives = 210/463 (45%), Gaps = 29/463 (6%)

Query: 266  FFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIF 325
            FF+   +G +++R  +D Y V   L +  S  F   +              Q    ++  
Sbjct: 1020 FFETTPIGRVLNRFSNDIYKVDELLGRTFSQFFVNAVKVSFTIIVICSSTWQFVFVIIPL 1079

Query: 326  APAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAI 385
                +     + +  R++  +       +    +E L G+ T++ +  +Q      N A 
Sbjct: 1080 GTLYIYYQQYYLRTSRELRRLDSVTRSPIYAHFQETLGGISTIRGY-QQQGRFLHINQAR 1138

Query: 386  RDIYNIGKMSAV-----VNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFML 440
             D      MSA       N   +     IG +  L       + +  G+LT G +   + 
Sbjct: 1139 VD----NNMSAFYPSVNANRWLAFRLEFIGSIIILGAATLSVFRLKQGALTPGMIGLSVS 1194

Query: 441  YTDYTANSIFGLSNFYSEIMQGVGAAKRL---FDLTDRIPAI----RPTIGEKFIPGDGC 493
            Y      S+  +     E+   + + +R+    ++T   PA+    RP   E + P  G 
Sbjct: 1195 YALQITQSLNWIVRMTVEVETNIVSVERIKEYANITPEAPAVIESNRP--AEDW-PTHGA 1251

Query: 494  IEFRNLGFAYPTRPE-NQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQ 552
            I+F N    Y  RPE +   +N+N  I+P   + IVG +G GKS++ L L R    + G+
Sbjct: 1252 IKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRIIEAAEGR 1309

Query: 553  ILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFC 612
            I+ID      +  + LR ++ I+ Q+  +  G++R+NI      E T +EI    +    
Sbjct: 1310 IIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENID--PTNEYTDEEIWHALELAHL 1367

Query: 613  HNFITKF-PDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGA 671
             + I     D  E+++   G  LS GQ+Q + +ARAL+   +IL+LDEAT+A+DVE++  
Sbjct: 1368 KDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAVDVETDQV 1427

Query: 672  INYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
            I  T     K++  TI++IAHR++TI  S+ I+VL + G + E
Sbjct: 1428 IQETIRTAFKNR--TILTIAHRINTILDSDRILVL-DSGKIAE 1467

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 128/527 (24%), Positives = 240/527 (45%), Gaps = 69/527 (13%)

Query: 251 LRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQK----VSDGFKAILCXXX 306
           L S + +K+L    E    +  GD+++ +  D   + + LTQ      S  F+ ILC   
Sbjct: 365 LTSVIYQKSLVLSNEASAASSTGDIVNLMSVDVQRL-QDLTQWGQIIWSGPFQLILCLIS 423

Query: 307 XXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVK 366
                          +VI  PA     S+  +  + +  I  +   + TR   E LN +K
Sbjct: 424 LYKLLGNSMWVGVIIMVIMIPA----NSVIIRYQKKLQKIQMKNKDERTRTISEILNNIK 479

Query: 367 TVQSFVAE---QKEIRRYNNA--IRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYG 421
           +++ +  E   ++++ +  N   ++++  +G  +A+ + +F+    ++   +F V +   
Sbjct: 480 SLKLYAWEVPFREKLDKVRNEKELQNLKRMGITTAIASFQFNIVPFLVSCSTFAVFVWTQ 539

Query: 422 SYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLF----------D 471
               L   L    LT F L +   A     L++F    ++   +  RL           D
Sbjct: 540 KDRPLSTDLVFPALTLFNLLSFPLAIIPTALTSF----IEASVSVNRLHSFLTNEELQRD 595

Query: 472 LTDRIPAIRPTIGEKFIPGDGCIEFRNLG----FAYPTRPENQV-FKNLNFKIEPGTSVC 526
              R P +  T GE  I         N+G    F +  +PE +V  KN+NF+ + G   C
Sbjct: 596 SVQRKPKVTKT-GEVAI---------NVGADATFLWQRKPEYKVALKNINFQAKKGELTC 645

Query: 527 IVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP-KSLRQYMGIVQQEPVLMSGS 585
           IVG  G GKS +   +L               D+ ++    S+   +  V Q P +M+G+
Sbjct: 646 IVGKVGSGKSALIQGIL--------------GDLFRVKGFASVHGSIAYVSQVPWIMNGT 691

Query: 586 IRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIA 645
           +++NI +G K +A  D      + C     ++  P   ET++G  G  LSGGQK RI++A
Sbjct: 692 VKENILFGHKYDA--DFYDTTLRACALAVDLSILPKGDETLVGEKGISLSGGQKARISLA 749

Query: 646 RALIKKPKILILDEATSALDVE-SEGAINYTFGK--LMKSKSVTIVSIAHRLSTIRRSEY 702
           RA+  +    +LD+  +A+D   ++  I +  G   L+ SK   + +  +++S +  +++
Sbjct: 750 RAVYARADTYLLDDPLAAVDEHVAKHLIEHVLGSQGLLSSKVKVLAT--NKISVLSIADH 807

Query: 703 IIVLGNDGSVVETGKFKELYADPTSELSKLL---NEKQSRANKKEAP 746
           I +L N G +++ G ++E+ +D +S LSK++    +KQ++    E+P
Sbjct: 808 ISLLEN-GEIIQQGSYEEVTSDKSSALSKIIANYGKKQTKGKGDESP 853

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 132/502 (26%), Positives = 224/502 (44%), Gaps = 53/502 (10%)

Query: 255  VIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXX 314
            ++ K LH    FFD   +G +++R   D   + + LT  V    ++++            
Sbjct: 1136 LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELTPYV----ESVVYNSVQLIATVLL 1191

Query: 315  XPQLSSFLVIFAPAVVISASIFGKKI----RDISTILQEATGQLTRVSEEQLNGVKTVQS 370
               +++  ++ A  V++     G       R++          + +   E L GV T+++
Sbjct: 1192 ITYITNGFIVVALLVILLYYFVGVYYLSGSRELKRFESTTKSPIYQHFSETLVGVTTIRA 1251

Query: 371  FVAEQKEIRRYNNAIRDIYNIGK---MSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH 427
            +     EIR     +  I    K      V N        +IG    LV+   G  ++++
Sbjct: 1252 Y---GDEIRFMKENLTKIDENNKPFFYLWVANRWLCFRIDIIGS---LVIFGAGVLVLMN 1305

Query: 428  GSLTIGDLTAFML-YTDYTANSIFGLSNFYSEI---MQGVGAAKRLFDLTDRIPAIRPTI 483
             +     L    L Y      S   L   YS +   M  V   K   D+     +     
Sbjct: 1306 INKIDSGLAGISLTYAITFTESALWLVRSYSNVEINMNSVERVKEYMDIEQEPYSAGIVN 1365

Query: 484  GEKFIPGDGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLL 542
             +K  P +G IE  +L   Y P+ P  +V KN++F +EP   V +VG +G GKSTI   L
Sbjct: 1366 VDKSWPSEGKIEVNDLSLRYAPSLP--KVIKNVSFTVEPKMKVGVVGRTGAGKSTIITAL 1423

Query: 543  LRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT-YGLKREATPD 601
             R+ +P +G I IDN DI  ++ K LR+ + I+ Q+P L +G+I+ N+  Y    E   D
Sbjct: 1424 FRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNLDPYN---EYNDD 1480

Query: 602  EIREVSKQC--------------FCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARA 647
            +I +  ++                    + KF +  ++ I   G+ LS GQ+Q + +AR+
Sbjct: 1481 QIFKALRRVNLIVDGNLNSDVTSVSSENVNKFLNL-QSEISEGGSNLSQGQRQLMCLARS 1539

Query: 648  LIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLG 707
            L++ P I++LDEAT+++D  S+  I  T     + K  TI++IAHRL ++   + I+V+ 
Sbjct: 1540 LLRAPNIMLLDEATASIDYASDAKIQGTIRN--EFKDSTILTIAHRLRSVIDYDKILVM- 1596

Query: 708  NDGSVVETGKFKELYADPTSEL 729
                  + G+ KE Y  P S L
Sbjct: 1597 ------DAGEVKE-YDHPYSLL 1611

 Score = 88.2 bits (217), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 112/229 (48%), Gaps = 11/229 (4%)

Query: 494 IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI 553
           I   N+  ++  + ++   +NLN   + G    ++GP+G GK+++ + LL   +   G+I
Sbjct: 698 ISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLMALLGEMHLLEGKI 757

Query: 554 LIDNQD---IMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQC 610
            + + D    M  +   L   M    Q   L++ ++++NI +    E   +    V   C
Sbjct: 758 TVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFN--AEYNEERYLAVISAC 815

Query: 611 FCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEG 670
                         T IG  G  LSGGQKQRI++ARAL    K ++LD+  SA+D  +  
Sbjct: 816 ALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILLDDCLSAVDSHTAA 875

Query: 671 AI--NYTFGKLMKSKSVTIVSIAHRLS-TIRRSEYIIVLGNDGSVVETG 716
            I  N   G LM++++  +VS  H ++ T++ +E +I++ N G +   G
Sbjct: 876 WIYDNCIIGPLMENRTCILVS--HNVALTLKNAEQVIMIDN-GKISHIG 921

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 140/545 (25%), Positives = 241/545 (44%), Gaps = 68/545 (12%)

Query: 208  PIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFF 267
            P +F + LY F   FA  + +      G++ +L  +       L    +K+ LH    + 
Sbjct: 930  PPSFYMGLYSFF-VFAAFIFMN-----GQFTILCAMGIMASKWLNLRAVKRILHTPMSYI 983

Query: 268  DQNKVGDLISRLGSDAYVVSRSLTQK---VSDGFKAILCXXXXXXXXXXXXPQLSSFLVI 324
            D   +G +++R   D   +   LT+    ++  F  I+                  FL++
Sbjct: 984  DTTPLGRILNRFTKDTDSLDNELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAIPFLLV 1043

Query: 325  FAPAVVISASIFGKKIRDISTILQE-ATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNN 383
                +       G++I+ +  + +      L  V    L G+ T++++ ++++ + + + 
Sbjct: 1044 IFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEV----LGGMDTIKAYRSQERFLAKSDF 1099

Query: 384  AIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH--------GSLTIGDL 435
             I  +   G +  V+          +G    +V +A+   + L          + ++G L
Sbjct: 1100 LINKMNEAGYLVVVLQR-------WVGIFLDMVAIAFALIITLLCVTRAFPISAASVGVL 1152

Query: 436  TAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL--------FDLTDRIPAIRPTIGEKF 487
              ++L      N+I       ++    + +A+RL         + + R P + P    + 
Sbjct: 1153 LTYVLQLPGLLNTIL---RAMTQTENDMNSAERLVTYATELPLEASYRKPEMTPP---ES 1206

Query: 488  IPGDGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYY 546
             P  G I F N+ FAY P  P   V KNLN  I+ G  + I G +G GKSTI   L R  
Sbjct: 1207 WPSMGEIIFENVDFAYRPGLP--IVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLN 1264

Query: 547  NPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKR---------- 596
              ++G+ILIDN DI +L    LR+ + I+ Q+PVL  G+IR N+    +R          
Sbjct: 1265 ELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTDDELWDALV 1324

Query: 597  ---EATPDEIREVSKQ----CFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALI 649
                   D++ EV  Q       H  + KF    +  +   G+  S G++Q +A+ RAL+
Sbjct: 1325 RGGAIAKDDLPEVKLQKPDENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALV 1382

Query: 650  KKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGND 709
            ++ KILILDEATS++D E++G I      + +    TI+ IAHRL TI   + I+VL   
Sbjct: 1383 RQSKILILDEATSSVDYETDGKIQTRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EK 1439

Query: 710  GSVVE 714
            G V E
Sbjct: 1440 GEVAE 1444

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 66/213 (30%), Positives = 105/213 (49%), Gaps = 20/213 (9%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           FK+LNF I+ G  + I GP G GKS++   +      + G++ + N D++          
Sbjct: 604 FKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEV-NGDLLMCG------- 655

Query: 572 MGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHG 631
                  P + + S+RDNI +G       ++  EV + C     +   P    T IG  G
Sbjct: 656 ------YPWIQNASVRDNIIFG--SPFNKEKYDEVVRVCSLKADLDILPAGDMTEIGERG 707

Query: 632 TLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGKLMKSKSVTIVSI 690
             LSGGQK RI +AR++ KK  I + D+  SA+D    +  ++     ++ +K+  + + 
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILAT- 766

Query: 691 AHRLSTIRRSEYIIVLGNDGSVVETGKFKELYA 723
            H+LS I R+  +IVLG DG  V+ G   EL A
Sbjct: 767 -HQLSLIERASRVIVLGTDGQ-VDIGTVDELKA 797

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 131/505 (25%), Positives = 223/505 (44%), Gaps = 51/505 (10%)

Query: 266  FFDQNKVGDLISRLGSDAY----VVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSF 321
            FF+   +G +++R  +D Y    ++ R+ +Q + +  K +                   F
Sbjct: 1045 FFETTPIGRILNRFSNDIYKVDSLLGRTFSQFLVNAVKVVFTMIVICWTTW-------QF 1097

Query: 322  LVIFAPAVVISASIF------GKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQ 375
            + I  P  V+            +++R + +I +     +    +E L G+ T++ +  +Q
Sbjct: 1098 IFIIGPLGVLYIYYQQYYLRTSRELRRLDSITRSP---IYSHFQETLGGMSTIRGY-NQQ 1153

Query: 376  KEIRRYNNAIRDIYNIGKMSAV-----VNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSL 430
            +     N+   D      MSA       N   +     IG +  L       Y +  G+L
Sbjct: 1154 RRFDHINHCRID----NNMSAFYPSINANRWLAFRLESIGSVIILGAATLSIYRLGQGTL 1209

Query: 431  TIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEK---- 486
            T G +   + Y      ++  +     E+   + + +R+ + ++        I EK    
Sbjct: 1210 TAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSEAPLVIEEKRPAA 1269

Query: 487  FIPGDGCIEFRNLGFAYPTRPE-NQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRY 545
              P  G I F +    Y  RPE + V +++N  I+P   + IVG +G GKS++ L L R 
Sbjct: 1270 HWPDSGDIRFDHYSTRY--RPELDLVLRDVNLHIKPREKIGIVGRTGAGKSSLTLALFRI 1327

Query: 546  YNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNI----TYGLKREATPD 601
               SSG I+ID   I ++    LR  + I+ Q+  +  G+IR+N+    TY      T D
Sbjct: 1328 VEASSGGIVIDGVRIDEIGLHDLRHNLSIIPQDSQVFQGTIRENVDPTETY------TDD 1381

Query: 602  EIREVSKQCFCHNFITKF-PDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEA 660
            EI  V +    +  +    P      +   G+ LS GQ+Q + +ARAL+   KILILDEA
Sbjct: 1382 EIWRVLELSHLNRHVESMGPRGLLNEVNEGGSNLSVGQRQLMCLARALLVPSKILILDEA 1441

Query: 661  TSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKE 720
            T+A+DVE++  I  T     + +  TI++IAHR++TI  S+ I+VL + G V E      
Sbjct: 1442 TAAVDVETDQVIQETIRSAFRDR--TILTIAHRINTIMDSDRIVVL-DGGRVTEFDTPTN 1498

Query: 721  LYADPTSELSKLLNEKQSRANKKEA 745
            L  +  S+   L  E       +EA
Sbjct: 1499 LLRNEGSQFHSLCQEAGLLTRAQEA 1523

 Score =  105 bits (263), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 103/416 (24%), Positives = 189/416 (45%), Gaps = 66/416 (15%)

Query: 355 TRVSEEQLNGVKTVQSFVAEQK-----EIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVI 409
           T V  E LN +K+++ +  E+      E  R +  ++++  +G   A+ + +F+    ++
Sbjct: 483 TSVISEILNNIKSLKLYAWEEPYKKKLEHVRNDKELKNLTKLGCFMAITSFQFNVVPFLV 542

Query: 410 GDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL 469
              +F  V  Y     L   L    LT F L +      +F + N  +  ++   +  RL
Sbjct: 543 SCCTF-AVFVYTEDRALTVDLVFPALTLFNLLS----FPLFVIPNVMTSFIEASVSVTRL 597

Query: 470 F----------DLTDRIPAIRPTIGEKFIP-GDGCIEFRNLGFAYPTRPENQV-FKNLNF 517
           F          D   R+P +   +G+  +  GD      +  F +  +PE +V  KN+NF
Sbjct: 598 FNFLTNEELQKDSVQRLPKV-TNVGDVAVKVGD------DATFLWRRKPEYKVALKNINF 650

Query: 518 KIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP-KSLRQYMGIVQ 576
           + + G   C+VG  G GKS +   L       SG       D+ ++    ++   +  V 
Sbjct: 651 EAKKGQLTCVVGRVGSGKSALIQSL-------SG-------DLFRVKGFATVHGSVAYVS 696

Query: 577 QEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSG 636
           Q   +M+G++++NI +G + +  P+   +  K C     +    D  ET++G  G  LSG
Sbjct: 697 QVAWIMNGTVKENILFGHRYD--PEFYDKTIKACALTIDLAVLVDGDETLVGEKGISLSG 754

Query: 637 GQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFG---------KLMKSKSVT 686
           GQK R+++ARA+  +    +LD+  +A+D    +  + +  G         K++ +  ++
Sbjct: 755 GQKARLSLARAVYARADTYLLDDPLAAVDEHVGKHLLEHVLGPTGLLRTKTKILATNKIS 814

Query: 687 IVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANK 742
           ++SIA R          I L  +G +VE G + E+ AD  S LSKL+ +   + NK
Sbjct: 815 VLSIADR----------IALLENGEIVEQGSYDEVTADGDSALSKLIRDYGRKDNK 860

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  131 bits (329), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 138/546 (25%), Positives = 233/546 (42%), Gaps = 48/546 (8%)

Query: 210  AFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQ 269
            +F + LY F     GA +  T     ++ +L  +       L    +K+ +H    F D 
Sbjct: 933  SFYMGLYSFF--VFGAYIFMT----SQFTILCYIGIGASKNLNIQALKRIIHTPMSFMDT 986

Query: 270  NKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLS------SFLV 323
              +G +++R   D   +   L + V                     P  +       F+ 
Sbjct: 987  TPIGRILNRFTKDTDSLDNELIENVRLTVSQFANIVGVCVMCIVYLPWFAIAVPFLVFIF 1046

Query: 324  IFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNN 383
            +F      SA   G++I+ +  I +     +     E L G+ T++ + +E++ I + + 
Sbjct: 1047 VFIQNHYQSA---GREIKRLEAIQRSF---VYNNFNEILGGMDTIKFYKSEERYIAKSDY 1100

Query: 384  AIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLT-IGDLTAFMLYT 442
             I  +   G ++  V    +    +I     L++         H S + +G L  ++L  
Sbjct: 1101 LIDKMNEAGYLTVCVQRWVAILVDMIAVAFALIITLLCVTRQFHISASSVGVLLTYVLQL 1160

Query: 443  DYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPA----IRP-TIGEKFIPGDGCIEFR 497
                N++       S++   + + +RL      +P      +P T   +  P +G I+F 
Sbjct: 1161 PGLFNTLL---RAVSQVENDMNSTERLVSYATDLPLEAQYHKPETAPPESWPEEGTIKFE 1217

Query: 498  NLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILID 556
            N+ FAY P  P   V KN+N +I     + I G +G GKSTI   L R    +SG ILID
Sbjct: 1218 NVDFAYRPGLP--IVLKNINLQINGTEKIGICGRTGAGKSTIMTALYRLNELTSGSILID 1275

Query: 557  NQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKR-------------EATPDEI 603
            + DI KL    LR+ + I+ Q+PVL  G IR N+    +R                P+++
Sbjct: 1276 DVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNLDPFHERTDEELWDVLVRGGAIAPEDL 1335

Query: 604  REVSKQCFCHNFITKFPDAY--ETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEAT 661
             E   Q    +  +     +  + ++   G   S G++Q +A+ RAL++  KILILDEAT
Sbjct: 1336 AETKAQHITEDGTSADLHKFHLDKVVEEDGANFSLGERQILALTRALVRNTKILILDEAT 1395

Query: 662  SALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
            S++D E++  I             TI+ IAHRL TI   + I+VL + G V E      L
Sbjct: 1396 SSVDYETDRKIQERIATAF--SHCTILCIAHRLKTILNYDRILVLEH-GEVAEFDTPMNL 1452

Query: 722  YADPTS 727
            + D T+
Sbjct: 1453 FKDETT 1458

 Score =  106 bits (265), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 80/230 (34%), Positives = 123/230 (53%), Gaps = 22/230 (9%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           F NLNF+I+ G  V I GP G GK+++      +   +SG I I N D++          
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQI-NGDLL---------- 660

Query: 572 MGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHG 631
           MG     P + + ++RDNI +G   E   D+ +EV + C   + +   P   +T IG  G
Sbjct: 661 MG---GYPWIQNATVRDNIIFGSPYE--EDKYKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 632 TLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGKLMKSKSVTIVSI 690
             LSGGQK RI +AR + K+  I +LD+  SA+D    +  ++    KL+ +K+  + + 
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLIGNKTRLLAT- 774

Query: 691 AHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRA 740
            H+LS I ++  IIVLGNDGS VE G  +  Y   T++  K+L E  ++A
Sbjct: 775 -HQLSLIDKASRIIVLGNDGS-VEIGDVQ--YMKETNKTLKVLLENTNQA 820

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 151/542 (27%), Positives = 244/542 (45%), Gaps = 102/542 (18%)

Query: 250  RLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXX 309
            ++  +++   LH    FFD   +G +++R   D   V + LT  +      ++       
Sbjct: 1079 KIFDNMLDLVLHAKIRFFDVTPIGRIMNRFAKDIEGVDQELTPYLEVTMFCLIQCTSIIF 1138

Query: 310  XXXXXXPQLSSFLVI---------FAPAVVISASIFGKKIRDI--STILQEATGQLTRVS 358
                  P    FL++         F     ++AS   K+I  I  S I Q  +       
Sbjct: 1139 LITIITPH---FLIVAVVVFILYYFVGMWYLTASRELKRIDSITKSPIFQHFS------- 1188

Query: 359  EEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVL 418
             E L GV T+++F  E++ I    + I          +V    F+    +IG     +VL
Sbjct: 1189 -ETLVGVCTIRAFGDEKRFILENLDKIDQNNRAFFYLSVAVKWFAFRVDIIGA---FIVL 1244

Query: 419  AYGSYLVLH-GSLTIG----DLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL---- 469
            A GS+++++ G++  G     LT  +L+TD        L   YS     + + +RL    
Sbjct: 1245 ASGSFILINIGNIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMSMNSVERLKEYS 1300

Query: 470  -------FDLT-DRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTR--PENQVFKNLNFKI 519
                   FD   D I  ++ +      P  G IE  NL   Y +   P   V KN++F I
Sbjct: 1301 SIEQENYFDYNKDHIQELQQSSW----PEHGQIEVDNLSLRYASNLPP---VIKNVSFTI 1353

Query: 520  EPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEP 579
            EP + V IVG +G GKSTI   L R   P +G I ID  DI +++  +LR+ + I+ Q+P
Sbjct: 1354 EPQSKVGIVGRTGAGKSTIITALFRLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDP 1413

Query: 580  VLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFIT-------------------KFP 620
            +L +G+I+ N+      E    +I +V  Q    N I+                   KF 
Sbjct: 1414 ILFTGTIKSNVDPC--DEYDNKKIFKVLSQV---NLISTGEMEAAQNMGDDSNTARNKFV 1468

Query: 621  DAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVES----EGAINYTF 676
            +  +T I   G  +S G++Q + IAR+L+++PKI++LDEATS++D ES    +G I   F
Sbjct: 1469 NL-QTEITEGGQNISQGERQLLFIARSLLREPKIILLDEATSSIDYESDHLIQGIIRNEF 1527

Query: 677  GKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEK 736
             K       TI++IAHRL ++   + ++V+       + G+ KE Y  P +    LL  +
Sbjct: 1528 NK------STILTIAHRLRSVIDYDRVLVM-------DAGEIKE-YDHPYN----LLKNE 1569

Query: 737  QS 738
            QS
Sbjct: 1570 QS 1571

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 96/384 (25%), Positives = 171/384 (44%), Gaps = 42/384 (10%)

Query: 360 EQLNGVKTVQSFVAEQ------KEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMS 413
           E L  ++ V+ F  E       K IR+  N +R ++    + A+ +  +  + +++  ++
Sbjct: 534 ECLQNIRIVKYFAWENNISKDIKSIRQ--NELRFLFQKALVWALSSFLWFVTPTLVTGVT 591

Query: 414 FLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLT 473
           F + + +  +  L+  L    L+ F L        +  LSN  S + Q + +  R+    
Sbjct: 592 FAIYI-FVQHQELNAPLAFTTLSLFTL----LKTPLDQLSNMLSFMNQSIVSLDRI---- 642

Query: 474 DRIPAIRPTIGEKF-----IPGDGCIEFRNLGFAY-PTRPENQVFK--NLNFKIEPGTSV 525
             +  I     EK+      P +  IEF+N    +     ++ +FK   LN   + G   
Sbjct: 643 --VKFINEDDTEKYNQLTVSPDENKIEFKNATLTWNENDKDSTIFKLCGLNITFQIGKLN 700

Query: 526 CIVGPSGRGKSTIALLLLRYYNPSSGQILIDN----QDIMKLNPKSLRQYMGIVQQEPVL 581
            I+G +G GKS + + LL   +  SG I +       D++  +   L        Q   L
Sbjct: 701 LILGSTGSGKSALLMGLLGELHLISGSITVPGLEPRHDLIP-DHNGLTNSFAYCSQSAWL 759

Query: 582 MSGSIRDNITYGLKREATPDEIR--EVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQK 639
           ++ ++++NI +        D++R  EV   C     +   P    T IG  G  LSGGQK
Sbjct: 760 LNDTVKNNIIFN----GAYDDVRYKEVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQK 815

Query: 640 QRIAIARALIKKPKILILDEATSALDVESEGAI--NYTFGKLMKSKSVTIVSIAHRLSTI 697
           QRI++ARA+    K ++LD+  SA+D  +   I  N   G +M++++  +V+  H +S  
Sbjct: 816 QRISLARAVYSNAKHVLLDDCLSAVDSHTAVWIYENCITGPIMENRTCILVT--HNVSLT 873

Query: 698 RRSEYIIVLGNDGSVVETGKFKEL 721
            R  Y  V+  +G V   G  K+L
Sbjct: 874 IREAYFAVILENGKVKNQGTIKQL 897

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  130 bits (328), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 140/543 (25%), Positives = 237/543 (43%), Gaps = 42/543 (7%)

Query: 210  AFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQ 269
            +F + LY F   F+  L   T   +     + +LS +    L    +K+ LH    + D 
Sbjct: 964  SFYMGLYSFFVFFSYIL---TTSQFTLLCCIGVLSSK---WLNLRAVKRILHTPMSYLDT 1017

Query: 270  NKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAV 329
              +G +++R   D   +   LT+ V                     P  +  +       
Sbjct: 1018 TPLGRILNRFTKDTDSLDNELTESVRMLLYQFANIVGVCIMCIIYLPWFAIAIPFLFVGF 1077

Query: 330  VISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIY 389
            V+ A  +    R+I  +       +     E L G+ T++S+ +E + I + +  I  + 
Sbjct: 1078 VLIADHYQSSGREIKRLEAIQRSFVYNNFNEVLGGMDTIKSYRSENRFIAKSDFLIDKMN 1137

Query: 390  NIGKMSAVVNSKFSTSTSVIG-DMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANS 448
              G +   V    +    VI    + ++ L   +      + ++G L  ++L      N 
Sbjct: 1138 EAGYLVVAVQRWVAIFLDVIAVCFALIITLLCVTRAFPISAASVGVLLTYVLQLPGLLN- 1196

Query: 449  IFGLSNFYSEIMQGVGAAKRLFDLTDRIPAI----RPTIG--EKFIPGDGCIEFRNLGFA 502
              G+    ++    + +A+RL      +P      +P +   E++ P  G I F N+ F+
Sbjct: 1197 --GVLRSLTQTENDMNSAERLVTYATELPLEADYRKPEVSPPEEW-PTKGEIHFENVDFS 1253

Query: 503  Y-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIM 561
            Y P  P   V KNL+  I+ G  + I G +G GKSTI   L R    SSG+++ID+ DI 
Sbjct: 1254 YRPGLP--TVLKNLSLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISSGKMIIDDVDIS 1311

Query: 562  KLNPKSLRQYMGIVQQEPVLMSGSIRDNI-----------TYGLKREATPD--EIREVSK 608
             +    LR+ + I+ Q+PVL  G+IR N+              L R    +  E+ E+  
Sbjct: 1312 TIGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHQDEHLWNALVRGGAIEQKELNEIKA 1371

Query: 609  QC----FCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSAL 664
            Q       H+ + KF    + ++   G   S G++Q +A+ RAL+++ +ILILDEATS++
Sbjct: 1372 QKPDEKGNHSEMYKF--HLDQLVEEEGANFSLGERQLLALTRALVRQARILILDEATSSV 1429

Query: 665  DVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYAD 724
            D E++G I      + +    TI+ IAHRL TI   + I+VL   G V E    K L+A 
Sbjct: 1430 DYETDGKIQARI--VEEFGHCTILCIAHRLKTILTYDRILVL-EKGEVAEFDTPKTLFAQ 1486

Query: 725  PTS 727
              S
Sbjct: 1487 EDS 1489

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 113/212 (53%), Gaps = 22/212 (10%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           F +LNF+I+ G  + +VGP G GK+++      + N  SG+I I N D++      L  Y
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQI-NGDLL------LCGY 701

Query: 572 MGIVQQEPVLMSGSIRDNITYGLK-REATPDEIREVSKQCFCHNFITKFPDAYETIIGPH 630
                  P + + S++DNI +G    +A  DE+  V   C   + +   P    T IG  
Sbjct: 702 -------PWIQNASVKDNIIFGSPYNKAKYDEVIRV---CSLKSDLDILPAGDLTEIGER 751

Query: 631 GTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGKLMKSKSVTIVS 689
           G  LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++  F  L+K K+  + +
Sbjct: 752 GITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDKTRILAT 811

Query: 690 IAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
             H+LS + R+  +IVLGNDGS  + G  +EL
Sbjct: 812 --HQLSLLERASRVIVLGNDGS-FDIGTVEEL 840

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  129 bits (325), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 122/474 (25%), Positives = 217/474 (45%), Gaps = 29/474 (6%)

Query: 266  FFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIF 325
            FF+   +G +++R  +D + V   L +  S     ++              Q + F++  
Sbjct: 1047 FFETTPIGRILNRFSNDIFKVDELLGRTFSQFVNNVIKVSFTIIVICFTTWQFTLFVIPL 1106

Query: 326  APAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIR----RY 381
                V     + +  R++  +       +    +E L G+ T++ +  +++ I     R 
Sbjct: 1107 GILYVYYQQYYLRTSRELRRLDSTTRSPIYAHFQESLGGLSTIRGYNQQRRFIHINQSRM 1166

Query: 382  NNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH---GSLTIGDLTAF 438
            +N +   Y     S   N   +     IG    +++    S  +L    GSLT G +   
Sbjct: 1167 DNNMSAYYP----SVNANRWLAYRLEFIGT---IIIFGASSLSILRLKSGSLTPGMIGLS 1219

Query: 439  MLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKF-----IPGDGC 493
            + Y      S+  +     E+   + + +R+ + ++ IP+  P + E        P DG 
Sbjct: 1220 LSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSE-IPSEAPYLIEDRRPSPNWPTDGA 1278

Query: 494  IEFRNLGFAYPTRPE-NQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQ 552
            I+F++    Y  RP  + + K++N  I+P   + IVG +G GKS++ L L R    + G+
Sbjct: 1279 IQFQHYSTRY--RPGLDLILKDINLDIKPKEKIGIVGRTGAGKSSLTLALFRLIEAAEGR 1336

Query: 553  ILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFC 612
            I+ID   I ++    LR  + I+ Q+  +  GS+R+NI      + + +EI  V      
Sbjct: 1337 IVIDGVPIDQMGLYDLRHKLSIIPQDSQVFEGSVRENI--DPTEQYSDEEIWRVLDLSHL 1394

Query: 613  HNFITKF-PDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGA 671
             N +     D   T +   G  LS GQ+Q + +ARAL+   KIL+LDEAT+A+DVE++  
Sbjct: 1395 KNHVLNMGNDGLLTQLSEGGGNLSVGQRQLMCLARALLVPTKILVLDEATAAVDVETDKV 1454

Query: 672  INYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADP 725
            +  T       +  TI++IAHRL+TI  S+ I+VL + G V E    + L  +P
Sbjct: 1455 LQETIRTAFADR--TILTIAHRLNTIMDSDRILVL-DAGRVAEFDTPENLLKNP 1505

 Score =  116 bits (291), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 131/520 (25%), Positives = 239/520 (45%), Gaps = 61/520 (11%)

Query: 251 LRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKV----SDGFKAILCXXX 306
           L S + KK+L   +E  D +  GD+++ +  D   + + L Q      S  F+ ILC   
Sbjct: 385 LTSVIYKKSLVLSSEAADMSSTGDIVNLMSVDVQRL-QDLAQWCHLIWSGPFQIILCLTS 443

Query: 307 XXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVK 366
                          L++  P   +++S+   + +++     +   Q TR+  E LN +K
Sbjct: 444 LYKLLGKSMWVGVIILIVMMP---LNSSLMRVQ-KNLQKGQMKNKDQRTRLINEILNNMK 499

Query: 367 TVQSFVAEQK-----EIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYG 421
           +++ +  E+      E  R    ++++  IG  +A++N +F+     +   +F  V  Y 
Sbjct: 500 SLKLYAWEKPYKEKLEYVRNEKELKNLTKIGVYNAIINFQFNIVPFFVSCSTF-AVFVYT 558

Query: 422 SYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLF----------D 471
               L   L    LT F L + +    +  + N Y E    +G   RL+          D
Sbjct: 559 EDRPLTTDLVFPALTLFGLLS-FPLAVVPLVLNSYIEASVSIG---RLYSFLTNEELQRD 614

Query: 472 LTDRIPAIRPTIGEKFIP-GDGCIEFRNLGFAYPTRPENQV-FKNLNFKIEPGTSVCIVG 529
              R+P ++  IG+  +  GD      N  F +  +PE +V  KN+NF+ + G   C+VG
Sbjct: 615 SVQRLPRVK-NIGDVAMKLGD------NATFLWKRKPEYKVALKNVNFQAKKGELNCVVG 667

Query: 530 PSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP-KSLRQYMGIVQQEPVLMSGSIRD 588
             G GKS +   LL               D+ ++    ++   +  V Q   +M+G+++D
Sbjct: 668 RVGSGKSALIQSLL--------------GDLFRVKGFATVHGNIAYVSQVAWIMNGTVKD 713

Query: 589 NITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARAL 648
           NI +G K +  P+   +  K C     +   PD  +TI+G  G  LSGGQK R+++ARA+
Sbjct: 714 NILFGHKYD--PEFYEKTIKACALTIDLAILPDGDKTIVGEKGISLSGGQKARLSLARAV 771

Query: 649 IKKPKILILDEATSALDVE-SEGAINYTFG--KLMKSKSVTIVSIAHRLSTIRRSEYIIV 705
             +  I +LD+  +A+D   S   I++  G   L+K+K+  + +  +++S +  ++ + +
Sbjct: 772 YSRADIFLLDDPLAAVDEHVSTHLIDHVLGPNGLLKTKTKILAT--NKISALSIADSVTL 829

Query: 706 LGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEA 745
           L N G +++ G F E+     S LSKL+ E   + +K E 
Sbjct: 830 LEN-GEIIQQGTFCEITKAADSPLSKLIKEYGKKKHKSEV 868

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  129 bits (325), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 125/501 (24%), Positives = 226/501 (45%), Gaps = 34/501 (6%)

Query: 251  LRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXX 310
            L  + + + LH    + D   +G +++R   D   +   LT+ V      +         
Sbjct: 947  LNLNAVHRVLHAPMSYLDTTPLGRILNRFTKDTDSLDNELTESVRLMLFQVGNIVAVIVM 1006

Query: 311  XXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQS 370
                 P  +  +       V+ A  +    R+I  +       +     E L G+ T++S
Sbjct: 1007 CIVYLPWFAIAVPFLFFMFVLIADHYQSTSREIKRLDAIQRSFVYNNLNEVLGGMDTIKS 1066

Query: 371  FVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVV--LAYGSYLVLHG 428
            +  +++   + +  I  +   G +   V    S    ++  +  L++  L+      L  
Sbjct: 1067 YKGQKRFQAKSDYLINKMNEAGYLLVSVQRWVSIFLDMVAIIFALIIALLSVTGVFSLSA 1126

Query: 429  SLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPA----IRPTIG 484
            S ++G L  ++L      NS+       ++    + +A+RL +   ++P      +P + 
Sbjct: 1127 S-SVGVLLTYVLQLPGLLNSVL---RALTQTENDMNSAERLVNYATKLPLEAAYKKPELS 1182

Query: 485  E-KFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLL 543
              +  P  G I F ++ FAY +     V K LN  I+ G  + I G +G GKSTI   L 
Sbjct: 1183 PPESWPSKGEIRFLDVDFAYRSGLP-VVLKGLNLDIKSGEKIGICGRTGAGKSTIMSALY 1241

Query: 544  RYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNI------------- 590
            R    +SG+ILID+ DI  L    LR+ + I+ Q+PVL  G+IR N+             
Sbjct: 1242 RLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPVLFKGTIRKNLDPFSNYDDSLLWD 1301

Query: 591  ----TYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIAR 646
                +  +++E+      E+  +   H  + KF    + ++   G+  S G++Q +A+ R
Sbjct: 1302 ALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKF--HLDQLVEEEGSNFSLGERQVLALTR 1359

Query: 647  ALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVL 706
            AL+++ KILILDEATS++D E++G I      + +  + TI+ IAHRL TI + + I+VL
Sbjct: 1360 ALVRQSKILILDEATSSVDYETDGKIQKRI--VEEFDNCTILCIAHRLKTILQYDRILVL 1417

Query: 707  GNDGSVVETGKFKELYADPTS 727
               G + E  +  +L++D  S
Sbjct: 1418 -EKGVIAEFDQPFKLFSDKDS 1437

 Score = 91.3 bits (225), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 120/243 (49%), Gaps = 24/243 (9%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           F NL+F+I  G  + I GP G GKS++      + N + G+I + N D++         +
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQV-NGDLL---------F 637

Query: 572 MGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHG 631
            G     P + + +++DNI +G       ++   V + C     +   P   +T IG  G
Sbjct: 638 CGY----PWIQNATVKDNILFG--SPFIKEKYENVLRVCSLDADLKVLPAGDKTEIGERG 691

Query: 632 TLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGKLMKSKSVTIVSI 690
             LSGGQK RI +ARA+ K   I + D+  SA+D    +  ++     L++ K+  + + 
Sbjct: 692 INLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGKTRILAT- 750

Query: 691 AHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLN---EKQSRANKKEAPL 747
            H+LS I +++ +IVLG DGS  + G   EL       L+ LL+    ++   N+ E+P+
Sbjct: 751 -HQLSLIEKADRVIVLGTDGS-FDIGTVDEL-KQRNQTLTNLLDYSTTERENENRDESPV 807

Query: 748 PPQ 750
             +
Sbjct: 808 ADE 810

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  129 bits (323), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 134/542 (24%), Positives = 231/542 (42%), Gaps = 40/542 (7%)

Query: 210  AFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQ 269
            +F + LY F   F G L +       ++ +L ++       L    +K+ LH    + D 
Sbjct: 933  SFYMGLYSFF-VFGGYLFMNI-----QFTMLCMMGIMASKWLNLKAVKRILHAPMSYLDT 986

Query: 270  NKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAV 329
              +G +++R   D   +   LT+ +                     P  +  +       
Sbjct: 987  TPLGRILNRFTKDTDSLDNELTENIRLMMSQFANIIGVCVLCIVYLPWFAIAIPFLLLVF 1046

Query: 330  VISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIY 389
            V+ A  +    R+I  +       +     E L G+ T++++ ++ + + + +  I  + 
Sbjct: 1047 VLIADHYQSAGREIKRLEAIQRSFVYNNLIEVLGGMDTIKAYKSQDRYMTKMDFLINKMN 1106

Query: 390  NIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLT-IGDLTAFMLYTDYTANS 448
             +  M   V    +    +I     L++         H S + +G L  ++L      N+
Sbjct: 1107 EVSYMVVSVQRWVAIFLDMIAVAFALIISLLCVTRQFHISPSAVGVLLTYVLQLPGLLNT 1166

Query: 449  IFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGD-----GCIEFRNLGFAY 503
            +       ++    + +A+RL      +P         + P D     G + F ++ FAY
Sbjct: 1167 VL---RALTQTENDMNSAERLVTYATELPQEAAYRKSDYSPPDNWPTNGEVIFEDVSFAY 1223

Query: 504  -PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMK 562
             P  P   V KN+N  I  G  + I G +G GKSTI   L R    +SG+I ID  D  K
Sbjct: 1224 RPGLP--TVLKNVNLSIAGGEKIGICGRTGAGKSTIMTALYRLNELTSGRIFIDGIDTFK 1281

Query: 563  LNPKSLRQYMGIVQQEPVLMSGSIR-----------DNITYGLKREAT--PDEIREVSKQ 609
            L    LR+ + I+ Q+PVL  G+IR           D++   L R      D++ ++  Q
Sbjct: 1282 LGLYDLRRKLSIIPQDPVLFRGTIRKNLDPFNEFSDDSLWNSLIRGGAIEKDDLEDIKHQ 1341

Query: 610  ----CFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALD 665
                   +N + KF    + I+   G   S G++Q +A+ RAL+++ KILILDEATS++D
Sbjct: 1342 KPDKNGSYNNMHKF--HLDQIVEEDGANFSLGERQVLALTRALVRQSKILILDEATSSVD 1399

Query: 666  VESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADP 725
             E++G I        + +  TI+ IAHRL TI   + I+VL   G V E  K + L+ + 
Sbjct: 1400 YETDGKIQTRIAT--EFQDCTILCIAHRLKTILNYDRILVL-EKGEVAEFDKPEILFNNE 1456

Query: 726  TS 727
             S
Sbjct: 1457 KS 1458

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 65/211 (30%), Positives = 111/211 (52%), Gaps = 20/211 (9%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           F NLNF+I+ G  + I GP G GKS++   +  +   ++G++ I+   +       L  Y
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDINGHML-------LCGY 669

Query: 572 MGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHG 631
                  P + + ++RDNI +G   +   ++ +EV + C     I   P    T IG  G
Sbjct: 670 -------PWIQNATVRDNIIFGSPYDR--EKYKEVIRVCSLQADIDILPAGDMTEIGERG 720

Query: 632 TLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGKLMKSKSVTIVSI 690
             LSGGQK RI +AR++ K   I + D+  SA+D    +  ++  F + ++SK+  + + 
Sbjct: 721 ITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSKTRILAT- 779

Query: 691 AHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
            H+LS I +++ +IVL  +GS V+ G  +EL
Sbjct: 780 -HQLSLIEKADRVIVLSTNGS-VDIGTVEEL 808

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  129 bits (323), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 137/516 (26%), Positives = 237/516 (45%), Gaps = 64/516 (12%)

Query: 250  RLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXX 309
            ++ ++++   LH +  FFD   VG +++R   D   V + L   +      ++       
Sbjct: 1074 KIFNNMLDLVLHANIRFFDVTPVGRIMNRFAKDIEGVDQELIPYLEVTIFCLIQCLSIIF 1133

Query: 310  XXXXXXPQLSSFLVIFAPAVVISASIF---GKKIRDISTILQEATGQLTRVSEEQLNGVK 366
                  P+     V+           +   G++++ I +I +    Q      E L GV 
Sbjct: 1134 LITIITPRFLVVAVVVLVLYYFVGKCYLSAGRELKRIDSITKSPIFQYF---SETLAGVC 1190

Query: 367  TVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVL 426
            T+++F  E++ I    + I          +V    F+    +IG     +VL  GS+++L
Sbjct: 1191 TIRAFGDEKRFILENMDKIDQNNRAFFYLSVAVKWFAFRVDIIGA---FIVLGSGSFILL 1247

Query: 427  H-----GSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLT-------- 473
            +      SL    LT  +L+TD        L   YS     + + +RL + +        
Sbjct: 1248 NIGDIDSSLAGISLTYSILFTD----GALWLVRLYSTFEMNMNSVERLKEYSGIEQENYN 1303

Query: 474  -DRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSG 532
             + I A++ ++     P  G IE  NL   Y +     V KN++F ++P T + IVG +G
Sbjct: 1304 ENHIQALQNSLW----PEHGKIEVDNLSLRYASNLP-PVIKNVSFTVDPQTKIGIVGRTG 1358

Query: 533  RGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNI-- 590
             GKSTI   L R   P +G I ID  DI K++  +LR+ + I+ Q+P+L +G+I+ N+  
Sbjct: 1359 AGKSTIITALFRLLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILFTGTIKSNLDP 1418

Query: 591  --TYGLKR---------EATPDEIREV--SKQCF--CHNFITKFPDAYETIIGPHGTLLS 635
               Y  +R           +  E+ E    ++ F   HN   +F +    I+   G  LS
Sbjct: 1419 YDEYDERRIFKVLSQVNLISSRELEETLNREENFSGVHN---RFLNLRTEIV-EGGLNLS 1474

Query: 636  GGQKQRIAIARALIKKPKILILDEATSALDVES----EGAINYTFGKLMKSKSVTIVSIA 691
             G+KQ + IAR+L+++PKI++LDEATS++D +S    +G I   F +       TI++IA
Sbjct: 1475 QGEKQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRNEFSR------STILTIA 1528

Query: 692  HRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTS 727
            HRL ++   + ++V+ + G V E     EL  +  S
Sbjct: 1529 HRLRSVIDYDKVLVM-DAGEVKEYDHPYELLKNERS 1563

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 115/243 (47%), Gaps = 20/243 (8%)

Query: 514 NLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILI---DNQDIMKLNPKSLRQ 570
           N+NF+I  G    I+G +G GKS + + LL      SG I++   + +  M  +   L  
Sbjct: 687 NINFRI--GKLNLILGSTGSGKSALLMGLLGELYLLSGSIIVPGLEPRHDMIPDLNGLTN 744

Query: 571 YMGIVQQEPVLMSGSIRDNITY-GLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGP 629
                 Q   L++G++R+NI + G+  E   +  + V   C     +   P    T IG 
Sbjct: 745 SFAYCSQSAWLLNGTVRNNIIFNGVYDE---NRYKNVIDACGLKRDLEILPAGDSTEIGE 801

Query: 630 HGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTF---GKLMKSKSVT 686
            G  LSGGQKQRI++ARA+    K ++LD+  SA+D  +   I Y     G LMK+++  
Sbjct: 802 KGITLSGGQKQRISLARAIYSNAKHVLLDDCLSAVDSHTAIWI-YEICITGLLMKNRTCI 860

Query: 687 IVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL-----YADPTSELSKLLNEKQSRAN 741
           +V+  H +S   R  Y  V+  +G V   G   EL     + +   +LS   N  +   N
Sbjct: 861 LVT--HNISLAIRKAYFAVILENGKVKSQGTITELKNKGVFKEDFGQLSYDDNNTEKNIN 918

Query: 742 KKE 744
           + E
Sbjct: 919 RSE 921

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 124/479 (25%), Positives = 216/479 (45%), Gaps = 41/479 (8%)

Query: 255  VIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXX 314
            ++ + ++    FFD   +G +++R   D  V+   L   +   F   +            
Sbjct: 1139 LLYRVVNSKLTFFDNTPIGRIMNRFSKDIQVLDSELAPFLDGVFSCFIQAVTALMLIVFI 1198

Query: 315  XPQLSSFLVIFAPAVVISASIFGKKI----RDISTILQEATGQLTRVSEEQLNGVKTVQS 370
             P+   FL+I A  ++ S+   G       R++      +   + +   E L+G+ T+++
Sbjct: 1199 TPK---FLII-AIFIICSSITIGYLYLCCSRELKRFESSSKSPVYQHFTETLSGLVTIRA 1254

Query: 371  FVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSL 430
            F  E K ++   + I +          VNS  S    ++G ++   V   G++++L+   
Sbjct: 1255 FGNEIKFLKENLDFIDENNKFFFYMWSVNSWLSFRIDLLGAIT---VFGSGAFILLNADK 1311

Query: 431  TIGDLTAFML-YTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIP-------AIRPT 482
                L    L Y          +  FYS +   + + +RL +  +          AI P+
Sbjct: 1312 IDAGLAGISLTYAVTFTEFCLWMVKFYSTVEMSMNSVERLKEYMEIEEEALADPGAITPS 1371

Query: 483  IGEKFIPGDGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALL 541
              E + P  G I F N    Y P  P+  V K LN KI+ G+ + +VG +G GKSTI   
Sbjct: 1372 --ENW-PVQGAITFANYSLRYAPKLPD--VLKQLNLKIDGGSKIGVVGRTGAGKSTIISA 1426

Query: 542  LLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPD 601
            L R+ + SSG+ILID+ DI ++N + LR  + I+ Q+P L  G+IR N+    + E    
Sbjct: 1427 LFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIRSNLDPNEEYENKDI 1486

Query: 602  EIREVSKQCFCHNFITKFP-DAYETI-------------IGPHGTLLSGGQKQRIAIARA 647
                V       +++     DA   +             I   G  LS GQ+Q I +AR+
Sbjct: 1487 YDALVKVHLLTEDYLANLNYDANADVAYDENIFLNLDSPISEGGINLSQGQRQLICLARS 1546

Query: 648  LIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVL 706
            ++   KI++LDEAT+++D +S+  +  T       K  TI++IAHR+ ++   + I+VL
Sbjct: 1547 ILHCSKIVLLDEATASIDYKSDFKVQETIRNEFSQK--TILTIAHRIKSVIDYDKILVL 1603

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 114/212 (53%), Gaps = 13/212 (6%)

Query: 513 KNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDN-QDIMKLNPKS--LR 569
           +N+N + E G    ++GP+G GK+++ + LL   +  SG++ + N +    L P+S  L 
Sbjct: 733 RNINAEFEMGKLNLVIGPTGSGKTSLLMALLGELHLFSGKVFVPNLESKFNLIPESDNLL 792

Query: 570 QYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGP 629
             +    Q P + + +IR+NI + +  +   D    V   C             +TI+G 
Sbjct: 793 NSIAYCSQLPWIFNDTIRNNIIFDMGYD--KDRYENVVIACGLERDFQILNLGDKTIVGD 850

Query: 630 HGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTF---GKLMKSKSVT 686
            G+ LSGGQKQRI++ARAL  K + LILD+  SA+D  S   I Y     G LM+ ++  
Sbjct: 851 KGSCLSGGQKQRISLARALYSKSRHLILDDCLSAVDSHSAKWI-YNVCITGPLMQGRTCI 909

Query: 687 IVSIAHRLS-TIRRSEYIIVLGNDGSVVETGK 717
           +VS  H +S TI+++  + ++ N G +V +G+
Sbjct: 910 LVS--HNVSLTIKKASKVFMIEN-GYIVASGR 938

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  128 bits (322), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 134/540 (24%), Positives = 235/540 (43%), Gaps = 58/540 (10%)

Query: 208  PIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFF 267
            P +F + LY F   FA  + +      G++ +L  +       L    +++ LH    + 
Sbjct: 930  PPSFYMGLYSFF-VFAAFIFMN-----GQFTILCAMGIMASKCLNLRAVRRILHTPMSYI 983

Query: 268  DQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAP 327
            D   +G +++R   D   +   LT+ +                     P  +  +     
Sbjct: 984  DTTPLGRILNRFTKDTDSLDNELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAIPFLLV 1043

Query: 328  AVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRD 387
              V+ A  +    R+I  +       +     E L G+ T++++ ++++ + + +  I  
Sbjct: 1044 VFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSDFLINK 1103

Query: 388  IYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH--------GSLTIGDLTAFM 439
            +   G +  V+          +G    +V +A+   + L          + ++G L  ++
Sbjct: 1104 MNEAGYLVVVLQR-------WVGIFLDMVAIAFALIITLLCVTRAFPISAASVGVLLTYV 1156

Query: 440  LYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAI----RPTIGE-KFIPGDGCI 494
            L      N+I       ++    + +A+RL     ++P      +P +   +  P  G I
Sbjct: 1157 LQLPGLLNTIL---RAMTQTENDMNSAERLVSYATKLPLEADYRKPEMTPPESWPSKGKI 1213

Query: 495  EFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI 553
             F N+ FAY P  P   V KN N  I+ G  + I G +G GKSTI   L R    ++GQI
Sbjct: 1214 VFENVDFAYRPGLP--IVLKNFNLDIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGQI 1271

Query: 554  LIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIRE-------V 606
             ID+ DI +L    LR+ + I+ Q+PVL  G+IR N+    +R  T DE+ +       +
Sbjct: 1272 FIDDVDISQLGLFDLRKKLAIIPQDPVLFRGTIRKNLDPFDER--TDDELWDALVRGGAI 1329

Query: 607  SKQCF------------CHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKI 654
            +K                H  + KF    +  +   G+  S G++Q +A+ RAL+++ KI
Sbjct: 1330 AKNDLPEVRLQKPDENGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKI 1387

Query: 655  LILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
            LILDEATS++D E++G I      + +    TI+ IAHRL TI   + I+VL   G V E
Sbjct: 1388 LILDEATSSVDYETDGKIQTRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAE 1444

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 100/212 (47%), Gaps = 18/212 (8%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           FK+LNF I+ G  + I GP G GKS++   +        G+I + N D++          
Sbjct: 604 FKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEV-NGDLLMCG------- 655

Query: 572 MGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHG 631
                  P + + ++RDNI +G       ++  EV   C     +   P    T IG  G
Sbjct: 656 ------YPWIQNATVRDNIIFG--SPFNKEKYDEVIHVCSLKADLDILPAGDMTEIGERG 707

Query: 632 TLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIA 691
             LSGGQK RI +AR++ KK  I + D+  SA+D      I       M S    I++  
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNKTRILA-T 766

Query: 692 HRLSTIRRSEYIIVLGNDGSVVETGKFKELYA 723
           H+LS I R+  +IVLG DG  V+ G  +EL A
Sbjct: 767 HQLSLIERASRVIVLGTDGK-VDIGTVEELKA 797

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 135/502 (26%), Positives = 227/502 (45%), Gaps = 69/502 (13%)

Query: 251  LRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAY----VVSRSLTQKVSDGFKA-----I 301
            L S ++   L     FF+   +G +++R  +D Y    V+ RS +Q   +  K      +
Sbjct: 1033 LHSSMVSSILRAPMTFFETTPIGRILNRFSNDVYKIDEVLGRSFSQFFVNAVKVSFTILV 1092

Query: 302  LCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIF------GKKIRDISTILQEATGQLT 355
            +C                 F+++  P  V+            +++R + +I +     + 
Sbjct: 1093 ICWNTW------------QFILLVIPMGVLYLYYQQYYLRTSRELRRLDSITKSP---IY 1137

Query: 356  RVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVV-----NSKFSTSTSVIG 410
               +E L G+ T++ +  +QK     N A  D      MSA       N   +     +G
Sbjct: 1138 AHFQESLGGLATIRGY-EQQKRFIHINQARVD----NNMSAYYPSINSNRWLAYRLEFLG 1192

Query: 411  DMSFLVVLAYGSYLVLH---GSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAK 467
                L++    S  +L    G+LT G +   + Y      S+  +     E+   + + +
Sbjct: 1193 S---LIIFGAASLSILKLRDGTLTAGMIGLSLSYALQVTQSLNWIVRMTVEVETNIVSVE 1249

Query: 468  RL---FDLTDRIPAI----RPTIGEKFIPGDGCIEFRNLGFAYPTRPE-NQVFKNLNFKI 519
            R+    +L    P I    RP+  E + P  G I+F N    Y  RP+ + V KN++  I
Sbjct: 1250 RIKEYAELKSEAPLIIEEKRPS--ENW-PERGAIKFENYSTRY--RPDLDLVLKNISLDI 1304

Query: 520  EPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEP 579
            +P   V IVG +G GKS++ L L R    + G I++D  +I ++    LR  + I+ Q+ 
Sbjct: 1305 KPQEKVGIVGRTGAGKSSLTLALFRIIEAAEGSIIVDGLNISEIGLYDLRHKLSIIPQDS 1364

Query: 580  VLMSGSIRDNI----TYGLKREATPDEIREVSKQCFCHNFIT---KFPDAYETIIGPHGT 632
             +  G+IR+NI     Y  ++     E+  + +     N  +      +A  T +   G 
Sbjct: 1365 QVFEGTIRENIDPTNIYTDEQIWNALELSHLKQHILRMNEESVNGSENNALYTRVTEGGN 1424

Query: 633  LLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAH 692
             LS GQ+Q + +ARAL+   KILILDEAT+A+DVE++  I  T     K +  TI++IAH
Sbjct: 1425 NLSVGQRQLMCLARALLVPSKILILDEATAAVDVETDSLIQETIRTAFKDR--TILTIAH 1482

Query: 693  RLSTIRRSEYIIVLGNDGSVVE 714
            RL+TI  S+ I+VL + G V E
Sbjct: 1483 RLNTIMDSDKIVVL-DKGEVAE 1503

 Score =  108 bits (271), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 128/514 (24%), Positives = 231/514 (44%), Gaps = 57/514 (11%)

Query: 251 LRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKV----SDGFKAILCXXX 306
           + S + +K L    E  D +  GD+++ +  D   + + LTQ      S  F+ ILC   
Sbjct: 382 MTSVLYQKALVLSNEASDLSSTGDVVNLMSVDVQRL-QDLTQWCNIIWSGPFQIILCLFS 440

Query: 307 XXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKI-RDISTILQEATGQLTRVSEEQLNGV 365
                       S ++ +    V+I  + +  +I + +  +  +   + TRV  E LN +
Sbjct: 441 LYKLLGH-----SMWVGVIVLIVMIPLNSYLMRIQKQLQKVQMKYKDERTRVINEILNNI 495

Query: 366 KTVQSFVAEQK-----EIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAY 420
           K+++ +  EQ      E  R    ++++  IG  +A+ N +F+    ++   +F  V  Y
Sbjct: 496 KSLKLYAWEQPYKEKLEHVRNEKELKNLTRIGVFNAMTNFQFNLVPFLVSCSTF-AVFVY 554

Query: 421 GSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDL-------T 473
                L   L    LT F L T   A     L    +  ++   +  RLF         T
Sbjct: 555 IEDKPLTTDLVFPALTLFNLLTFPLA----ALPIVITAFIEASVSMSRLFSFMTNEELQT 610

Query: 474 DRIPAIRPTIGEKFIPGDGCIEF-RNLGFAYPTRPENQV-FKNLNFKIEPGTSVCIVGPS 531
           D I  + P   +    GD  +    N  F +  +PE +V  KN+ F+ + G   CIVG  
Sbjct: 611 DAIQRLPPVKKQ----GDIAVNIGDNATFLWKRKPEYKVALKNIEFQAKKGELACIVGKV 666

Query: 532 GRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP-KSLRQYMGIVQQEPVLMSGSIRDNI 590
           G GKS     +L               D+ ++    ++   +  V Q P +M+G+++DNI
Sbjct: 667 GSGKSAFIQSIL--------------GDLFRVKGFATIHGNVAYVSQLPWIMNGTVKDNI 712

Query: 591 TYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIK 650
            +G K      E  +  + C     ++  PD  +T++G  G  LSGGQK R+++ARA+  
Sbjct: 713 LFGHKYNQEFYE--KTLRACALTIDLSILPDGDQTLVGEKGISLSGGQKARLSLARAVYA 770

Query: 651 KPKILILDEATSALDVE-SEGAINYTFG--KLMKSKSVTIVSIAHRLSTIRRSEYIIVLG 707
           +  + +LD+  +A+D   S+  I +  G   L+ +K  T V   +++S +  ++ I +L 
Sbjct: 771 RADVYLLDDPLAAVDEHVSKHLIQHVIGPNGLLHTK--TRVLATNKISVLSIADNITLL- 827

Query: 708 NDGSVVETGKFKELYADPTSELSKLLNEKQSRAN 741
           +DG +V+ G + E+  +  S L KL++E  ++ N
Sbjct: 828 DDGEIVQQGTYNEVTDNINSPLCKLISEYGNKNN 861

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  127 bits (320), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 134/539 (24%), Positives = 238/539 (44%), Gaps = 60/539 (11%)

Query: 210  AFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQ 269
            +F + LY F   FA  + +      G+Y +L  +       L    +K+ LH    + D 
Sbjct: 933  SFYMGLYSFF-VFAAFIFMN-----GQYTILCAMGIMASKWLNLKAVKRILHTPMSYIDT 986

Query: 270  NKVGDLISRLGSDAYVVSRSLTQK---VSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFA 326
              +G +++R   D   +   LT+    ++  F  I+                  FL+I  
Sbjct: 987  TPLGRILNRFTKDTDSLDNELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAIPFLLIIF 1046

Query: 327  PAVVISASIFGKKIRDISTILQE-ATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAI 385
              +       G++I+ +  + +      L  V    L G+ T++++ ++++ + + +  I
Sbjct: 1047 VLIADHYQSSGREIKRLEAVQRSFVYNNLNEV----LGGMDTIKAYRSQERFLAKSDFLI 1102

Query: 386  RDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSL-----TIGDLTAFML 440
              +   G +  V+         +  DM  +V     + L +  +      ++G +  ++L
Sbjct: 1103 NKMNEAGYLVVVLQR----WVGIFLDMVAIVFALIITLLCVTRAFPISAASVGVMLTYVL 1158

Query: 441  YTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAI----RPTIGE-KFIPGDGCIE 495
                  N++       ++    + +A+RL      +P      +P +   +  P  G I 
Sbjct: 1159 QLPGLLNTLL---RALTQTENDMNSAERLVSYATELPLEADYRKPEMAPPESWPSKGEIA 1215

Query: 496  FRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQIL 554
            F+N+ F+Y P  P   V KNLN  I+ G  + I G +G GKSTI   L R    S G+IL
Sbjct: 1216 FKNVDFSYRPGLP--VVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELSGGEIL 1273

Query: 555  IDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREV-------- 606
            ID+ +I ++    LR+ + I+ Q+PVL  G+IR N+      E T DE+ +         
Sbjct: 1274 IDDVNISQIGLFDLRRKLAIIPQDPVLFRGTIRKNLDPF--NERTEDELWDALVRGGAIA 1331

Query: 607  -----------SKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKIL 655
                        ++   H  + KF    +  +   G+  S G++Q +A+ RAL+++ KIL
Sbjct: 1332 KNDLPEVKLQKPEENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALTRALVRQSKIL 1389

Query: 656  ILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
            ILDEATS++D E++G I      + +    TI+ IAHRL TI   + I+VL   G V E
Sbjct: 1390 ILDEATSSVDYETDGKIQVRI--VEEFGDCTILCIAHRLKTIVNYDRILVL-EKGEVAE 1445

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/213 (29%), Positives = 106/213 (49%), Gaps = 20/213 (9%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           FK+L+F+I+ G  + I GP G GKS++   +      + G+I + N D++          
Sbjct: 604 FKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEV-NGDLLMCG------- 655

Query: 572 MGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHG 631
                  P + + +++DNI +G       ++  EV   C     +   P    T IG  G
Sbjct: 656 ------YPWIQNATVKDNIIFG--SPFNKEKYDEVIHVCSLKADLDILPAGDMTEIGERG 707

Query: 632 TLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGKLMKSKSVTIVSI 690
             LSGGQK RI +AR++ K+  I + D+  SA+D    +  ++     L+++K+  + + 
Sbjct: 708 ITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENKTRVLAT- 766

Query: 691 AHRLSTIRRSEYIIVLGNDGSVVETGKFKELYA 723
            H+LS I ++  +IVLG DG  V+ G   EL A
Sbjct: 767 -HQLSLIEKASRVIVLGTDGD-VDIGTVDELKA 797

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  127 bits (318), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 119/462 (25%), Positives = 209/462 (45%), Gaps = 27/462 (5%)

Query: 266  FFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIF 325
            FF+   +G +++R  +D Y V   L +  S  F   +              Q    +V  
Sbjct: 1062 FFETTPIGRILNRFSNDIYKVDSILGRTFSQFFVNTVKVLFTIGVIAYTTWQFVFVIVPL 1121

Query: 326  APAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAI 385
                +     + +  R++  +       +    +E L G+ T++ +  +QK     N   
Sbjct: 1122 GIFYIYYQQYYLRTSRELRRLESVTRSPIFSHFQETLGGLATIRGY-GQQKRFEHINECR 1180

Query: 386  RDIYNIGKMSAV-----VNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFML 440
             D      MSA       N   +     IG +  L       + +  G++T G +   + 
Sbjct: 1181 VD----NNMSAFYPSINANRWLAYRLEFIGSVIILGAATLSIFKLRAGTMTAGMIGLSLS 1236

Query: 441  YTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGE-----KFIPGDGCIE 495
            Y      ++  +     E+   + + +R+ + ++ + +  P + E     K  P  G I+
Sbjct: 1237 YALQITQTLNWIVRMTVEVETNIVSVERIKEYSE-LKSEAPLVIESNRPPKEWPVAGEIK 1295

Query: 496  FRNLGFAYPTRPE---NQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQ 552
            F +    Y TR     + V K++N +I+P   + IVG +G GKS++ L L R    +SG 
Sbjct: 1296 FEH----YYTRYREDLDYVLKDINLEIKPREKIGIVGRTGAGKSSLTLALFRIIEATSGG 1351

Query: 553  ILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFC 612
            ILID   I ++    LR ++ I+ Q+  +  G+IR+NI     +    D  R +      
Sbjct: 1352 ILIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTIRENID-PTNQFTDADIWRALELSHLK 1410

Query: 613  HNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI 672
             + +    D   T++   G+ LS GQ+Q + +ARAL+   K+L+LDEAT+A+DVE++  I
Sbjct: 1411 EHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLARALLVPSKVLVLDEATAAVDVETDKVI 1470

Query: 673  NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
              T     K +  TI++IAHR++TI  ++ IIVL + G VVE
Sbjct: 1471 QETIRTSFKDR--TILTIAHRINTIMDNDRIIVL-DKGKVVE 1509

 Score =  105 bits (261), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 124/524 (23%), Positives = 232/524 (44%), Gaps = 63/524 (12%)

Query: 247 VVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKV----SDGFKAIL 302
           V + L S + +K L    E  + +  GD+++ +  D   + + LTQ +    S   + +L
Sbjct: 396 VKSALTSIIYQKALVLSNEASNTSSTGDIVNLMSVDVQKL-QDLTQWIHLIWSGPLQIVL 454

Query: 303 CXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKI-RDISTILQEATGQLTRVSEEQ 361
           C               S ++ +    ++I  + F  KI +++     +   + TRV  E 
Sbjct: 455 CLISLYKLLGH-----SMWVGVLILTIMIPVNSFLMKIQKNLQKSQMKFKDERTRVISEI 509

Query: 362 LNGVKTVQSFVAEQK-----EIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLV 416
           LN +K+++ +  EQ      E  R    ++++  +G   A  + +F+    ++   +F  
Sbjct: 510 LNNMKSLKLYAWEQPYKEKLEYVRNEKELKNLKKLGVYMACTSFQFNIVPFLVSCSTF-A 568

Query: 417 VLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLF------ 470
           V  Y     L   L    LT F L     +  +  + N  + I++   +  RLF      
Sbjct: 569 VFVYTEDKALTTDLVFPALTLFNL----LSFPLMVIPNVITAIIESSVSVSRLFNFLTNE 624

Query: 471 ----DLTDRIPAIRPTIGEKFIP-GDGCIEFRNLGFAYPTRPENQV-FKNLNFKIEPGTS 524
               D   R+P ++  IG+  +  GD      N  F +  +PE +V  KN+N++ + G  
Sbjct: 625 ELQKDAVQRLPKVKE-IGDVAVNVGD------NATFLWKRKPEYKVALKNINYQAKKGEL 677

Query: 525 VCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP-KSLRQYMGIVQQEPVLMS 583
            CIVG  G GKS     LL               D+ ++    ++   +  V Q   +M+
Sbjct: 678 SCIVGKVGSGKSAFLQSLL--------------GDLFRVKGFATIHGSVAYVSQVAWIMN 723

Query: 584 GSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIA 643
           G++RDN+ +G K +  P+   +  K C     +    D  +T++G  G  LSGGQK R++
Sbjct: 724 GTVRDNVLFGHKYD--PEFYEKTIKACALTIDLATLVDGDQTLVGEKGISLSGGQKARLS 781

Query: 644 IARALIKKPKILILDEATSALDVE-SEGAINYTFG--KLMKSKSVTIVSIAHRLSTIRRS 700
           +ARA+  +    +LD+  +A+D   S   + +  G   L+ SK+  + +  +++S +  +
Sbjct: 782 LARAVYARADTYLLDDPLAAVDEHVSRHLVEHVLGPNGLLHSKTRILAT--NKISVLSAA 839

Query: 701 EYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKE 744
           + I +L N G + + G + +   D  S L KLL E   + +K +
Sbjct: 840 DSITLLEN-GEITQQGTYADCRKDEESALGKLLKEFGRKESKND 882

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  126 bits (317), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 123/499 (24%), Positives = 211/499 (42%), Gaps = 44/499 (8%)

Query: 255  VIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXX 314
            V+ K LH    FFD    G +++RL  D   V + L       F A++            
Sbjct: 1114 VLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGSFAAVVQCISTLVLIAYV 1173

Query: 315  XPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAE 374
             PQ     +       +    +    R++          + +   E L G+ +++++  E
Sbjct: 1174 TPQFLIMAIFIGFLYALIGYFYVTTSRELKRFESITRSPIYQHFSETLVGITSIRAYGDE 1233

Query: 375  QK----EIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GS 429
            ++     + R ++  R  + +     + N   +    ++G    LV    G ++ L+ G 
Sbjct: 1234 RRFMLENLSRIDDNNRPFFYLW----IANRWLAFRVDLLGA---LVTFFSGLFIYLNIGK 1286

Query: 430  LTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL---FDLTDRIPAIRPTIGEK 486
            L  G     + Y  +           YS +   + + +RL    ++          +   
Sbjct: 1287 LDAGLAGISLTYAIFFTEGALWFVRHYSNVEMTMNSFERLKEYMEIEQEPYNENAQLPPD 1346

Query: 487  FIPGDGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRY 545
              P  G I+  +L   Y P  P  +V KN+NF +EP   V IVG +G GKSTI   + R+
Sbjct: 1347 NWPQHGRIDVSDLSLRYAPNLP--KVIKNVNFSVEPKLKVGIVGRTGAGKSTIITAMFRF 1404

Query: 546  YNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRD-----------NITYGL 594
             +P +G + IDN DI  +    LRQ + I+ Q+P L +G+++             I   L
Sbjct: 1405 LDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTLFTGTLKSILDPYSQYSDKQIYEAL 1464

Query: 595  KR----EATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIK 650
            +R      T                I KF D    +    G  LS GQ+Q + +AR+L++
Sbjct: 1465 QRVNLLSDTDINSLSSPSTQSSGENINKFLDLNNEVT-EGGANLSQGQRQLVCLARSLLR 1523

Query: 651  KPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDG 710
             PKI++LDEAT+++D  S+  I  T  +  + +  TI++IAHRL +I   + ++V+    
Sbjct: 1524 SPKIIMLDEATASIDYTSDEKIQQTIRE--EFRDSTILTIAHRLKSIIDYDKVLVM---- 1577

Query: 711  SVVETGKFKELYADPTSEL 729
               + G+ KE Y  P S L
Sbjct: 1578 ---DAGEVKE-YDHPYSLL 1592

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 79/289 (27%), Positives = 127/289 (43%), Gaps = 16/289 (5%)

Query: 474 DRIPAI----RPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVG 529
           DRI A       T  E+       + F N   A+   P +   +N++ +   G      G
Sbjct: 648 DRIQAFLDEDETTKYEQLTISGNRLAFENATIAWNDDPSSFRLRNIDIEFMIGKLNVAFG 707

Query: 530 PSGRGKSTIALLLLRYYNPSSGQILI---DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSI 586
           P+G GKS++ L LL       G+I +   D ++ + +    L   +    Q   L++ + 
Sbjct: 708 PTGTGKSSLLLGLLGEMTLQEGKIYVPSLDPREDLVIQADGLTNSIAYCSQSAWLLNDTA 767

Query: 587 RDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIAR 646
           R NI +            +V + C              T IG  G  LSGGQKQRI++AR
Sbjct: 768 RSNILF--NSPYNEQRYNDVLEACGLKKDFEILSGGDLTQIGEKGMTLSGGQKQRISLAR 825

Query: 647 ALIKKPKILILDEATSALDVESEGAI--NYTFGKLMKSKSVTIVSIAHRLS-TIRRSEYI 703
           AL    + L+LD+  SA+D  +   I  N   G LM+ ++  +VS  H ++ T+R ++++
Sbjct: 826 ALYSSARHLLLDDCLSAVDSHTALLIYENCIIGPLMEGRTCVLVS--HNVALTMRNADWV 883

Query: 704 IVLGNDGSVVETGKFKELYADPTSELSKLLNEK-QSRANKKEAPLPPQS 751
           ++L N G V   G+   L  +      KL+     SR N   +   PQS
Sbjct: 884 VILEN-GRVKAQGEPLALANEGLLGEDKLIKSSIASRTNSSLSLKTPQS 931

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  125 bits (315), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 138/565 (24%), Positives = 239/565 (42%), Gaps = 66/565 (11%)

Query: 213  LTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKV 272
            +T+Y  +G  + A       N    I+L   S R   +L   +    +     FF+   +
Sbjct: 1024 VTIYAIIGLLSAAF-----NNIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFETTPI 1078

Query: 273  GDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQ---LSSFLVIFAPAV 329
            G +++R  SD   +   L    S  F+++L             P    L++ L++     
Sbjct: 1079 GRIVNRFSSDLEAIDSGLQYIFSFFFRSVLIYVVSLILVGYNLPWFIALNAVLIMIYFYY 1138

Query: 330  VISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYN--NAIRD 387
                 +  ++++ ++TI   +   +  +  E L G   + +F        R+N  N    
Sbjct: 1139 QAYYIMLSRELKRLTTI---SYSPIMSLISETLGGFSVINAF----DHTSRFNFFNFETV 1191

Query: 388  IYNIGKMSAV--VNSKFSTSTSVIGDMSFLVVLAYG--SYLVL--HGSLTIGDLTAFMLY 441
             YNI  +      N   S     IG+   L++LA G  S+  L     L+ G +   M Y
Sbjct: 1192 QYNIDCVFQFRSTNRWLSVRLQTIGN---LIILATGLLSFATLGTKKQLSSGMVGLLMSY 1248

Query: 442  TDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAI-------RPTIGEKFIPGDGCI 494
            +    +S+  +     +I   + + +R  +  +  P         RP  G    P +G I
Sbjct: 1249 SLQVTSSLMWIVRMTVQIETRIVSVERTLEYCELKPEALEIIENSRPPEGW---PREGAI 1305

Query: 495  EFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQIL 554
            EF N    Y    +  V K++N  I+P   + IVG +G GKST+ L L R    + G I 
Sbjct: 1306 EFNNYTTKYRENLD-PVLKDINVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATGGSIS 1364

Query: 555  IDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHN 614
            ID  DI K+  + LR  + I+ Q+     G+IR N+      + + +E+    +      
Sbjct: 1365 IDGIDISKIGLEDLRSNLAIIPQDAQAFEGTIRSNLDPF--DQHSDEELWRAVELSHLKQ 1422

Query: 615  FITKF------------------PDAYE------TIIGPHGTLLSGGQKQRIAIARALIK 650
             I +                   PD++       T I  +G+ +S GQ+Q + ++RAL+ 
Sbjct: 1423 HILRMNEEANDRESDSSRTDITTPDSHNIKELLATPISKNGSNVSVGQRQLLCLSRALLN 1482

Query: 651  KPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDG 710
              K+LILDEAT+A+D+E++  +  T     K +  TI++IAHR+ T+   + I+VL + G
Sbjct: 1483 PSKVLILDEATAAIDMETDKIVQDTIKNEFKER--TILTIAHRIDTVMNYDKILVL-DKG 1539

Query: 711  SVVETGKFKELYADPTSELSKLLNE 735
             V E      L +D  +   KL  +
Sbjct: 1540 EVAEFDTVSNLLSDKNTMFYKLCEQ 1564

 Score = 84.3 bits (207), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 132/572 (23%), Positives = 248/572 (43%), Gaps = 65/572 (11%)

Query: 202 ETSDLPPIAFGLTLYP-FLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTL 260
           ET+  PP+   + +   FL  F     I T+     YI +  +   +   L + V KK+L
Sbjct: 321 ETNVYPPLQGAIIVVALFLSKF-----ISTLLGNQFYIKIFEVGLGIRGSLMALVYKKSL 375

Query: 261 HQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSS 320
              ++   ++  GD+I+ + +D   + R      S     I                + +
Sbjct: 376 RISSDARQKHSSGDIINLMSTDVLNLQRFFENSQSIIGAPIQIVIVLISLYLLLDKAVFA 435

Query: 321 FLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRR 380
            ++     + I+A +  K      T ++    +LT ++E  LN +K+++ +  E+  +++
Sbjct: 436 GMISMVIMIPINAYLSRKVGSLYKTQMKYKDSRLTILTE-ILNSIKSIKLYSWEKPMLKK 494

Query: 381 YNNAIRDIY--NIGKMSAVVNSKFSTSTSV--IGDMSFLVVLAYGSYLVLHGSLTIGDLT 436
             +   D+   N  K+    N  F     V  +   S  ++ +  S + L   +    LT
Sbjct: 495 LLHVRNDLELENFKKIGIFSNLIFFAWNCVPLMVTCSTFLIFSMISDVPLSPDIIFPSLT 554

Query: 437 AFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFI----PGDG 492
            F +  D    +I+ + +  ++++Q   + KRL D       +   + + FI    P + 
Sbjct: 555 LFNILND----AIYVVPSTINDVIQANISMKRLRDF-----LLAEELDDSFIEYKSPSET 605

Query: 493 ----CIEFRNLGFAYPTRP---ENQ-------------VFKNL-NFKIEPGTSVCIVGPS 531
                IE  N  F + ++    EN                KN+ NF ++ G+  CIVG  
Sbjct: 606 DDAPVIEINNATFLWQSKKIINENSSTDEESNIETSKAALKNIDNFTVKKGSLTCIVGKV 665

Query: 532 GRGKSTIALLLLRYYNPSSGQI-LIDNQDIMKLNPKSLRQY-MGIVQQEPVLMSGSIRDN 589
           G GKSTI   +L       GQ+  I   D  +    ++R   +    QE  +M+ S+++N
Sbjct: 666 GSGKSTILHAIL-------GQLPCISALDQTRAPKVTIRATSIAYCPQEAWIMNSSVKEN 718

Query: 590 ITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGG-QKQRIAIARAL 648
           I +G K +     +  V + C   + ++  PD  ETI+G  G  L GG QK RI++ARA+
Sbjct: 719 IVFGHKHDENYYNL--VIQACQLASDLSILPDGDETIVGEKGISLVGGVQKARISLARAV 776

Query: 649 IKKPKILILDEATSALDVE-SEGAINYTFGK---LMKSKSVTIVSIAHRLSTIRRSEYII 704
             +  + +LD+  SA+D   S+  I Y   K   L+++K  TI+   + ++ ++ S+ I 
Sbjct: 777 YARADVYLLDDILSAVDAHVSKNIIKYVLSKETGLLRNK--TIILSTNNVNVLKNSQKIY 834

Query: 705 VLGNDGSVVETGKFKELY-ADPTSELSKLLNE 735
            +   G +VE   ++ +  +   S + KL+ E
Sbjct: 835 AI-EKGEIVEESDYENVMNSSDASRIKKLIEE 865

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  125 bits (314), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 139/533 (26%), Positives = 228/533 (42%), Gaps = 58/533 (10%)

Query: 220  GAFAGALVIGTMCNYG----RYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDL 275
            G + G  +     NY     ++ +L  +       L    +K+ LH    F D   +G +
Sbjct: 893  GFYIGLYIFFVFVNYFFMSLQFTILCYIGLAASKWLNLKAVKRLLHTPMSFMDTTPLGRV 952

Query: 276  ISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASI 335
            ++R   D   +   LT+ V                     P  +  +       +I A  
Sbjct: 953  LNRFTKDTDTLDNELTESVRLFVYQTANIAGVIIMCIIYLPWFAIAVPFLGLIFIIVADH 1012

Query: 336  FGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMS 395
            +    R+I  +       +     E L+G+ T++++ +E + + + +  I  +   G + 
Sbjct: 1013 YQSSGREIKRLEAVQRSFVYNNFNEVLSGMDTIKAYKSENRFLMKSDFLINRMSEAGYLV 1072

Query: 396  AVVNSKFSTSTSVIG----------------DMSFLVVLAYGSYLVLHGSLTIGDLTAFM 439
              V    S S  +I                 D+S   V    +Y++    L  G L A M
Sbjct: 1073 VAVQRWVSISLDMIAVAFALIITLLCVTRQFDISAASVGVLLTYVLQLPGLLNGLLRA-M 1131

Query: 440  LYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKFIPGDGCIEFRNL 499
               +   NS+  + N+ +E+ Q   AA R  ++T + P           P +G + F N+
Sbjct: 1132 TQAENDMNSVERIVNYATELPQE--AAYRKPEMTPQEPW----------PSNGEVVFDNV 1179

Query: 500  GFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQ 558
              +Y P  P   V K ++  I+ G  + I G +G GKSTI   L R    + G++LID  
Sbjct: 1180 SLSYRPGLP--LVLKGVSLNIKGGEKIGICGRTGAGKSTIMSALYRLCELNEGRVLIDGV 1237

Query: 559  DIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT-YG----------LKREAT--PDEIRE 605
            D  KL    LR+ + I+ Q+PVL  GSIR N+  +G          L R  T   +E+ +
Sbjct: 1238 DTSKLGLYDLRRKLSIIPQDPVLFKGSIRKNLDPFGEREDEELWSALVRSGTIEAEEVEK 1297

Query: 606  VSKQ----CFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEAT 661
            V  Q          + KF    E  +   GT  S G++Q +A+ RAL+++ KILILDEAT
Sbjct: 1298 VKNQHRDESGSSTGLHKFHLDQE--VEDDGTNFSLGERQLLALTRALVRQSKILILDEAT 1355

Query: 662  SALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
            S++D E++  I     +  +    TI+ IAHRL TI   + ++VL N G+V E
Sbjct: 1356 SSVDHETDAKIQSLIAQ--EFNRCTILCIAHRLKTILNYDRLVVLDN-GTVKE 1405

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 76/250 (30%), Positives = 119/250 (47%), Gaps = 27/250 (10%)

Query: 500 GFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQD 559
            FA   +     FKNLNF+I+ G  V I G  G GKS++   L  +   + G       D
Sbjct: 559 AFASSEKASFSGFKNLNFQIQKGELVIITGSIGTGKSSLLNALAGFMKKTEG-------D 611

Query: 560 IMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIR--EVSKQCFCHNFIT 617
           I K     L  Y       P + + ++RDNI +G    ++ D++R  EV + C     + 
Sbjct: 612 IFKNGSLLLCGY-------PWIQNTTVRDNILFG----SSFDDVRYKEVIRVCALQADLD 660

Query: 618 KFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTF 676
             P    T IG  G  LSGGQK RI +AR++ K   I + D+  SA+D    +  ++   
Sbjct: 661 ILPAGDFTEIGERGITLSGGQKARINLARSVYKSMDIYLFDDVLSAVDARVGKHIMDECL 720

Query: 677 GKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLL--N 734
             ++  K+  + +  H+LS I R+  +I LG  GS  + G  +EL  +  S   KL+  +
Sbjct: 721 MGMLDGKTRILAT--HQLSLIERASRVIFLGAGGS-FDIGTVEEL-KERNSGFVKLMEFS 776

Query: 735 EKQSRANKKE 744
            +   AN++E
Sbjct: 777 TQTKSANQRE 786

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 133/533 (24%), Positives = 235/533 (44%), Gaps = 37/533 (6%)

Query: 226  LVIGTMC-NYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAY 284
             V+G++   + ++I + LL       L    +++ LH    F D   +G +++R   D  
Sbjct: 918  FVLGSLAFMFTQFISIGLLGTYASKHLNIKALQRLLHAPMSFMDVTPIGRVMNRFTKDTD 977

Query: 285  VVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLS---SFLVIFAPAVVISASIFGKKIR 341
             +   +T+ V      I              P  +    FLV     V       G++I+
Sbjct: 978  TLDNEITESVRLLIFQIANLTGIIILCIIYIPWFAIAMPFLVFLYVFVADHYQASGREIK 1037

Query: 342  DISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSK 401
             +  + +     +     E L G+ T++++ +EQ+ + + +  I  +   G +   +   
Sbjct: 1038 RMDAVQRSF---VYNNFNEVLGGMDTIKAYRSEQRFLMKSDFLINKMNEAGYLVTSIQRW 1094

Query: 402  FSTSTSVIGDMSFLVVLAYGSYLVLHGSL-TIGDLTAFMLYTDYTANSIFGLSNFYSEIM 460
             + S  ++  +  L++         H S  ++G +  ++L      N++       ++  
Sbjct: 1095 VAISLDMLAVIFALIIALLCVTRQFHVSAGSVGVMVTYVLQLPGLLNALLRSQ---TQTE 1151

Query: 461  QGVGAAKRLFDLTDRIPA-----IRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQV-FKN 514
              + +A+RL +    +P      I  T   +  P +G I+F N+  AY  RPE  V  KN
Sbjct: 1152 NDLNSAERLVNYAYDLPIEAKYRILETQPPEQWPSEGRIKFENVSLAY--RPELPVALKN 1209

Query: 515  LNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGI 574
            ++  I     + I G +G GKSTI   L R     +G+I ID+ DI  L    LR  + I
Sbjct: 1210 VSIDIGSNEKIGICGRTGAGKSTIMSALYRLVELKTGKITIDDIDISTLGLYELRSKLAI 1269

Query: 575  VQQEPVLMSGSIRDN-----------ITYGLKREATPD--EIREVSKQCFCHNFIT--KF 619
            + Q+PVL  G IR N           +   L R    D  ++  +  Q    N ++   F
Sbjct: 1270 IPQDPVLFKGDIRRNLDPFQECTDEQLWDALVRGGAIDRKDVDSIRAQHKDANGLSGDMF 1329

Query: 620  PDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKL 679
                + ++   G+  S G++Q +A+ RAL++  KILILDEATS++D  ++  I      +
Sbjct: 1330 KFHLDQMVEDDGSNFSLGERQLLALTRALVRGSKILILDEATSSVDYATDAKIQSRI--V 1387

Query: 680  MKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKL 732
             +  + TI+ IAHRL TI     I+VL + G VVE    K+LY D  S  +++
Sbjct: 1388 EEFSNCTILCIAHRLKTILAYNRILVL-DQGQVVEFDTPKKLYNDRDSIFNEM 1439

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 98/201 (48%), Gaps = 19/201 (9%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           F  LNF ++    + I GP G GKS++   L  +   SSG + I   D++      L  Y
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKG-DLL------LCGY 644

Query: 572 MGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHG 631
                  P + + +++DNI +G   +    + ++V + C     +   P    T IG  G
Sbjct: 645 -------PWVQNATVKDNILFGSPFDKP--KYQKVIEICSLQADLDILPAGDRTEIGERG 695

Query: 632 TLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGKLMKSKSVTIVSI 690
             LSGGQK RIA+AR++ K   I + D+  SA+D    +  ++      +K K+  + + 
Sbjct: 696 ITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQKTRILAT- 754

Query: 691 AHRLSTIRRSEYIIVLGNDGS 711
            H+LS I ++  +I LG DGS
Sbjct: 755 -HQLSLIDKASRVIFLGLDGS 774

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  124 bits (310), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 126/468 (26%), Positives = 208/468 (44%), Gaps = 39/468 (8%)

Query: 266  FFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIF 325
            FF+   +G +++R  +D Y V   L +  +  F  ++              Q   F+ I 
Sbjct: 1043 FFETTPIGRILNRFSNDIYKVDEILGRTFAQFFANVVKVSFTIVVICMATWQ---FIFIV 1099

Query: 326  APAVVISASIF------GKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIR 379
             P  V+            +++R + ++ +     +    +E L G+ T++ +  + + + 
Sbjct: 1100 LPLSVLYIYYQQYYLRTSRELRRLDSVTRSP---IYAHFQETLGGLTTIRGYSQQNRFVH 1156

Query: 380  ----RYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLT---I 432
                R +N +   Y     S   N   +     IG +  L         + +G+LT   I
Sbjct: 1157 INQTRVDNNMSAFYP----SVNANRWLAFRLEFIGSVIILAASMLAVIRLGNGTLTAGMI 1212

Query: 433  GDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAI----RPTIGEKFI 488
            G   +F L    + N I  ++      +  V   K   +L    P I    RP       
Sbjct: 1213 GLSLSFALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKSEAPYIIKDHRPPAS---W 1269

Query: 489  PGDGCIEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYN 547
            P  G I+F N    Y  RPE + + K+++  I P   + IVG +G GKS++ L L R   
Sbjct: 1270 PESGEIKFVNYSTRY--RPELELILKDIDLHIHPKEKIGIVGRTGAGKSSLTLALFRIIE 1327

Query: 548  PSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVS 607
             +SG I+ID   I  +    LR  + I+ Q+  +  G++R+NI        T +EI    
Sbjct: 1328 AASGHIVIDGIPIDSIGLADLRHGLSIIPQDSQIFEGTVRENI--DPTNRYTDEEIWNAL 1385

Query: 608  KQCFCHNFITKF-PDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDV 666
                  + I     +  ET++   G+ LS GQ+Q + +ARAL+    ILILDEAT+A+DV
Sbjct: 1386 ALSHLKDHILGMGSNGLETMLTEGGSNLSVGQRQLMCLARALLISSNILILDEATAAVDV 1445

Query: 667  ESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
            E++  I  T     K +  TI++IAHR++TI  S+ IIVL + G V E
Sbjct: 1446 ETDQLIQKTIRNAFKER--TILTIAHRINTIMDSDRIIVL-DKGRVTE 1490

 Score =  110 bits (275), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 109/427 (25%), Positives = 191/427 (44%), Gaps = 75/427 (17%)

Query: 355 TRVSEEQLNGVKTVQSFVAE-----QKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVI 409
           TRV+ E LN +K+++ +  E     + +  R    ++++  +G   A+ N +F+    ++
Sbjct: 482 TRVTSEILNNIKSLKVYGWEIPYKAKLDHVRNEKELKNLKKMGCTLALANFQFNIVPFLV 541

Query: 410 GDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLS---NFYSEIMQGVGAA 466
              +F  V  Y     L   L    LT F L +       F L+   N  S  ++   + 
Sbjct: 542 SCSTF-AVFVYTEERPLSTDLVFPALTLFNLLS-------FPLAVVPNAISSFIEASVSI 593

Query: 467 KRLF----------DLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQV-FKNL 515
            RLF          D   R P ++         GD  ++  +  F +  +PE +V  KN+
Sbjct: 594 NRLFAFLTNEELQNDAVLREPKVKNI-------GDEGVKVNDATFLWQRKPEYKVALKNI 646

Query: 516 NFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP-KSLRQYMGI 574
           NF  + G   CIVG  G GKS +   LL               D++++    ++   +  
Sbjct: 647 NFVAKKGELTCIVGKVGSGKSALIQSLL--------------GDLIRVKGFATVHGDVAN 692

Query: 575 VQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLL 634
           V Q P +M+G+++DNI +G K +  P+  +   K C     ++  PD  +T++G  G  L
Sbjct: 693 VSQVPWIMNGTVKDNILFGHKYD--PEFYQLTIKACALSIDLSMLPDGDQTLVGEKGISL 750

Query: 635 SGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFG---------KLMKSKS 684
           SGGQK R+++ARA+  +    +LD+  +A+D   ++  I +  G         K++ +  
Sbjct: 751 SGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLLHSKTKVLATNK 810

Query: 685 VTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKE 744
           +T++SIA            I L  +G +++ G + ++     S LSKL+ E      KK 
Sbjct: 811 ITVLSIADS----------ITLMENGEIIQQGSYDQVNESTNSPLSKLIAE----FGKKG 856

Query: 745 APLPPQS 751
            P P QS
Sbjct: 857 KPTPSQS 863

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  123 bits (309), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 135/510 (26%), Positives = 218/510 (42%), Gaps = 47/510 (9%)

Query: 250  RLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXX 309
            +L   + +  L     FF+   VG +I+R  SD  VV + L    +  F  IL       
Sbjct: 1048 KLHDTMARAVLRSPMSFFETTPVGRIINRFSSDVNVVDQGLQFSFTYFFIYILNYLFTVI 1107

Query: 310  XXXXXXPQLSSF------LVIFAPAVVISASIFGKKIRDIS-----TILQEATGQLTRVS 358
                  P    F      L  +     I+ S   K++  IS     ++L E  G      
Sbjct: 1108 LISFNMPLFLLFNGILLVLYFYYQIYYITLSRELKRLTSISYSPIMSLLSETLG-----G 1162

Query: 359  EEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVL 418
               +N  K +Q F     E  ++N  I  ++N        N   S     IG +  L+  
Sbjct: 1163 HLVINAYKHLQRFTYLNNESIQFN--INCMFNFRS----TNRWLSMRLQTIGAVLVLLTA 1216

Query: 419  AYGSYLV-LHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIP 477
                  +    +L+ G +   M Y      S+  +     ++   + + +R+ +  +  P
Sbjct: 1217 LLSLSTINTDKALSSGMVGLLMSYALQVTTSLTWIVRMSVQVETDIVSVERILEYCNLPP 1276

Query: 478  AIRPTIGE----KFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGR 533
                 I E    K  P  G I F+N    Y    +  V K++  +I+P   + IVG +G 
Sbjct: 1277 EADAIIEESRPPKEWPSRGAITFQNYSTKYRENLD-PVLKDITVEIKPQEKIGIVGRTGA 1335

Query: 534  GKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDN---- 589
            GKST++L L R   PS G I+ID  DI KL    LR  + I+ Q+     G+I+ N    
Sbjct: 1336 GKSTLSLALFRLLEPSGGSIVIDGIDIAKLGLSDLRGNLAIIPQDAQAFEGTIKSNLDPF 1395

Query: 590  -------ITYGLKREATPDEIREVSKQCFCHN--FITKFPDAYETI---IGPHGTLLSGG 637
                   I   L+       I +++ +    N    T+   ++E +   I  +G  LS G
Sbjct: 1396 GQYSDEEIWRALELSHLKPHILKMASEENTENSETTTEATRSHELLSARITENGGNLSIG 1455

Query: 638  QKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTI 697
            Q+Q + ++RAL+   KIL+LDEAT+A+D+E++  I  T     K +  TI++IAHR+ T+
Sbjct: 1456 QRQLLCLSRALLNHSKILVLDEATAAVDMETDKIIQETIKTAFKDR--TILTIAHRIDTV 1513

Query: 698  RRSEYIIVLGNDGSVVETGKFKELYADPTS 727
              S+ I+VL + G V E      L AD ++
Sbjct: 1514 MDSDKIMVL-DKGEVKEFDTPTNLLADKST 1542

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 122/240 (50%), Gaps = 18/240 (7%)

Query: 512 FKNL-NFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQ 570
            KN+ +F+   G   CIVG  G GKST    +L      SG   +D     KL  ++  +
Sbjct: 645 LKNIRHFEARKGDLTCIVGRVGSGKSTFLQAILGQLPCISG---LDEHVPPKLIIRA--K 699

Query: 571 YMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPH 630
            +    Q+P +M+ S++DN+ +G       D  +   ++C     +   PD  +T++G  
Sbjct: 700 SIAYCPQQPWIMNASLKDNVIFG--HRLNEDYYKATIRKCQLLPDLDILPDGDQTLVGEK 757

Query: 631 GTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-----SEGAINYTFGKLMKSKSV 685
           G  LSGGQK R+++ARA+  +  + +LD+  SA+D E      E  +N   G ++K+K+V
Sbjct: 758 GISLSGGQKARLSLARAVYARADVYLLDDILSAVDAEVSKNIVEQVLNRGTG-ILKNKTV 816

Query: 686 TIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKE-LYADPTSELSKLLNEKQSRANKKE 744
            + + A  +S ++ S+ I  L  DG +VE   + + +  D +S L  L+ E  S  N +E
Sbjct: 817 ILTTNA--VSVLKHSQNIYALL-DGEIVENKSYADAMSCDDSSILKTLIQEFDSNENSRE 873

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  123 bits (308), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 125/520 (24%), Positives = 226/520 (43%), Gaps = 29/520 (5%)

Query: 215  LYPFLGAFAGALVIGTMCNYGRYILLRLL-SERVVARLRSHVIKKTLHQDAEFFDQNKVG 273
            ++ ++  +A   V  +     R I++ L  S R      + +    +     FF+   VG
Sbjct: 1030 IWKYVAVYALIGVTSSAFELARTIIMMLFCSIRASKLFHNQMAHSVVMAPMSFFETTPVG 1089

Query: 274  DLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISA 333
             +++R  SD   +       +S  F+++L             P    F  I         
Sbjct: 1090 RIVNRFSSDVNSIDEDFQHIISFFFRSMLDYLITIVIITVSMPWFLLFNTILLGIYYYYQ 1149

Query: 334  SIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNN------AIRD 387
            +++    R++  +   +   +  +  E L G   + ++  +   I  Y N       I  
Sbjct: 1150 TLYVVLSRELKRLTSISYSPVMSLLSETLGGHVVINAY--KHANIFNYYNFENIQTNINF 1207

Query: 388  IYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTAN 447
            I+N    +  ++ +  T  +VI  ++ L+ LA    L     ++ G +   M Y    ++
Sbjct: 1208 IFNFRSTNRWLSMRLQTIGAVIVLITSLMALAS---LGTSNPISAGLIGLLMSYALQVSS 1264

Query: 448  SIFGLSNFYSEIMQGVGAAKRLFDLTDRIP----AIRPTIGEKFIPGDGCIEFRNLGFAY 503
            S+  +      I   + + +R+ +  D  P     I  +   K  P  G I F +    Y
Sbjct: 1265 SLMWIIRMAVNIETTIVSVERIIEYRDLKPEGIRVIEDSRPPKNWPKRGEITFEHYTTKY 1324

Query: 504  PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKL 563
                +  V K+++ +I+    + +VG +G GKST+ L L R   P  G+I ID  DI  L
Sbjct: 1325 RENLD-PVLKDIDLRIKHQEKIGVVGRTGAGKSTLTLALFRILEPFEGKITIDGIDISTL 1383

Query: 564  NPKSLRQYMGIVQQEPVLMSGSIRDNIT-YGLKREATPDEIREVSK-QCFCHNFITKFP- 620
                LR+ + I+ Q+     G++R N+  +    +A   +  E+S  +      +++ P 
Sbjct: 1384 GLYDLRRSLSIIPQDAQAFEGTVRSNLDPFNRHTDAEIWKALELSHLKPHIERIVSELPD 1443

Query: 621  ------DAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINY 674
                  D  +T I  +G  LS GQ+Q + ++RAL+   KILILDEAT+A+D E++  I  
Sbjct: 1444 DENKPTDLLDTQISDNGNNLSMGQRQLLCLSRALLNPSKILILDEATAAVDRETDKIIQE 1503

Query: 675  TFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
            T     K +  TI++IAHR+ T+  S+ I+VL + G V E
Sbjct: 1504 TIRTAFKDR--TILTIAHRIDTVLDSDKIMVL-DKGEVKE 1540

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 108/433 (24%), Positives = 195/433 (45%), Gaps = 64/433 (14%)

Query: 360 EQLNGVKTVQSFVAEQKEIRRYNNAIRDI--YNIGKMSAVVNSKFSTSTSV--IGDMSFL 415
           E LN +K+++ +  E+  + R N+   D+  +N+ K++ V N  F     V  +   S  
Sbjct: 473 EILNSMKSIKLYAWEKPMLDRLNHVRNDLELHNMKKIAIVSNFMFFCWNIVPLLVTCSTF 532

Query: 416 VVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL------ 469
           V+ +Y +  VL   +    LT F +  D    ++F +    S I++   + KRL      
Sbjct: 533 VLFSYLTDQVLSPQIIFPSLTLFSMLND----ALFTVPTMISNIIEIGVSLKRLKGYLLA 588

Query: 470 --FDLTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYP----------TRPENQV------ 511
              D T  I   R T        D  +E  N  F +           T  E ++      
Sbjct: 589 EELD-TSFIEHARAT------ASDPTVEISNAVFLWKSPKSAASSEDTDEEAEISSPGVA 641

Query: 512 FKNL-NFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI-LIDNQDIMKLNPKSL- 568
            K++ NF  +     CIVG  G GKST    +L       GQ+  + +     + PK + 
Sbjct: 642 LKSIENFSAKKAQLTCIVGRVGSGKSTFLQAIL-------GQLPCVSSDSASGVKPKVVI 694

Query: 569 -RQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETII 627
               +    Q+P +M+ S++DNI +G K +      ++  K C     +   PD  +T++
Sbjct: 695 RADNLAYCPQQPWIMNASLKDNILFGYKYDEA--MYKKTIKACQLLPDLEILPDGDQTLV 752

Query: 628 GPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGK---LMKSK 683
           G  G  LSGGQK R+++ARA+  +  + +LD+  SA+D    +  I+    +   L+K+K
Sbjct: 753 GEKGISLSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQKGLLKNK 812

Query: 684 SVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYAD-----PTSELSKLLNEKQS 738
           +V + + A  ++ +  S+ I +L N G +VE+  ++E+ +        S L +++ E  S
Sbjct: 813 TVILTTNA--VNVLVHSDMIYLLKN-GKIVESNSYEEVMSKDRNNGEKSSLREIIEEFAS 869

Query: 739 RANKKEAPLPPQS 751
             +++ A    +S
Sbjct: 870 NESEETAEKKSES 882

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  122 bits (305), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 118/460 (25%), Positives = 208/460 (45%), Gaps = 23/460 (5%)

Query: 266  FFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIF 325
            FF+   +G +++R  +D Y V   L +  +  F  +               Q    ++  
Sbjct: 1042 FFETTPIGRILNRFSNDIYKVDELLGRTFAQFFVNVTKVSFTIIVICVTTWQFIFLILPM 1101

Query: 326  APAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAI 385
                V     + +  R++  +       +    +E L G+ T++ +  +Q++   + N  
Sbjct: 1102 IVLYVYYQQYYLRTSRELRRLDSVTKSPVYAHFQESLGGLSTIRGY--DQQDRFTHINQS 1159

Query: 386  RDIYNIGKMSAVVNSK--FSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTD 443
            R   N+      VN+    +     IG +      +     +  GSLT G +   + Y  
Sbjct: 1160 RIDNNMSAFYPSVNANRWLAFRLEFIGTIIIFGAASLSMLRLKAGSLTPGMIGLSLSYAL 1219

Query: 444  YTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEKF-----IPGDGCIEFRN 498
                S+  +     E+   + + +R+ + ++ I +  P + E        P  G I+F +
Sbjct: 1220 QITQSLNWIVRMTVEVETNIVSVERIKEYSE-IKSEAPLVIEDHRPPADWPSKGDIKFEH 1278

Query: 499  LGFAYPTRPE---NQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILI 555
                Y TR     N V K++N  ++P   + IVG +G GKS++ L L R    + G+I+I
Sbjct: 1279 ----YSTRYRENMNLVLKDINLHVKPQEKIGIVGRTGAGKSSLTLALFRIIEAAEGRIVI 1334

Query: 556  DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNF 615
            D   I ++    LR  + I+ Q+  +  G++R+NI      + + +EI  V +     N 
Sbjct: 1335 DGVPINEIGLHDLRHKLSIIPQDSQVFEGTVRENI--DPTNQYSDEEIWRVLELSHLKNH 1392

Query: 616  ITKFP-DAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINY 674
            +     D   T +   G  LS GQ+Q + +ARAL+   +ILILDEAT+A+DVE++  I  
Sbjct: 1393 VLSMSKDGLMTRLTEGGANLSVGQRQLMCLARALLIPSRILILDEATAAVDVETDQVIQE 1452

Query: 675  TFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
            T     K +  TI++IAHRL+TI  S+ I+VL + G V E
Sbjct: 1453 TIRTAFKDR--TILTIAHRLNTIMDSDRILVL-DAGEVRE 1489

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 129/579 (22%), Positives = 242/579 (41%), Gaps = 83/579 (14%)

Query: 203 TSDLPPI-AFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLH 261
           T +LP +  F L++  FL +F    ++     Y     + + S      L S + KK L 
Sbjct: 342 TKELPIVRGFMLSIAMFLVSFTQTSILHQYFLYSFNTGMNIKSA-----LTSTIYKKALV 396

Query: 262 QDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKV----SDGFKAILCXXXXXXXXXXXXPQ 317
              E  D +  GD+++ +  D   + + LTQ      S  F+ +LC              
Sbjct: 397 LSNEAADMSSTGDIVNLMSVDVQRL-QDLTQYCHLIWSGPFQILLCLVSLYKLLGRSMWI 455

Query: 318 LSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAE--- 374
               LVI  P      S+  +  + +  +  +   + +R+  E LN +K+++ +  E   
Sbjct: 456 GVIILVIMMPL----NSMLMRIQKKLQKVQMKNKDERSRLISEILNNIKSLKLYSWEAPY 511

Query: 375 --QKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTI 432
             + E  R +  ++++  +G   A+ + +F+    ++   +F  V  Y     L   L  
Sbjct: 512 KAKLEHVRNDKELKNLTKMGVYMALTSFQFNIVPFLVSCSTF-AVFVYTEKKPLTTDLVF 570

Query: 433 GDLTAFMLYTDYTANSI-FGLSNFYSEIMQGVGAAKRLF----------DLTDRIPAIRP 481
             L  F L + +  N +   L+ F    ++   +  RL+          D    +P  + 
Sbjct: 571 PALALFNLLS-FPLNVVPMVLTAF----IEASVSVNRLYSFLTNEELQKDAVHHLPKAQK 625

Query: 482 TIGEKFIPGDGCIEFRN-LGFAYPTRPENQV-FKNLNFKIEPGTSVCIVGPSGRGKSTIA 539
                   GD  I+  +   F +  +P+ QV  KN+N +++ G   C+VG  G GKS + 
Sbjct: 626 A-------GDVAIKISDDANFLWKRKPQYQVALKNINLEVKKGELACVVGKVGSGKSALV 678

Query: 540 LLLLRYYNPSSGQILIDNQDIMKLNP-KSLRQYMGIVQQEPVLMSGSIRDNITYGLKREA 598
             LL               D+ ++    ++      V Q P +M+G+++DNI +G K + 
Sbjct: 679 QSLL--------------GDLYRVKGYAAVHGSTAYVSQVPWIMNGTVKDNILFGHKYDP 724

Query: 599 TPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILD 658
              ++    K C     +   PD  +T++G  G  LSGGQK R+++ARA   +    +LD
Sbjct: 725 VFYDL--TIKACALTIDLGILPDGDQTMVGEKGISLSGGQKARLSLARATYARADTYLLD 782

Query: 659 EATSALDVE-SEGAINYTFG---------KLMKSKSVTIVSIAHRLSTIRRSEYIIVLGN 708
           +  +A+D   ++  I +  G         KL+ +  +T++SIA  +S +           
Sbjct: 783 DPLAAVDEHVAQHLIEHVLGPRGLLKSKTKLLATNKITVLSIASSISLVE---------- 832

Query: 709 DGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEAPL 747
            G +++ G ++++  D  S LS L+ E   +     A L
Sbjct: 833 GGEIIQHGSYEDISKDLDSPLSNLVKEFGKKKTSSSADL 871

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  114 bits (286), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 80/262 (30%), Positives = 134/262 (51%), Gaps = 34/262 (12%)

Query: 489 PGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNP 548
           P  G +E +NL   Y     ++   N++FK++ GT V IVG +G GKS+I   + R  + 
Sbjct: 28  PQTGDVELKNLSLRYSPH-SSKALDNVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDW 86

Query: 549 SSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT----------YGLKREA 598
            +G I IDN+DI  +  + LR  +  + Q+P L  G++R N+           YG+  + 
Sbjct: 87  ENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRSNLDPFDRYSDVQIYGVLSKV 146

Query: 599 TPDEIREVSKQCF----------CHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARAL 648
               I E  + C            H    +F D   T++   G+ LS GQ+Q + +AR++
Sbjct: 147 GL--IEECDELCLIFEQEQPNFSSHKLRNRFID-LNTVVKSGGSNLSQGQRQLLCLARSM 203

Query: 649 IKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGN 708
           +    I+++DEAT+++D  S+  I  T  + M  K+ TI++IAHRL ++   + I+V+  
Sbjct: 204 LGARNIMLIDEATASIDYISDAKIQKTIRETM--KNTTILTIAHRLRSVIDYDKILVM-- 259

Query: 709 DGSVVETGKFKELYADPTSELS 730
                E G+ KE Y  P + +S
Sbjct: 260 -----EMGRVKE-YDHPYTLIS 275

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  120 bits (301), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 140/562 (24%), Positives = 246/562 (43%), Gaps = 67/562 (11%)

Query: 200  SLETSDLPPI---AFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVI 256
            S  T D  P    +F + LY F   F G + + +     ++ ++  +      +L    +
Sbjct: 904  SFWTEDKFPTRSTSFYMGLYSFF-VFGGYIFMTS-----QFTIVCFIGVNASKKLNLSAV 957

Query: 257  KKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXP 316
            ++ LH    F D   +G +++R   D    + SL  ++++  + +L              
Sbjct: 958  RRILHTPMAFLDTTPLGRILNRFTKD----TDSLDNELTENVRLMLAQFANIIG------ 1007

Query: 317  QLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVS-----------EEQLNGV 365
             +    +I+ P   I+          +S   Q A  ++ R+             E L G+
Sbjct: 1008 -VCVMCIIYLPWFAIAIPFILLIFVLVSNHYQSAGREIKRLEAIQRSFVYNNLNEVLGGM 1066

Query: 366  KTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLV 425
             T++ + +E++ + + +  I  +   G +   V    +    +I     L++        
Sbjct: 1067 DTIRFYNSEERFMAKSDYLIDKMNEAGYLVVCVQRWVAVLLDMIAVCFALIIALLCVTRQ 1126

Query: 426  LHGSLT-IGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIP---AIR- 480
             H S + +G L  ++L      N++       ++    + + +RL      +P   A R 
Sbjct: 1127 FHISASSVGVLLTYVLQLPGLLNTVL---RALTQTENDMNSVERLVSYATELPTEAAYRK 1183

Query: 481  -PTIGEKFIPGDGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTI 538
              +  +   P +G I+F  + FAY P  P   V KNL+  I  G  + I G +G GKSTI
Sbjct: 1184 PESSPDPSWPQEGKIDFEEVSFAYRPGLP--AVLKNLSMSINGGEKIGICGRTGAGKSTI 1241

Query: 539  ALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT-YG---- 593
               L R     SG+I+ID  +I  +    LR+ + I+ Q+PVL  G+IR N+  +G    
Sbjct: 1242 MSALYRLNELESGRIIIDGVNISNIGLFDLRRSLSIIPQDPVLFRGTIRKNLDPFGERSD 1301

Query: 594  ------LKREATPDE--IREVSKQCFCHNF----ITKFPDAYETIIGPHGTLLSGGQKQR 641
                  L R  + D+  + EV  Q    N     + KF    E  +   G+  S G++Q 
Sbjct: 1302 DELWDALSRGGSIDKESLEEVKTQKSTGNSKVQELHKFHLDQE--VEEEGSNFSLGERQL 1359

Query: 642  IAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKS-VTIVSIAHRLSTIRRS 700
            +A+ARAL++  K+LILDEATS++D E++  I     +++++ S  TI+ IAHRL TI   
Sbjct: 1360 LALARALVRNSKVLILDEATSSVDYETDNKIQ---NRIIEAFSECTILCIAHRLKTILNY 1416

Query: 701  EYIIVLGNDGSVVETGKFKELY 722
            + I+VL   G + E      LY
Sbjct: 1417 DRILVL-EKGEIAEFDSPYNLY 1437

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 100/217 (46%), Gaps = 32/217 (14%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           FK++N +I  G  + I GP G GK+++   +      + G + I+ + +M          
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGELLMG--------- 654

Query: 572 MGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHG 631
                  P + + ++RDNI +G   + +   +  V K C     +   P    T IG  G
Sbjct: 655 -----GYPWIQNATVRDNIIFGSPFDKSKYNM--VVKACCLDADLDILPAGDMTEIGERG 707

Query: 632 TLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSV------ 685
             LSGGQK RI +AR + K   I + D+  SA+D           GKL+  + +      
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSR--------VGKLIMDECLLGLLNG 759

Query: 686 -TIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
            T V   H+LS +  +  +IVLGNDGS V+ G  +EL
Sbjct: 760 KTRVLATHQLSLVENASRVIVLGNDGS-VDIGTVEEL 795

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  120 bits (301), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 134/532 (25%), Positives = 224/532 (42%), Gaps = 57/532 (10%)

Query: 214  TLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVG 273
            T + F   FA       +C  G       LS      L++  +K+ LH    F D   +G
Sbjct: 933  TFFVFFNYFATTSQFSVLCYMG-------LSAAKWLNLKA--VKRLLHTPMSFLDTTPIG 983

Query: 274  DLISRLGSDAYVVSRSLTQKV-------SDGFKAILCXXXXXXXXXXXXPQLSSFLVIFA 326
             +++R   D   +   LT+ V       S+    ++             P L   L+IFA
Sbjct: 984  RVLNRFTKDTDTLDTELTESVRLFLFQASNIVGVVIMCIIYLPWFAIAVPFL---LLIFA 1040

Query: 327  PAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIR 386
                  A  +    R+I  +       +     E L+G+ T++++  E + + + +  I 
Sbjct: 1041 AV----ADHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMDTIRAYRGEARFLTKSDFLIN 1096

Query: 387  DIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTA 446
             +   G +   +    S +  +I  M+F +++   + L +    +I   +  +L T Y  
Sbjct: 1097 KMNEAGYVVVAIQRWVSIALDMIA-MAFALII---TLLCVTRQFSISAASVGVLLT-YVL 1151

Query: 447  NSIFGLSNFYSEIMQG---VGAAKRLFDLTDRIPAI----RP-TIGEKFIPGDGCIEFRN 498
                 L+     + QG   + +A+RL      +P      RP T   +  P +G I+F +
Sbjct: 1152 QLPGLLNTLMRAMTQGENDMNSAERLISYATDLPLEAAYRRPETSPPESWPSEGAIDFDH 1211

Query: 499  LGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDN 557
            +  AY P  P   V  +++  +  G  + I G +G GKSTI   L R      G I ID 
Sbjct: 1212 VSLAYRPGLP--LVLHDVSLHVRGGEKIGICGRTGAGKSTIMSALYRMIELHDGSITIDG 1269

Query: 558  QDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKRE--------------ATPDEI 603
             DI +L    LR  + I+ Q+PVL  G +R N+    +R               AT DE 
Sbjct: 1270 IDIAQLGLYELRSKLAIIPQDPVLFKGDVRKNLDPFHERSDNELWDALVRAGAIATEDEA 1329

Query: 604  REVSKQCFCHNFITKFPDAY-ETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATS 662
               +        +T     + E  +   G+  S G++Q +A+ RAL++  +ILILDEATS
Sbjct: 1330 AARAVTRATAGALTNLHKFHLEQEVEEDGSNFSLGERQLLALTRALVRSSRILILDEATS 1389

Query: 663  ALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
            ++D E++  I             T++ IAHRL+TI   + I+VL + G V E
Sbjct: 1390 SVDYETDAKIQARIADAF--SECTVLCIAHRLNTILDYDRILVL-DQGRVCE 1438

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 70/215 (32%), Positives = 99/215 (46%), Gaps = 28/215 (13%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           FKNLN +I  G  V + G  G GKS++   +  +    SG       DI K     L  Y
Sbjct: 594 FKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSG-------DIYKNGSLLLCGY 646

Query: 572 MGIVQQEPVLMSGSIRDNITYGLKREATP-DEIR--EVSKQCFCHNFITKFPDAYETIIG 628
                  P + + +++DNI +G     +P DE R  E  + C     +   P   +T IG
Sbjct: 647 -------PWIQNTTVKDNILFG-----SPFDEARYKETIRVCSLQADLDLLPAGDKTEIG 694

Query: 629 PHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTFGKLMKSKSVT 686
             G  LSGGQK RI +AR++ KK  I + D+  SA+D      I      G L      T
Sbjct: 695 ERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDECMMGAL---DGKT 751

Query: 687 IVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
            V   H+LS I R+  +I +  DG+ V++G   EL
Sbjct: 752 RVLATHQLSLIARASKVIFIDLDGT-VDSGTLDEL 785

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 131/498 (26%), Positives = 216/498 (43%), Gaps = 54/498 (10%)

Query: 251 LRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXX 310
           L    +K  LH    F D   +G +++R   D   +   LT+ +      +         
Sbjct: 482 LNLKAVKGILHTPLSFMDTTPLGRILNRFTKDTDSMDNELTEDIRLMMFQLGNIIGVIVM 541

Query: 311 XXXXXPQLS---SFLVIFAPAVVISASIFGKKIRDISTILQE-ATGQLTRVSEEQLNGVK 366
                P  +    FL+I    +       G++++ +  + +      L  V    L G+ 
Sbjct: 542 CIVYLPWFAIAVPFLLIMFVMIADHYQSSGREVKRLEAVQRSFVYNNLNEV----LGGLD 597

Query: 367 TVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVV--LAYGSYL 424
           T++++ ++ + + + +  I  +   G M A +    +    ++  +  L++  L      
Sbjct: 598 TIRAYRSQDRFLVKSDFLINKMNEAGYMVAALQRWVAIFLDMLAVIFALIITLLCVTRQF 657

Query: 425 VLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL----FDLTDRIPAIR 480
            +  S T G L  ++L      N++       ++   G+ +A+RL     DL       R
Sbjct: 658 KISPSST-GVLLTYVLQLPGLLNTVL---RALTQAENGMNSAERLVTYALDLPQEAEYRR 713

Query: 481 PTIG--EKFIPGDGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKST 537
           P +   E + P  G I+F  + FAY P+ P   V KN +  I  G  + I G +G GKST
Sbjct: 714 PEMSPPENW-PDRGEIKFEGVSFAYRPSLP--PVLKNFSLNIGSGEKIGICGRTGAGKST 770

Query: 538 IALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT-YGLKR 596
           I   L R      G+I IDN +I  L    LR  + I+ Q+PVL  G+I+ N+  +G K 
Sbjct: 771 IMSALYRINEVIDGKIFIDNINIADLGLFELRSKLAIIPQDPVLFRGTIKKNLDPFGEKT 830

Query: 597 EA------------TPDEIREVSKQ----CFCHNFITKFPDAYETIIGPHGTLLSGGQKQ 640
           +              P++I E   Q       H+ + KF    E  +   G   S G+KQ
Sbjct: 831 DQELWESLVRGGAIAPEDIEETKAQQPDASGSHSKMHKF--HLEQKVEEEGGNFSLGEKQ 888

Query: 641 RIAIARALIKKPKILILDEATSALDVESEGAIN----YTFGKLMKSKSVTIVSIAHRLST 696
            +A+ RAL++  +ILILDEATS++D E++  I       FG        TI+ IAHRL+T
Sbjct: 889 LLALTRALVRNSRILILDEATSSVDYETDDKIQSRIVEAFG------DCTILCIAHRLNT 942

Query: 697 IRRSEYIIVLGNDGSVVE 714
           I   + I+VL   G V E
Sbjct: 943 ILNYDRILVL-EQGEVAE 959

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/245 (29%), Positives = 118/245 (48%), Gaps = 32/245 (13%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           F+NLNF I+ G  + + GP G GK+++   +  +   S G +        ++N + L   
Sbjct: 106 FQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSV--------EVNGRLLSCG 157

Query: 572 MGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHG 631
                  P + + ++RDNI +G   E    + R+V K C   + +   P    T IG  G
Sbjct: 158 Y------PWIQNATVRDNIIFGSPYEKA--KYRKVIKACSLDSDLEILPAGDMTEIGERG 209

Query: 632 TLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGKLMKSKSVTIVSI 690
             LSGGQK RI +AR + K   I + D+  SA+D    +  ++     L+  K+  + + 
Sbjct: 210 INLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLLGQKTRILAT- 268

Query: 691 AHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLL-----------NEKQSR 739
            H+L+ I ++  +IVLGNDGS    G ++EL     S+L KLL           N+++  
Sbjct: 269 -HQLALIEKATRLIVLGNDGSFT-IGTYEEL-QKSNSQLKKLLQFTSDKSEEDDNDQKQN 325

Query: 740 ANKKE 744
            N KE
Sbjct: 326 ENDKE 330

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 131/528 (24%), Positives = 223/528 (42%), Gaps = 37/528 (7%)

Query: 215  LYPFLGAFAGALVIGTMCNYGRYILLRLL-SERVVARLRSHVIKKTLHQDAEFFDQNKVG 273
            L+ F+G +A   +I    N  R I++ +  S R   +L  ++    ++    FF+   +G
Sbjct: 1013 LWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIG 1072

Query: 274  DLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISA 333
             +I+R   D   V   L    S  F+++L             P    F +          
Sbjct: 1073 RIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFFVFNIFLIVIYFYYQ 1132

Query: 334  SIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGK 393
            + +    R++  +       +  +  E L G   + ++   ++    Y N     +NI  
Sbjct: 1133 AYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINAYNHAKR--FSYFNFESVQFNIDC 1190

Query: 394  MSAV--VNSKFSTSTSVIGDMSFLVVLAYG----SYLVLHGSLTIGDLTAFMLYTDYTAN 447
            +      N   S     IG    L+VLA G    S +     LT G +   M Y+    N
Sbjct: 1191 LFNFRSTNRWLSVRLQAIGA---LIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQVTN 1247

Query: 448  SIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRP----TIGEKFIPGDGCIEFRNLGFAY 503
            S+  +     +I   + + +R+ +  +  P        T  EK  P  G I+F +    Y
Sbjct: 1248 SLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYSTKY 1307

Query: 504  PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKL 563
              +  + V   +N +IEP   + IVG +G GKST+ L L R    + G+I+ID  DI  L
Sbjct: 1308 -RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVDISTL 1366

Query: 564  NPKSLRQYMGIVQQEPVLMSGSIRDNIT-------YGLKREATPDEI----------REV 606
                LR  + I+ Q+     G+IR N+          L +      +          R+ 
Sbjct: 1367 GLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLKPHLERIISNRDD 1426

Query: 607  SKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDV 666
            + +    N   K  +  E  I  +G+ LS GQ+Q + ++RAL+   KIL+LDEAT+++D+
Sbjct: 1427 NSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATASVDM 1486

Query: 667  ESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
            E++  I  T       +  TI++IAHR+ T+   + I+VL + G V E
Sbjct: 1487 ETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVRE 1531

 Score = 91.3 bits (225), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 108/410 (26%), Positives = 189/410 (46%), Gaps = 45/410 (10%)

Query: 356 RVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIY--NIGKMSAVVNSKFSTSTSV--IGD 411
           R   E LN +K+++ +  E+  ++R ++   D+   +  K+  V N  F     V  +  
Sbjct: 469 RTLTEILNSIKSIKLYSWEKPMLKRLDHVRNDLELESFKKIGIVSNCIFFAWNCVPIMVT 528

Query: 412 MSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFD 471
            S  ++ A  S + L   +    L  F +  D    +I+ + +  + I++   +  RL +
Sbjct: 529 CSSFIIFALTSGMALTPDIVFPALALFNILND----AIYSVPSTITNIIEVSVSLGRLKN 584

Query: 472 LTDRIPAIRPTIGEKFIPGDG---CIEFRNLGFAYPTR-----PEN----------QV-F 512
                   R  I +     DG    +E  N  F +  +      EN          QV F
Sbjct: 585 FLATEELDRSFIEQSDPKNDGHSCAVEIDNATFLWKGKKNLVSSENGDEESTIDNTQVAF 644

Query: 513 KNLN-FKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSG-QILIDNQDIMKLNPKSLRQ 570
           KN+N F+++ G+  CIVG  G GK+T+   +L      SG Q  I  + I++ N      
Sbjct: 645 KNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGAQESIPPKLIIRGNS----- 699

Query: 571 YMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPH 630
            +    Q+  +M+ S+++NI +G K +     +    + C     +   PD  ETI+G  
Sbjct: 700 -IAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEACQLTEDLKMLPDGDETIVGEK 756

Query: 631 GTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGK---LMKSKSVT 686
           G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I     +   L+KSK  T
Sbjct: 757 GISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK--T 814

Query: 687 IVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKE-LYADPTSELSKLLNE 735
           I+   + +S ++ S+ I  L N   ++E G + + + +   S+L  L+NE
Sbjct: 815 IILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDVMNSSEDSKLKALINE 863

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  118 bits (296), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 131/528 (24%), Positives = 223/528 (42%), Gaps = 37/528 (7%)

Query: 215  LYPFLGAFAGALVIGTMCNYGRYILLRLL-SERVVARLRSHVIKKTLHQDAEFFDQNKVG 273
            L+ F+G +A   +I    N  R I++ +  S R   +L  ++    ++    FF+   +G
Sbjct: 1041 LWMFVGVYALIGIISAAFNNLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIG 1100

Query: 274  DLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISA 333
             +I+R   D   V   L    S  F+++L             P    F +          
Sbjct: 1101 RIINRFSGDLDSVDSGLQFIFSHFFRSLLGYIVTVILVGYNMPWFFVFNIFLIVIYFYYQ 1160

Query: 334  SIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGK 393
            + +    R++  +       +  +  E L G   + ++   ++    Y N     +NI  
Sbjct: 1161 AYYIVTSRELKRLTSITYSPIMSLISETLAGYLVINAYNHAKR--FSYFNFESVQFNIDC 1218

Query: 394  MSAV--VNSKFSTSTSVIGDMSFLVVLAYG----SYLVLHGSLTIGDLTAFMLYTDYTAN 447
            +      N   S     IG    L+VLA G    S +     LT G +   M Y+    N
Sbjct: 1219 LFNFRSTNRWLSVRLQAIGA---LIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQVTN 1275

Query: 448  SIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRP----TIGEKFIPGDGCIEFRNLGFAY 503
            S+  +     +I   + + +R+ +  +  P        T  EK  P  G I+F +    Y
Sbjct: 1276 SLMWIVRMSVQIETNIVSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYSTKY 1335

Query: 504  PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKL 563
              +  + V   +N +IEP   + IVG +G GKST+ L L R    + G+I+ID  DI  L
Sbjct: 1336 -RKNLDPVLNKINLEIEPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVDISTL 1394

Query: 564  NPKSLRQYMGIVQQEPVLMSGSIRDNIT-------YGLKREATPDEI----------REV 606
                LR  + I+ Q+     G+IR N+          L +      +          R+ 
Sbjct: 1395 GLSDLRSNLAIIPQDAQAFEGTIRTNLDPFDQHSDEELWKAIEASHLKPHLERIISNRDD 1454

Query: 607  SKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDV 666
            + +    N   K  +  E  I  +G+ LS GQ+Q + ++RAL+   KIL+LDEAT+++D+
Sbjct: 1455 NSESEETNVSAKDNNLLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATASVDM 1514

Query: 667  ESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
            E++  I  T       +  TI++IAHR+ T+   + I+VL + G V E
Sbjct: 1515 ETDKIIQETIRNEFSDR--TILTIAHRIDTVLGYDKILVL-DKGEVRE 1559

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 108/410 (26%), Positives = 189/410 (46%), Gaps = 45/410 (10%)

Query: 356 RVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIY--NIGKMSAVVNSKFSTSTSV--IGD 411
           R   E LN +K+++ +  E+  ++R ++   D+   +  K+  V N  F     V  +  
Sbjct: 497 RTLTEILNSIKSIKLYSWEKPMLKRLDHVRNDLELESFKKIGIVSNCIFFAWNCVPIMVT 556

Query: 412 MSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFD 471
            S  ++ A  S + L   +    L  F +  D    +I+ + +  + I++   +  RL +
Sbjct: 557 CSSFIIFALTSGMALTPDIVFPALALFNILND----AIYSVPSTITNIIEVSVSLGRLKN 612

Query: 472 LTDRIPAIRPTIGEKFIPGDG---CIEFRNLGFAYPTR-----PEN----------QV-F 512
                   R  I +     DG    +E  N  F +  +      EN          QV F
Sbjct: 613 FLATEELDRSFIEQSDPKNDGHSCAVEIDNATFLWKGKKNLVSSENGDEESTIDNTQVAF 672

Query: 513 KNLN-FKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSG-QILIDNQDIMKLNPKSLRQ 570
           KN+N F+++ G+  CIVG  G GK+T+   +L      SG Q  I  + I++ N      
Sbjct: 673 KNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVLGQLPCISGAQESIPPKLIIRGNS----- 727

Query: 571 YMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPH 630
            +    Q+  +M+ S+++NI +G K +     +    + C     +   PD  ETI+G  
Sbjct: 728 -IAYCPQQAWIMNSSVKENILFGHKYDEHYYNL--TIEACQLTEDLKMLPDGDETIVGEK 784

Query: 631 GTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGK---LMKSKSVT 686
           G  LSGGQK R+++ARA+  +  I +LD+  SA+D E S+  I     +   L+KSK  T
Sbjct: 785 GISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK--T 842

Query: 687 IVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKE-LYADPTSELSKLLNE 735
           I+   + +S ++ S+ I  L N   ++E G + + + +   S+L  L+NE
Sbjct: 843 IILTTNAISVLKHSQKIYALEN-CEIIEEGAYDDVMNSSEDSKLKALINE 891

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  117 bits (293), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 137/548 (25%), Positives = 242/548 (44%), Gaps = 58/548 (10%)

Query: 214  TLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVG 273
            TLY FL  +A   +I +    G+  +  L       ++ S ++         F D   VG
Sbjct: 1025 TLY-FLLFYAIIGLISSFLTAGKVWVAMLSGTNATKKIFSKLLSSIFEAKLRFHDITPVG 1083

Query: 274  DLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISA 333
             +++R   D  ++ + L       F +++             P+   F +          
Sbjct: 1084 RIMNRFSKDMDIIDQQLIPNFEGLFYSVVVCLWIVILIGYVTPRFLIFAIPLCGLYYFVG 1143

Query: 334  SIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIYNIGK 393
            +++ +  R++  I       + ++  E + GV T+++   E++ I     AI D  N   
Sbjct: 1144 ALYLRASRELKRIDNINVSPIHQLFTEAIKGVVTIRALADERRFITHTLEAI-DGSNAPF 1202

Query: 394  MSAVVNSKFST-STSVIGDM----SFLVVLAYGSYLV--LHGSLTIGDLTAFMLYTDYTA 446
                V +++ T    +IG +    S L+++A   YL   L G L    L+    +T+ TA
Sbjct: 1203 FYLSVATEWITYRVDIIGALVLFSSSLMIIARAPYLDAGLAGIL----LSNAFSFTE-TA 1257

Query: 447  NSIFGLSNFYSEIMQGVGAAKRLFDL-----TDRIPAIRPTIGEKFIPGDGCIEFRNLGF 501
              I  + +    +M  V   K   ++          A  P       P  G IEF+NL  
Sbjct: 1258 QWIIKVFSGVELLMSSVERIKEYIEVPLEFSKSNDSATSPVDW----PQTGEIEFKNLSL 1313

Query: 502  AYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIM 561
             Y     ++   N++FK+  GT V IVG +G GKS+I   + R  +  SG I+IDN+DI 
Sbjct: 1314 RYSPHS-SKALDNVSFKVRTGTKVGIVGRTGAGKSSIIAAIYRLSDWESGTIIIDNKDIK 1372

Query: 562  KLNPKSLRQYMGIVQQEPVLMSGSIRDNI----TYGLKREATPDEIREVS----KQCFCH 613
             ++ + LR  +  + Q P L  G+IR N+     Y  K+    D + +V      +  C 
Sbjct: 1373 CVSLECLRNSISCIPQNPTLFDGTIRSNLDPYNQYSDKQ--VFDALAKVGLIERNEVLC- 1429

Query: 614  NFIT-----------KFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATS 662
              +T           KF D   +++   G+ LS GQ+Q + +AR+++   KI+++DEAT+
Sbjct: 1430 -LVTDRQQSSSFSPNKFSD-LNSVVRSGGSNLSQGQRQLLCLARSMLGSRKIMLIDEATA 1487

Query: 663  ALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELY 722
            ++D  S+  I  T  + M  ++ TI++IAHRL ++     I+V+       + G+ KE Y
Sbjct: 1488 SIDYISDAKIQKTIRETM--ENTTILTIAHRLRSVIDYNKILVM-------DMGRVKE-Y 1537

Query: 723  ADPTSELS 730
              P + +S
Sbjct: 1538 DHPYNLIS 1545

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 88/307 (28%), Positives = 152/307 (49%), Gaps = 29/307 (9%)

Query: 494 IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI 553
           + F++    +     +   KN++ + +  +   I+GP+G GKS++ L LL   N  SGQI
Sbjct: 664 VGFKDANMEWDADETSFKLKNISIEFKLNSLNAIIGPTGSGKSSLLLGLLGELNLCSGQI 723

Query: 554 LI---DNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIR--EVSK 608
            +   D++D +++    +   M    Q P L+SG+I DNI +G +    P++ R   V K
Sbjct: 724 YVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGTIEDNIVFGER----PNQRRFNAVIK 779

Query: 609 QCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
            C     +       +T +G  G  LSGGQ+QR+A+ARA+    + L+LD+  SA+D E+
Sbjct: 780 ACCLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALARAIYSSSRFLLLDDCLSAVDPET 839

Query: 669 EGAI--NYTFGKLMKSKSVTIVSIAHRLSTI-RRSEYIIVLGNDGSVVETGKFKELYADP 725
              I      G +MK ++  I S  H +S I +++E++++L N G V   GK  +L A+ 
Sbjct: 840 ALNIYEKCLCGPIMKGRTCIITS--HNISLITKKAEWLVILDN-GEVKGQGKPSDL-AES 895

Query: 726 TSELSKLLNEKQSRANKKEAPLPPQSXXXXXXXXXXXXTPASPPSLHNNLVTDVLKEVSD 785
            + L + +N   +  +  +A   P+S            T A+     N  V + + +V D
Sbjct: 896 NNFLKESMNNGLADESGNQA--KPKS-----------KTAATLHDTDNADVQEEISQVED 942

Query: 786 DSSPLKI 792
              P +I
Sbjct: 943 AVEPAQI 949

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  117 bits (292), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 136/552 (24%), Positives = 233/552 (42%), Gaps = 78/552 (14%)

Query: 218  FLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLIS 277
            ++G +   +         ++ L+  +      RL    +++ LH    F D   +G +++
Sbjct: 943  YMGMYTFFVFFNYFVTTSQFSLICYIGLSAAKRLNLKAVQRLLHTPMSFLDTTPIGRVLN 1002

Query: 278  RLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFL------VIFAPAVVI 331
            R   D   V   LT+ V                      QLS+ +      +I+ P   I
Sbjct: 1003 RFTKDTDTVDTELTESVR-----------------LFVFQLSNIVGVIVMCIIYLPWFAI 1045

Query: 332  SASIFGKKIRDISTILQEATGQLTRVS-----------EEQLNGVKTVQSFVAEQKEIRR 380
            +          ++   Q ++ ++ R+             E L G+ T++++  E++ + +
Sbjct: 1046 AVPFLMLVFVGVADHYQSSSREIKRLEAVQRSHVFNNFNEVLGGMDTIRAYRGERRFLTK 1105

Query: 381  YNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLH-GSLTIGDLTAFM 439
             +     +   G +   +    + +  +I     L+V         H  + ++G L  ++
Sbjct: 1106 SDFLTNKMNEAGYLVVAIQRWVAIALDMIAMAFALIVTLLCVTRQFHISAASVGVLLTYV 1165

Query: 440  LYTDYTANSIFGLSNFYSEIM-QG---VGAAKRLFDLTDRIPA----IRPTIGE-KFIPG 490
            L        + GL N     M QG   + + +RL      +P      RP +      P 
Sbjct: 1166 L-------QLPGLLNMLLRAMTQGENDMNSTERLISYATELPLEAAYRRPEMSPPAEWPT 1218

Query: 491  DGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
            DG IEF ++  AY P  P   V K++   +  G  + I G +G GKSTI   L R     
Sbjct: 1219 DGRIEFDHVSLAYRPGLP--LVLKDVTLHVAAGEKIGICGRTGAGKSTIMSALYRMCELH 1276

Query: 550  SGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIR-----------DNITYGLKRE- 597
             G I ID  DI  L    LR  + I+ Q+PV+  G +R           D + + L R  
Sbjct: 1277 DGSITIDGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRKNLDPFHERTDDELWHALVRGG 1336

Query: 598  ATPDE----IR-EVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKP 652
            A P E    +R +  +     + + KF    E  +   GT  S G++Q +A+ RAL+++ 
Sbjct: 1337 AIPAESLATVRAQTHENAGSLSNMHKFHLQQE--VEEDGTNFSLGERQLLALTRALVRQS 1394

Query: 653  KILILDEATSALDVESEGAINYTFGKLMKSKS-VTIVSIAHRLSTIRRSEYIIVLGNDGS 711
            KILILDEATS++D E++  I     +++++ S  TI+ IAHRL+TI   + I+VL + G 
Sbjct: 1395 KILILDEATSSVDYETDAKIQ---TRIVEAFSNCTILCIAHRLNTILDYDRILVL-DQGR 1450

Query: 712  VVETGKFKELYA 723
            V E      LYA
Sbjct: 1451 VCEFDTPAALYA 1462

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 98/213 (46%), Gaps = 24/213 (11%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           F NLN +I  G  V + G  G GKS++   L  +   + G       DI K     L  Y
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGG-------DIYKDGTMLLCGY 655

Query: 572 MGIVQQEPVLMSGSIRDNITYGL-KREATPDEIREVSKQCFCHNFITKFPDAYETIIGPH 630
                  P + + ++RDNI +G    EA  +EI  V   C     +   P    T IG  
Sbjct: 656 -------PWIQNATVRDNILFGSPYNEARYNEIIRV---CSLQADLELLPAGDRTEIGER 705

Query: 631 GTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTFGKLMKSKSVTIV 688
           G  LSGGQK RI +ARA+ KK  I + D+  SA+D      I      GKL  S   T V
Sbjct: 706 GITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKLEGS---TRV 762

Query: 689 SIAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
              H+LS I R+  +I +  DGS V+ G  +EL
Sbjct: 763 LATHQLSLIARASKVIYIDLDGS-VDVGSVEEL 794

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  116 bits (290), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 132/543 (24%), Positives = 233/543 (42%), Gaps = 52/543 (9%)

Query: 210  AFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQ 269
            +F + LY F   F G L +      G+Y L+  +       L    +++ LH    + D 
Sbjct: 923  SFYMGLYSFF-VFGGYLFMN-----GQYTLICYMGVTASKVLNLKAVERVLHTPMAYMDT 976

Query: 270  NKVGDLISRLGSDAYVVSRSLTQKVS---DGFKAILCXXXXXXXXXXXXPQLSSFLVIFA 326
              +G +++R   D   +   LT+ +      F  I+                  FLV+  
Sbjct: 977  TPIGRILNRFTKDTDSLDNELTESLRLFMTQFANIIGVCVMCIIYLPWFAIAIPFLVLIF 1036

Query: 327  PAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIR 386
              +       G++++ +  I +     +     E L G+ T++++ ++++ + + +  I 
Sbjct: 1037 VLIADHYQASGREVKRLDAIQRSF---VYNNLNEVLGGMDTIKAYGSQERFLVKTDFLIN 1093

Query: 387  DIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGS-LTIGDLTAFMLYTDYT 445
             +   G +   +    +    +I     L++         H S  ++G L  ++L     
Sbjct: 1094 KMNEAGYLLVALQRWVAIFLDMIAVAFALIISLLCVTRQFHISPASVGVLLTYVLQLPGL 1153

Query: 446  ANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPA----IRPTIGE-KFIPGDGCIEFRNLG 500
             N+I       ++    + +A+RL    + +P      RP +   +  P  G I F ++ 
Sbjct: 1154 LNTIL---RALTQTENDMNSAERLVYCANELPLEADYKRPELAPPESWPSKGEIVFEDVS 1210

Query: 501  FAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQD 559
            FAY P  P   V K ++  I+    + I G +G GKSTI   L R    S G+I ID+ D
Sbjct: 1211 FAYRPGLP--VVLKGISLDIKSQEKIGICGRTGAGKSTIMSALYRLNELSDGKIFIDSVD 1268

Query: 560  IMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFIT-- 617
            I ++    LR+ + I+ Q+PVL  G+IR N+      +  PDE+  + K       I+  
Sbjct: 1269 IGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLD---PFQEHPDEL--LWKSLVSGGAISAE 1323

Query: 618  -------KFPDAYETIIGPH-----------GTLLSGGQKQRIAIARALIKKPKILILDE 659
                   + PD+  ++   H           G   S G++Q +A+ RAL+++ KILILDE
Sbjct: 1324 EVEVVKGQKPDSIGSLSSMHKFHLDQKVEEEGANFSLGERQLLALTRALVRQSKILILDE 1383

Query: 660  ATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFK 719
            ATS++D E++  I             TI+ IAHRL TI   + I+VL   G + E    +
Sbjct: 1384 ATSSVDYETDNKIQSRIAAAF--GDCTILCIAHRLKTILTYDRILVL-EQGEIEEFDTPR 1440

Query: 720  ELY 722
             LY
Sbjct: 1441 SLY 1443

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 111/236 (47%), Gaps = 23/236 (9%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           FKNLN  I+ G  V I GP G GKS++   +  +   +SG + +D   +M          
Sbjct: 596 FKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDGDLLM---------- 645

Query: 572 MGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHG 631
                  P + + ++RDNI +G   +   +   EV + C     I   P    T IG  G
Sbjct: 646 ----CGYPWIQNATVRDNIIFGSPYD--KERFDEVVRVCSLKADIDILPGGELTEIGERG 699

Query: 632 TLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTFGKLMKSKSVTIVS 689
             LSGGQK RI +AR++ K   I + D+  SA+D      I      G+L   K  T + 
Sbjct: 700 ITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL---KGKTRIL 756

Query: 690 IAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEA 745
             H+LS I ++  +IVLG DGS  E GK ++L       L  LL+    +++ KEA
Sbjct: 757 ATHQLSLIEKASVVIVLGVDGS-FEAGKLEDL-KRSNKTLINLLHFSSQKSSSKEA 810

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  115 bits (288), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 130/557 (23%), Positives = 236/557 (42%), Gaps = 59/557 (10%)

Query: 210  AFGLTLYPFLGAFAGALVIGTMC-------NYGRYILLRLLSERVVARLRSHVIKKTLHQ 262
            A+ L+ Y  +G  +  L  G +        N  + I  +LLS   +A+LR H        
Sbjct: 1039 AYFLSTYTIIGFISSFLTAGKVWVAVLFGTNATKKIFAKLLSSIFLAKLRFH-------- 1090

Query: 263  DAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFL 322
                 D   VG +++R   D  ++ + L       F +++             P+   F 
Sbjct: 1091 -----DITPVGRIMNRFSKDMDIIDQQLIPNFEGLFYSVVVCLWVIFLIGYITPRFLLFA 1145

Query: 323  VIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYN 382
            +       I  S++ +  R++  I       + ++  E + GV T+++   E++ I +  
Sbjct: 1146 IPLCALYYIVGSLYLRASRELKRIDNINVSPIHQLFTEAIKGVATIRALADERRFITQTL 1205

Query: 383  NAIRDIYNIGKMSAVVNSKFST-STSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLY 441
             AI D  N       + +++ T    +IG    L++ +    +VL        L   +L 
Sbjct: 1206 VAI-DKSNAPFFYLNLATEWITYRVDIIGA---LILFSSSLMIVLKAPYLDAGLAGILLS 1261

Query: 442  TDY----TANSIFGLSNFYSEIMQGVGAAKRLFDL----TDRIPAIRPTIGEKFIPGDGC 493
              +    TA  I  + +    +M  V   K   D+    ++      P       P  G 
Sbjct: 1262 NAFSFTETAQWIIKVFSGVELLMSSVERIKEYVDVPLESSESNNYATPLAN---WPQTGD 1318

Query: 494  IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI 553
            IEF NL   Y     ++    ++FK++ GT V IVG +G GKS+I   + R  +   G I
Sbjct: 1319 IEFENLTLRYSPH-SSKALDGVSFKVKAGTKVGIVGRTGAGKSSIIAAIYRLSDWEDGTI 1377

Query: 554  LIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT-YGLKREATPDEIRE-----VS 607
            +IDN+DI  +  + LR  +  + Q P L  G+IR N+  +    +    E  E       
Sbjct: 1378 IIDNKDIKYVPLECLRNSISCIPQNPTLFEGTIRSNLDPWDQYSDVQVFEALEKVGLIEQ 1437

Query: 608  KQCFC------------HNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKIL 655
             +  C            H    +F D   T++   G+ +S GQ+Q + +AR+++    I+
Sbjct: 1438 SEGLCSLPGQKLSYPSNHKLRNRFIDL-NTVVKSGGSNISQGQRQLLCLARSMLGARNIM 1496

Query: 656  ILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVET 715
            ++DEAT+++D  S+  I  T  + M  ++ T+++IAHRL ++   + I+V+ + G V E 
Sbjct: 1497 LIDEATASIDYVSDAKIQKTIRETM--RNTTVLTIAHRLRSVIDYDKILVM-DMGRVEEY 1553

Query: 716  GKFKELYADPTSELSKL 732
                 L +D  +   +L
Sbjct: 1554 DHPYNLISDKNTIFHRL 1570

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 123/246 (50%), Gaps = 16/246 (6%)

Query: 496 FRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI-- 553
           F N    +     +   KN++   +  T   I+GP+G GKS++ L LL   N  SG+I  
Sbjct: 667 FENANMEWEAAETSFKLKNISIDFKQNTLNAIIGPTGSGKSSLLLGLLGELNLRSGKINV 726

Query: 554 -LIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFC 612
             + ++D +++    +   M    Q P L+SG+I+DNI +G        +  +V K C  
Sbjct: 727 PTVHSRDDLEIGIDGMANSMAYCSQSPWLISGTIKDNIVFG--EFFNQQKFDDVIKCCCL 784

Query: 613 HNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI 672
              I       +T +G  G  LSGGQ+QRIA+ARA+    + L+ D+  SA+D E+   I
Sbjct: 785 EKDIKAMTAGLKTDVGEGGFSLSGGQQQRIALARAIYSSSRYLLFDDCLSAVDPETALHI 844

Query: 673 --NYTFGKLMKSKSVTIVSIAHRLS-TIRRSEYIIVLGNDGSVVETGKFKELYADPTSEL 729
                 G +MK ++  + S  H +S  I++++++++L N G V   GK  +L      E 
Sbjct: 845 YEECLCGPMMKGRTCIVTS--HNISLIIKQAQWLVILDN-GEVKAQGKPSDLI-----ES 896

Query: 730 SKLLNE 735
           SK L E
Sbjct: 897 SKFLKE 902

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  114 bits (286), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 129/536 (24%), Positives = 233/536 (43%), Gaps = 67/536 (12%)

Query: 210  AFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQ 269
            +F + +Y F     G++V  T    G++ LL  +  R    L    + + +H    F + 
Sbjct: 838  SFYMGMYSFF--VFGSIVFLT----GQFSLLCYIGLRASKSLNLQAVNRVIHSPMWFMES 891

Query: 270  NKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAV 329
              +G +++R   D    + SL  ++ D  + ++               +S   +I+ P  
Sbjct: 892  TPMGRIMNRFTKD----TESLDNQILDNLRFVV-------YQACTIVGISVLCIIYLPWF 940

Query: 330  VISASIFGKKIRDISTILQEATGQLTRVSEEQ-----------LNGVKTVQSFVAEQKEI 378
             I+    G  +    +  Q +  ++ R+   Q           L GV T++++ AE++  
Sbjct: 941  AIAIPGLGLILFVACSHYQSSAREIKRLEAVQRSFIYNHLNDVLGGVDTIRAYGAEERFS 1000

Query: 379  RRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVV---LAYGSYLVLHGSLTIGDL 435
             + +  I        +   V    +   +++G +SF ++   L       L G+ T   L
Sbjct: 1001 YKLDYLIDKTNEASYLYTAVQRWINIVINLVG-ISFTLIVSLLCVTKVFNLSGASTGVVL 1059

Query: 436  TAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGE----KFIPGD 491
            +  +L  D   N++       ++    + + +RL      +P    + GE    K  P +
Sbjct: 1060 SYVLLIPDLLNNTL----TMVTQTENDMNSVERLVTYATELPQ-EASHGEEVPSKTWPEN 1114

Query: 492  GCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSS 550
            G I+F N+ + +    P   V      KI  G  V I G +G GKST+   L R     S
Sbjct: 1115 GEIKFENVRYTHRDGLP--AVLDKFTLKIAAGERVGICGRTGAGKSTVLGALYRLREVES 1172

Query: 551  GQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT-YGLKREATPDEIREVSKQ 609
            G+++ID+ D+ KLN  +LR  + I+ Q+PVL  GS+R N+  +G   E   D ++    +
Sbjct: 1173 GRVMIDDVDVSKLNLTALRSRLAIIPQDPVLFQGSVRHNLDPFG---EYDDDVLKNALMR 1229

Query: 610  CFCHNFITKFPDAYETI-----------------IGPHGTLLSGGQKQRIAIARALIKKP 652
            C    F     ++ E I                 +  +G   S G++Q +A+ARALI+  
Sbjct: 1230 CTVGKFNKTGNESTEGIDTDADNGLVGKFRLDQDVEENGCNFSVGERQVLALARALIRNS 1289

Query: 653  KILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGN 708
             IL+LDEAT+A+D  ++  +     +  K +  T++ +AHRL TI   + I+VL N
Sbjct: 1290 SILVLDEATAAVDAATDAHVQRLVAEAFKGR--TVLCVAHRLDTILNYDRILVLEN 1343

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 116/429 (27%), Positives = 194/429 (45%), Gaps = 68/429 (15%)

Query: 324 IFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNN 383
           +F   +++   +FG  ++ +   + + T Q   +  E LN +K V+ +  EQ     Y  
Sbjct: 333 LFFVTIIVVIFLFGIVMK-MRLNINQVTDQRVSILREVLNNIKMVKLYCWEQA----YEK 387

Query: 384 AIRDIYNI-----GKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVLHGSLTIGDLTAF 438
           +I+ I ++      +M  + N  FS + S+    S +  LA      +HG L      A 
Sbjct: 388 SIKKIRSLETSKLTRMEILKNVIFSVTFSLPNICSLMTFLAL---FKIHGGLK----NAA 440

Query: 439 MLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPA------------IRPTIGEK 486
            +++  +   I  L +FY  I   +G A  +    DR               IR T  E 
Sbjct: 441 TIFSSLSLFKILSLLSFY--IPLSLGTAIDIVTSLDRFQEFLEAEESKETRIIRETNSE- 497

Query: 487 FIPGDGCIEFR--NLGFAYPTRPENQV-------FKNLNFKIEPGTSVCIVGPSGRGKST 537
            I GD  +  +  +  F + T  ++         F +LNF+I  G  + IVGP G GK++
Sbjct: 498 -IYGDNTVAIKASHCSFRWDTEEKDNNEEKEFSGFHDLNFEIMKGELIIIVGPIGSGKTS 556

Query: 538 ----IALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYG 593
               I  L+ +Y N   G++ +D          SL     +    P + + ++RDNI +G
Sbjct: 557 LLNAICGLMPQYGNE--GELEVDG---------SL-----VSCGYPWIQNTTVRDNILFG 600

Query: 594 LKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPK 653
            K + +  + + V + C     + K      T IG  G  LSGGQK RI +AR+L K+  
Sbjct: 601 SKYDES--KFKRVIRMCSLEEDLEKLSAYDMTEIGERGVTLSGGQKSRINLARSLYKEKD 658

Query: 654 ILILDEATSALDVESEGAINYTFGKLMKS-KSVTIVSIAHRLSTIRRSEYIIVLGNDGSV 712
           I + D+  SA+D     +I      LM+  K+ T V   H+LS I +++ +IVLGNDG  
Sbjct: 659 IYLFDDILSAVDSRVGQSIMKEC--LMEGLKNKTRVLATHQLSLIGKADQLIVLGNDGK- 715

Query: 713 VETGKFKEL 721
            + G++++L
Sbjct: 716 FDMGRYEDL 724

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  113 bits (282), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 129/229 (56%), Gaps = 13/229 (5%)

Query: 490  GDGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNP 548
            G   I F ++   Y P  P+  V KN++F + P + V IVG +G GKST+ + L R    
Sbjct: 1234 GGAEISFDHVYVRYAPHLPD--VLKNVSFTLLPNSKVAIVGRTGSGKSTVMMSLFRLIEL 1291

Query: 549  SSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT-YGLKREATPDEIREVS 607
            ++G I I   DI  LN ++LR+ + ++ Q+P L SG+I+ NI  +G     +  E+   +
Sbjct: 1292 TNGTIRIGGIDIASLNLQTLRRELTVIPQDPSLFSGTIKSNIDPFG---RYSDQELTHFA 1348

Query: 608  KQ--CFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALD 665
            ++   F      +  ++  +++   G  +S GQ+Q + +ARAL++K KILILDEAT+++D
Sbjct: 1349 RRIGLFSGTDDVRTFNSLGSLVSEGGENMSQGQRQLLCLARALLQKSKILILDEATASID 1408

Query: 666  VESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
             E++  I         S    ++++AHR+STI   + +IVL  D  +V+
Sbjct: 1409 HETDATIQQVVRDF--SSGGIVITVAHRMSTIIDYDQVIVL--DSGIVK 1453

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 125/270 (46%), Gaps = 30/270 (11%)

Query: 496 FRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILI 555
           FRN    +       + KNL    E      I+GPSG GKS++ L LL   +   G I +
Sbjct: 637 FRNASLTWNRFDTGFMLKNLTIDFELHKLNVIIGPSGSGKSSVLLALLGELDLIEGSIRV 696

Query: 556 DNQDIMKLNPKSL----RQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCF 611
                    P+      R       Q P + + ++++NI +    +      +EV   C 
Sbjct: 697 ---------PRGYMHDDRCSFAFCSQTPWITNATVKENIVFS--SQFNTKRYQEVLHACG 745

Query: 612 CHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGA 671
               I +  +  ET++G  G  LSGGQ+QR+A+ARA+    + L+LD+  SA+D    G 
Sbjct: 746 LEEDILEMQEGDETVVGDKGMTLSGGQRQRLALARAVYSGAEHLLLDDCLSAVD---PGM 802

Query: 672 INYTF-----GKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPT 726
             + F     G LMK K+  + +  H ++ +++   +I+L ++G V + GK ++   D  
Sbjct: 803 AVWIFQKCIMGPLMKGKTCILAT--HNIALVQKHADMIILLDNGRVSKIGKARDFNFDSE 860

Query: 727 SELSK--LLNEKQSRAN---KKEAPLPPQS 751
            + SK   L + + + N   KKE  L P +
Sbjct: 861 FDYSKPSKLEKAEMKPNKKPKKEMILQPDT 890

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  110 bits (276), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 86/272 (31%), Positives = 137/272 (50%), Gaps = 24/272 (8%)

Query: 489  PGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNP 548
            P +G I+F++  F Y       + KN N  ++ G  + I G +G GKSTI   L R    
Sbjct: 797  PENGKIQFKDANFRYKEGLP-LILKNFNMLVQSGEKIGICGRTGAGKSTIMNCLFRLDEL 855

Query: 549  SSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT-YGLKREATPDEIREVS 607
            + G I ID+ DI  L    LR+ + I+ Q+P+L  G+IR N+  +    +AT  E   +S
Sbjct: 856  TDGAIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNLDPFSYFDDATLWEAMILS 915

Query: 608  ----KQCFCH--------NFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKIL 655
                +  F H          +TKF       +   GT  S G+KQ +A  RA+I   K++
Sbjct: 916  GFIDRDTFGHFSEKPVNNKELTKFHLTAH--VEEDGTNYSLGEKQLLAFTRAIIHHSKVV 973

Query: 656  ILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVET 715
            +LDEA+S++D E++  I     K       TI+ IAHRL+TI + + I+VL + G+++  
Sbjct: 974  VLDEASSSVDYETDAKIQTLISKQFSHN--TILCIAHRLNTILKYDRILVL-DHGNIIGF 1030

Query: 716  GKFKELYADPTSELSKLLNEKQSRANKKEAPL 747
               + L+     E ++L  +   +AN +EA  
Sbjct: 1031 ENPRVLF-----ENNELFRQMCFQANIEEADF 1057

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/251 (31%), Positives = 113/251 (45%), Gaps = 43/251 (17%)

Query: 494 IEFRNLGFAYPT------RPENQV---------------FKNLNFKIEPGTSVCIVGPSG 532
           I+F N  F + T      + EN +               F NLNF I  G  + I GP G
Sbjct: 166 IKFNNASFEWETFEDDIIKDENNINQILENKTNNCHFNGFNNLNFSI-XGEFIIITGPIG 224

Query: 533 RGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITY 592
            GK+++   +        G I ID             Q  G     P + + ++RDNI +
Sbjct: 225 TGKTSLLYAMSGLMKKLEGTIEIDGN----------LQLCGY----PWVQNTTVRDNIIF 270

Query: 593 GLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKP 652
           G K E   ++   V + C     +  F     T IG  G  LSGGQK RI +ARA+ K  
Sbjct: 271 GSKYE--KEKFDHVIRICALTEDLENFSGKDLTEIGELGITLSGGQKARINLARAIYKTS 328

Query: 653 KILILDEATSALDVESEGAI--NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDG 710
            I + D+  SA+D      I  N   G L   K+  I++  H+LS I++++ I+VLGND 
Sbjct: 329 DIYLFDDILSAVDSRVGNFIMENCLLGAL-SGKTXXILA-THQLSLIKKADRIVVLGNDN 386

Query: 711 SVVETGKFKEL 721
           S  E G +KEL
Sbjct: 387 S-FEIGPYKEL 396

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
           Anc_8.303 YDR135C
          Length = 1546

 Score =  110 bits (275), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 107/402 (26%), Positives = 190/402 (47%), Gaps = 52/402 (12%)

Query: 355 TRVSEEQLNGVKTVQSFVAEQ--KEIRRYNNAIRDIYNIGKMS---AVVNSKFSTSTSVI 409
           TR+  E LN +K+++ +  E   KE   Y    +++ N+ KM    A  + +F+    ++
Sbjct: 468 TRLISEILNNIKSLKLYAWEAPYKEKLEYVRNEKELKNLTKMGCYVAFTHFQFNIVPFLV 527

Query: 410 GDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRL 469
              +F  V  +     L   L    LT F L +   A     +++F    ++   +  RL
Sbjct: 528 SCSTF-AVFVWTQDRPLTTDLVFPALTLFNLLSFPMAAIPIMITSF----IEASISINRL 582

Query: 470 F----------DLTDRIPAIRPTIGEKFIPGDGCIEF-RNLGFAYPTRPENQV-FKNLNF 517
           F          D   R+P ++ T       GD  I+   +  F +  +PE +V  KN+NF
Sbjct: 583 FSFLTNEELQKDAVQRLPNVKNT-------GDVSIKLGDDATFLWKRKPEYKVALKNINF 635

Query: 518 KIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP-KSLRQYMGIVQ 576
           +   G   CIVG  G GKS +   +L               D+ ++    ++   +  V 
Sbjct: 636 QARKGELTCIVGKVGSGKSALIQSIL--------------GDLFRVKGFATVHGDVAYVS 681

Query: 577 QEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSG 636
           Q P +M+G++++NI +G K +    E  +  K C     ++  PD   T++G  G  LSG
Sbjct: 682 QVPWIMNGTVKENILFGHKFDKKFYE--KTIKACALTIDLSILPDGDSTLVGEKGISLSG 739

Query: 637 GQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFG--KLMKSKSVTIVSIAHR 693
           GQK R+++ARA+  +    + D+  +A+D    +  I +  G   L+ SK  T V   ++
Sbjct: 740 GQKARLSLARAVYARADTYLFDDPLAAVDEHVGKHLIEHVLGPNGLLHSK--TKVLATNK 797

Query: 694 LSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNE 735
           ++ +  ++YI +L N G +++ GK++E+ +DP S L KL+NE
Sbjct: 798 ITVLNIADYITLLDN-GEIIQRGKYEEVTSDPGSPLCKLINE 838

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 95/433 (21%), Positives = 171/433 (39%), Gaps = 48/433 (11%)

Query: 182  VIGLVLDALKNVMTDSPSSLETS--DLPPIAFGLTLYPFLGAFAGAL-------VIGTMC 232
            ++ +    + NV     S + TS  D P     L +Y  LG F+ AL       ++   C
Sbjct: 943  ILSMFFSVMGNVWLKHWSEINTSNGDNPHAGRYLGIYFALG-FSSALSQLLQTVILWVFC 1001

Query: 233  N-YGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLT 291
              +G  IL             S ++   L     FF+   +G +++R  +D Y V   L 
Sbjct: 1002 TIHGSKIL------------HSQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLG 1049

Query: 292  QKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEAT 351
            +  S  F   +              Q   F+V  +   +     + +  R++  +     
Sbjct: 1050 RTFSQFFSNAVKVTFTLVVICVSTWQFIFFIVPMSFLYIYYQQYYMRTSRELRRLDSVTR 1109

Query: 352  GQLTRVSEEQLNGVKTVQSFVAEQKEI----RRYNNAIRDIYNIGKMSAVVNSKFSTSTS 407
                   +E L G+ T++ +  E + I    +R +N +   Y     S   N   +    
Sbjct: 1110 SPTISHFQETLGGISTIRGYSQENRFIHINQQRVDNNMSAYYP----SINCNRWLAFRLE 1165

Query: 408  VIGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAK 467
             +G +  L     G Y +  G++T G +   + Y      S+  +     E+   + + +
Sbjct: 1166 FLGSVIILGASTLGIYRLSQGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVE 1225

Query: 468  RL---FDLTDRIPAI----RPTIGEKFIPGDGCIEFRNLGFAYPTRPE---NQVFKNLNF 517
            R+    +L    P+I    RP +     P DG ++F +    Y TR     + V K++  
Sbjct: 1226 RIKEYSELASEAPSIVEDKRPDVNW---PQDGAVKFNH----YYTRYRADLDYVLKDITL 1278

Query: 518  KIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQ 577
             I+P   + IVG +G GKS++ L L R    S G I +D  +  ++    LR  + I+ Q
Sbjct: 1279 DIKPREKIGIVGRTGAGKSSLTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSIIPQ 1338

Query: 578  EPVLMSGSIRDNI 590
            +  +  G++RDNI
Sbjct: 1339 DSQVFEGTVRDNI 1351

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 66/107 (61%), Gaps = 3/107 (2%)

Query: 621  DAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLM 680
            +A  T +   G+ LS GQ+Q + +ARAL+    IL+LDEAT+A+DVE++  I  T     
Sbjct: 1424 NALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAAVDVETDQLIQETIRSAF 1483

Query: 681  KSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTS 727
            K++  TI++IAHRL+TI  S+ I+VL + G + E    + L  D  S
Sbjct: 1484 KNR--TILTIAHRLNTIMDSDRILVL-DKGEIKEFDSPQTLLGDKDS 1527

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 140/580 (24%), Positives = 230/580 (39%), Gaps = 77/580 (13%)

Query: 210  AFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSERVVARLRSHVIKKTLHQDAEFFDQ 269
            +F + LY F   F   + +      G+Y LL  +       L    + K LH    F D 
Sbjct: 941  SFYMGLYSFF-VFGSYIFMN-----GQYTLLCYMGVVASKTLNLQALHKILHTPMSFMDT 994

Query: 270  NKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAPAV 329
            N +G +++R   D   +   LT+ +      I              P  +  +       
Sbjct: 995  NPLGRILNRFTKDTDALDNELTENLRLAMSQIANIIGVGAMCIIYLPWFAIAIPFLLLIF 1054

Query: 330  VISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRDIY 389
            ++ A  +    R++  +       +     E L G+ T++++ A+ +       A +  +
Sbjct: 1055 LLIADHYQSTGREVKRLEAIQRSFVYNNLNEMLTGMDTIKAYNAQDR------FATKSEF 1108

Query: 390  NIGKM--SAVVNSKFSTSTSVIGDMSFLVVLAYGSYLVL-----HGSLTIGDLTAFMLYT 442
             I KM  +A ++        +  D   LV +A+   + L        ++  D    + Y 
Sbjct: 1109 LIDKMNEAAYISIAVQRWAGIFLD---LVAVAFALIITLLCVTRQFHISGADTGVLLTY- 1164

Query: 443  DYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRI---------------PAIRPTIGEKF 487
                  +  L    + +++ +   +   + T+R+               P   P I    
Sbjct: 1165 ------VLQLPGLLNTVLRALTQTENDMNSTERLVSYATQLPQEAQYRKPECSPPID--- 1215

Query: 488  IPGDGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYY 546
             P +G I F N+ FAY P  P   + KN N  I+P   + I G +G GKSTI   L R  
Sbjct: 1216 WPQNGHIVFENINFAYRPGLP--IILKNFNLIIKPNEKIGICGRTGAGKSTIMNALYRLT 1273

Query: 547  NPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDN----------------I 590
              ++G+I+ID+ DI  L    LR  + I+ Q+PVL  G+IR N                +
Sbjct: 1274 ELTTGKIIIDDIDISNLGLYELRSKLAIIPQDPVLFRGNIRRNLDPFDEYQDDLLWESLV 1333

Query: 591  TYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIK 650
              G       + ++   K     N + KF       +   G   S G++Q +A+ RAL++
Sbjct: 1334 KAGAIDSQELETVKSQDKNSDAKN-LHKF--HLNQSVDEDGNNFSLGERQVLALTRALVR 1390

Query: 651  KPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDG 710
            + KILILDEATS++D E++  I             TI+ IAHRL TI   + I+VL   G
Sbjct: 1391 QSKILILDEATSSVDYETDAKIQNLIATAF--NHCTILCIAHRLKTILNYDRILVL-EKG 1447

Query: 711  SVVETGKFKELYADPTSELSKLLNEKQSRANKKEAPLPPQ 750
             V E      L+ +       +     SRAN  E   P Q
Sbjct: 1448 EVAEFDTPWNLFNN-----DGIFKSMCSRANITEEDFPKQ 1482

 Score = 87.4 bits (215), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 99/214 (46%), Gaps = 21/214 (9%)

Query: 511 VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQ 570
           +  N+NF I  G  V + GP G GK+++   L       SG+          +N      
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGE----------MNHSGDLL 673

Query: 571 YMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPH 630
             GI    P + + +IRDNI +G   +  P   + V   C   + +   P   +T +G  
Sbjct: 674 LCGI----PWVQNATIRDNILFGSPYD--PTFYKRVLHVCALESDLENLPAHDKTEVGER 727

Query: 631 GTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE-SEGAINYTFGKLMKSKSVTIVS 689
           G  LSGGQK RI++ARA+ K   I + D+  SA+D       ++Y     +  K+  + +
Sbjct: 728 GVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDKTRILAT 787

Query: 690 IAHRLSTIRRSEYIIVLGN--DGSVVETGKFKEL 721
             H+LS + +++ IIVL    D    E G FKEL
Sbjct: 788 --HQLSLVEKADRIIVLSTSKDAPHFEIGTFKEL 819

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 71/236 (30%), Positives = 113/236 (47%), Gaps = 7/236 (2%)

Query: 494  IEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQ 552
            I F+ + FAY P  P       ++F +  G  + I G +G GK+++   L R     SG 
Sbjct: 1145 IVFQEVSFAYRPGLP--LALCGVSFHVRAGEKIGICGRTGAGKTSVTTALYRLSELESGS 1202

Query: 553  ILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNIT-YGLKREATPDEIREVSKQCF 611
            I ID  DI  L    LR  + I+ Q+P+L  G++R N+  +    + T       S    
Sbjct: 1203 IKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKNLDPFAEHTDGTLWSALVRSGVVP 1262

Query: 612  CHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGA 671
                 T      +  +   G   S G++Q +A+ARAL++  +ILILDEATS++D  ++  
Sbjct: 1263 AGVVPTSHKFHLDQEVDEGGANFSLGERQLLALARALVRSTRILILDEATSSVDYATDAR 1322

Query: 672  INYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTS 727
            +        + +  T++ +AHRL TI   + I+VL + G V E      L+A   S
Sbjct: 1323 VQARIAA--EFRQATVLCVAHRLRTIISYDRILVL-DQGRVAEFDTPYRLFARKDS 1375

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 67/266 (25%), Positives = 122/266 (45%), Gaps = 26/266 (9%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
             +L F I+ G  + ++G  G GK+++   +  Y   ++G + ++   +          +
Sbjct: 551 LNDLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNGSLL----------F 600

Query: 572 MGIVQQEPVLMSGSIRDNITYGLKREATPDEIR--EVSKQCFCHNFITKFPDAYETIIGP 629
            G+    P + + +IRDNI +G    ++ D+ R  EV   C        FP   +T +G 
Sbjct: 601 CGV----PWIQNATIRDNIIFG----SSFDQTRYDEVVNACALEADFKIFPAGDKTEVGE 652

Query: 630 HGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVS 689
            G  LSGGQK RI++ARA+ K   I + D+  SA+D      I      L + ++ T + 
Sbjct: 653 RGITLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQK-CLLDRLQNRTRIL 711

Query: 690 IAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEAPLPP 749
             H+L+ ++ +  +I LG DGS  + G   EL+ +   +   L++   S+ N +E+ +  
Sbjct: 712 ATHQLALVQEASRVIFLGQDGS-FDMGTPAELH-EKNPQFRNLMS-LSSQTNAEESEM-- 766

Query: 750 QSXXXXXXXXXXXXTPASPPSLHNNL 775
           +S             P S P  +  +
Sbjct: 767 ESIRSQSKSKKASTAPVSMPDFNEEI 792

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 87.8 bits (216), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 135/284 (47%), Gaps = 29/284 (10%)

Query: 444 YTANSIFGL--------SNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGEK---FIPGDG 492
           +TA S+FGL        S+  + I+Q V + +R+    D      P + ++    +  DG
Sbjct: 634 FTALSLFGLLKMPLDQLSSTINYIVQSVISLRRIQSFLDE-----PDMDKQKNLLLSKDG 688

Query: 493 C-IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSG 551
               F      +    +  + +NLN K +      + GP+G GKS + + LL   +   G
Sbjct: 689 TYFMFSGATIGWSINNKGFILENLNVKFKSKKLNVVAGPTGAGKSLLLMSLLGETHLFKG 748

Query: 552 QI----LIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVS 607
           +I    L    ++M ++   L   +    Q P +++ SI++NI +G   E       +V 
Sbjct: 749 EIHVPSLASKHELM-IHGDGLTNSISYCSQIPWIINDSIKNNILFG--SEFNLKRYNDVI 805

Query: 608 KQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVE 667
           + C   N +    D   +I+G  G  LSGGQ+QR+++ARA+  K   +ILD+  SA+D +
Sbjct: 806 RACCLTNDLRLLQDGDNSIVGDRGQNLSGGQRQRVSLARAIYSKSMHIILDDCLSAVDSK 865

Query: 668 SEGAINYTF---GKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGN 708
               I Y     G LMK ++  +VS    L  I+++ Y+++L N
Sbjct: 866 CAKDI-YDLCLTGPLMKGRTCILVSHNVEL-VIKKAAYLLILDN 907

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
           similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 103/216 (47%), Gaps = 30/216 (13%)

Query: 512 FKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQY 571
           F +L+F+++ G  + I G  G GK+++   L  + + ++G I                QY
Sbjct: 590 FSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDI----------------QY 633

Query: 572 MG--IVQQEPVLMSGSIRDNITYGLKREATPDE--IREVSKQCFCHNFITKFPDAYETII 627
            G  +    P + + +IRDNIT+G    +  DE   REV + C     ++  P   +T +
Sbjct: 634 NGRMLFCGAPWIQNATIRDNITFG----SPYDENLYREVMRVCSLDRDMSVLPAGDKTEV 689

Query: 628 GPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI--NYTFGKLMKSKSV 685
           G  G  LSGGQK RI +AR + K   I + D+  SA+D     +I  +   GKL      
Sbjct: 690 GERGITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKLGDK--- 746

Query: 686 TIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKEL 721
           T +   H++S   ++  +I LG DGS  + G   EL
Sbjct: 747 TRILATHQISLTEQASRVIYLGTDGS-FDIGTVDEL 781

 Score = 78.6 bits (192), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 91/402 (22%), Positives = 166/402 (41%), Gaps = 44/402 (10%)

Query: 216  YPFLGA----FAGALVIGTMCNYG----RYILLRLLSERVVARLRSHVIKKTLHQDAEFF 267
            Y F G     + G      M NY     ++ L+  L  R    +    + + LH    F 
Sbjct: 911  YKFRGRSDTFYMGMYFFFVMANYLSTNIQFSLVSYLGLRASKNINLQSLHRLLHVPVSFI 970

Query: 268  DQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCXXXXXXXXXXXXPQLSSFLVIFAP 327
            D   +G +++R   D  ++   LT+ +                     P  +  + +   
Sbjct: 971  DTTPLGRILNRFTKDTDILDNELTESLRMFSYQFTVIWGVIIMSIIYLPWFAVAVPLLVV 1030

Query: 328  AVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGVKTVQSFVAEQKEIRRYNNAIRD 387
              ++ +  +    R+I  +       +     E ++GV T++++ AE + +++      D
Sbjct: 1031 VFILVSDHYQCSAREIKRLEAVQRSFVLNNFNEVISGVDTIKAYHAEARFLKK-----SD 1085

Query: 388  IYNIGKMSAVVNSKFSTSTSV---IGDMSFLVVLAYGSYLVLHGSLTIGDLTAFMLYTDY 444
            I  I +M+ +    +++   V   IG ++ L  L   S L + G   I   +  +L T  
Sbjct: 1086 IL-IDRMNEMTFPLYASQRWVSILIGMIAVLFALII-SILCVTGWFNISPASTGVLLT-- 1141

Query: 445  TANSIFGLSNFYSEIMQGV-------GAAKRLFDLTD--------RIPAIRPTIGEKFIP 489
                +  L N ++ +++ +        +A+R+    +        RIP + P    K  P
Sbjct: 1142 ---YVLQLPNLFNTLLRAMTQLENDMNSAERVLSYANSLPKEAPYRIPEMAP---PKAWP 1195

Query: 490  GDGCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNP 548
              G I F N+  AY P  P   V ++++F I  G  + I G +G GKSTI   L R    
Sbjct: 1196 ERGAITFDNVALAYRPGLP--LVLQDVSFHISSGEKIGICGRTGAGKSTITNALYRLVEL 1253

Query: 549  SSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNI 590
            S+G + ID  DI  +   +LR  + I+ Q+P+L  G+IR N+
Sbjct: 1254 SNGSVTIDGVDIATIGLYNLRSKLSIIPQDPLLFRGTIRKNL 1295

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 59/97 (60%), Gaps = 3/97 (3%)

Query: 631  GTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSI 690
            G+  S G++Q +A+ARAL+++ KILILDEATS++D E++  I      + + +  TI+ +
Sbjct: 1425 GSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQARI--VQEFQHATIMCV 1482

Query: 691  AHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTS 727
            AHRL TI   + I+V+   G V E      LY +  S
Sbjct: 1483 AHRLKTILHYDRILVM-EKGRVAEFDTPLRLYNEQGS 1518

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 88/166 (53%), Gaps = 8/166 (4%)

Query: 555 IDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHN 614
           ++++D +++    +   M    Q P L+SG+I+DN+ +G        +  +V K C    
Sbjct: 715 VESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFG--EIFNKQKFDDVMKSCCLDK 772

Query: 615 FITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI-- 672
            I        T +G  G  LSGGQ+QRIA+ARA+    + LILD+  SA+D E+   I  
Sbjct: 773 DIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCLSAVDPETALYIYE 832

Query: 673 NYTFGKLMKSKSVTIVSIAHRLSTI-RRSEYIIVLGNDGSVVETGK 717
               G +MK ++  I S  H +S + +R++++++L + G V   GK
Sbjct: 833 ECLCGPMMKGRTCIITS--HNISLVTKRADWLVIL-DRGEVKSQGK 875

>Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar to
           Ashbya gossypii ACR128C
          Length = 828

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 120/258 (46%), Gaps = 39/258 (15%)

Query: 507 PENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYY--NPSSGQILIDNQDIMKLN 564
           P +      N  + PG+S+ I+GP+  GKS+I  ++   +     +G + I ++  M   
Sbjct: 583 PASSNLTQANVLLGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKTGLLSIPSESDM--- 639

Query: 565 PKSLRQYMGIVQQEPVLMSGSIRDNITYGL------KREATPDEIREVSKQCFCHNFITK 618
                  M I Q+   +  G+ RD I Y +      ++     E+  V K+    +++ K
Sbjct: 640 -------MCIAQRPYFIQGGTFRDQIIYPMFVDTFYEKGHKDRELVRVLKEVKL-DYLLK 691

Query: 619 FPDA--YETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTF 676
             DA  Y   +     +LSGG+KQR+  AR +  +PK ++LDEAT+A+  + E   +Y F
Sbjct: 692 RADALNYLDHVADWKDVLSGGEKQRMNFARIMFHRPKFIVLDEATNAISADME---DYLF 748

Query: 677 GKLMKSKSVTIVSIAHRLSTIRRSEYII-----------VLGNDGSVVETGKFKELYADP 725
             L K +    +SI+ R S I+  +Y++            LG+D ++       E     
Sbjct: 749 NMLKKFR-FNFISISQRPSLIKYHDYLLEITTNSNWQYQTLGSDEAITSIDTEIE---SL 804

Query: 726 TSELSKLLNEKQSRANKK 743
            S+LS++ N ++ R   K
Sbjct: 805 ESKLSQIHNWEKEREELK 822

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/191 (27%), Positives = 96/191 (50%), Gaps = 19/191 (9%)

Query: 521 PGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPV 580
           PG+S+ I+GP+  GKS+I  +L   +       + +   ++ +  +S    M I Q+   
Sbjct: 597 PGSSLLILGPNSCGKSSIQRILAEIWP------IYNKTGLVSIPAES--DLMCIAQRPYF 648

Query: 581 LMSGSIRDNITYGL------KREATPDEIREVSKQCFCHNFITKFPD-AYETIIGPHGTL 633
           +  G+ RD I Y +      ++     E+  + K+      + +    +Y   +     +
Sbjct: 649 IQGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKLDYLLKRSEGLSYLDFVADWKDI 708

Query: 634 LSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHR 693
           LSGG+KQR+  AR +  +PK L+LDEAT+A+ V+ E   +Y F  L K +    +SI+ R
Sbjct: 709 LSGGEKQRMNFARIMFHRPKFLVLDEATNAISVDME---DYLFNMLRKCR-FNFISISQR 764

Query: 694 LSTIRRSEYII 704
            S I+  +Y++
Sbjct: 765 PSLIKYHDYLL 775

>SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1447

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 127/249 (51%), Gaps = 15/249 (6%)

Query: 492  GCIEFRNLGFAYPTR-PENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYN--- 547
            G   ++++ +  P +  E ++   ++  ++PG +  ++G SG GK+T+  +L +  +   
Sbjct: 800  GVFMWKDVDYVIPYKGSEKKLLDKVSGFVKPGLT-ALMGASGAGKTTLLNVLAQRMDFGI 858

Query: 548  PSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSG-SIRDNITYGLKREATPDEIREV 606
             SSG+IL+D + +     +  ++ +G VQQ+ +     ++R+++ +   R   PD + + 
Sbjct: 859  VSSGEILVDAKPV----DRKFKRSVGYVQQQDIHTQELTVRESLQFS-ARLRRPDSVPDA 913

Query: 607  SKQCFCHNFIT--KFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEATSA 663
             K  +    I      D  + ++G  G  L+  Q+++++I   L+ KP +L+ LDE TS 
Sbjct: 914  EKMEYVEKIIVVLGMQDYSDAVVGEAGFGLNVEQRKKLSIGVELVAKPTLLLFLDEPTSG 973

Query: 664  LDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRS-EYIIVLGNDGSVVETGKFKELY 722
            LD +S  AI     +L ++    + +I    +T+  S + +++L + GSVV  G   +  
Sbjct: 974  LDSQSSWAILQLLRRLAEAGQAILCTIHQPSATLFESFDRLLLLKDGGSVVYWGNIGDHS 1033

Query: 723  ADPTSELSK 731
             D T+   K
Sbjct: 1034 KDVTNYFKK 1042

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 107/211 (50%), Gaps = 23/211 (10%)

Query: 521 PGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPV 580
           PG+S+ I+GP+G GK++I  ++   + P      I N++ + L+  + R+ + I Q+   
Sbjct: 600 PGSSMLILGPNGSGKTSIQRIIAEIW-P------IYNKNGL-LSVPAERELICIPQKPYF 651

Query: 581 LMSGSIRDNITYGLKREATPD------EIREVSKQCFCHNFITKFPDA-YETIIGPHGTL 633
           +  G+ R+ I Y +  +   D      E+  V K+      + +     Y   +     +
Sbjct: 652 IQGGTFREQIIYPMSADQYFDLGYRDKELVHVLKEVKLEYLLKRDKGWRYLDAVAEWKDV 711

Query: 634 LSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHR 693
           LSGG++QR+  AR +  KPK ++LDEAT+A+  + E   +Y F  ++K      ++I+ R
Sbjct: 712 LSGGERQRMNFARIMFHKPKFVVLDEATNAISADME---DYLFN-MLKRYRFNFITISQR 767

Query: 694 LSTIRRSEYIIVLGNDGSVVETGKFKELYAD 724
            S I+  +  + +G D    E+ + ++L  D
Sbjct: 768 PSLIKYHDLALEIGAD----ESWRLQDLGTD 794

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1595

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 112/239 (46%), Gaps = 21/239 (8%)

Query: 494  IEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS--S 550
              +RNL +    + E + +  N++  ++PGT   ++G SG GK+T+   L         +
Sbjct: 951  FHWRNLCYDVQIKKETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVIT 1010

Query: 551  GQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITYGLKREATPDEIREVSKQ 609
            G + ID +   +  P+S+    G  QQ+ + L + ++R+++ +       P E+    K 
Sbjct: 1011 GDVFIDGKPRDESFPRSI----GYCQQQDLHLKTATVRESLRFSAYLR-QPAEVSIAEKN 1065

Query: 610  CFCHNFI-----TKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEATSA 663
             +  + I      K+ DA   I+G  G  L+  Q++R+ I   L  KPK+L+ LDE TS 
Sbjct: 1066 AYVEDIIKILEMEKYADA---IVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSG 1122

Query: 664  LDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETGKFKE 720
            LD ++  AI     KL       + +I H+ S I   E+  ++ +   G     G+  E
Sbjct: 1123 LDSQTAWAICQLMRKLCNQGQAILCTI-HQPSAILMQEFDRLLFMQRGGQTCYFGELGE 1180

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 112/266 (42%), Gaps = 42/266 (15%)

Query: 496 FRNLGFAY----PTRPEN--QVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
           ++ LG+ Y    PT+ E+  Q+ K ++  ++PG  + ++G  G G +T  LL     N  
Sbjct: 232 YKMLGYLYRKVKPTKEEDLFQILKPMDGCLKPGELLVVLGRPGSGCTT--LLKSITSNTH 289

Query: 550 SGQILIDNQ-DIMKLNPKSL-RQYMG----------------IVQQEPVLMSGSIRDNIT 591
              +  D+Q      +PK + R Y G                + Q    +       N  
Sbjct: 290 GFHVGKDSQISYSGFSPKEIKRHYRGEVVYNAESDIHLPHLTVYQTLITVARLKTPQNRI 349

Query: 592 YGLKREATPDEIREVSKQCF--CHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALI 649
            G+ RE   + I EV+   +   H   TK  +  + + G     +SGG+++R++IA   I
Sbjct: 350 QGVSREDYANHIAEVAMATYGLSHTRNTKVGN--DLVRG-----VSGGERKRVSIAEVAI 402

Query: 650 KKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGND 709
              K    D AT  LD     A    F + +K+++ TI + A  ++  + S+    L + 
Sbjct: 403 CGSKFQCWDNATRGLD----AATALEFVRALKTQA-TIANSAAAVAIYQCSQDAYDLFDK 457

Query: 710 GSVVETGKFKELYADPTSELSKLLNE 735
             V++ G   +LY    ++  K   +
Sbjct: 458 VCVLDDG--YQLYYGSATKAKKYFQD 481

>KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1513

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 113/242 (46%), Gaps = 21/242 (8%)

Query: 491  DGCIEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
            +    +R+L +    + E + +  N++  ++PGT   ++G SG GK+T+   L       
Sbjct: 866  EAIFHWRDLCYDVQIKDETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMG 925

Query: 550  --SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITYGLKREATPDEIREV 606
              +G I +D     +  P+S+    G  QQ+ + L + ++R+++ +       P E+   
Sbjct: 926  VITGDIFVDGLPRNESFPRSI----GYCQQQDLHLKTSTVRESLRFSAYLR-QPKEVSVE 980

Query: 607  SKQCFCHNFI-----TKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEA 660
             K  +    I      K+ DA   I+G  G  L+  Q++R+ I   L  KPK+L+ LDE 
Sbjct: 981  EKNAYVEEIIKILEMEKYADA---IVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEP 1037

Query: 661  TSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETGKF 718
            TS LD ++  AI     KL K     + +I H+ S I   E+  ++ +   G  V  G+ 
Sbjct: 1038 TSGLDSQTAWAICQLMKKLCKHGQAILCTI-HQPSAILMQEFDRLLFMQKGGKTVYFGEL 1096

Query: 719  KE 720
             E
Sbjct: 1097 GE 1098

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 107/210 (50%), Gaps = 26/210 (12%)

Query: 514 NLNFKIE---PGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQ 570
           N+N K+    PG+S+ I+GP+G GK++I  ++   + P     + +   ++ + P S   
Sbjct: 589 NINKKLAFQGPGSSMLILGPNGSGKTSIQRIIAEIW-P-----IYNKNGLLSIPPAS--- 639

Query: 571 YMGIVQQEPVLMSG-SIRDNITYGLKREATPD------EIREVSKQCFCHNFITKFPDAY 623
            +  V Q+P  + G + R+ I Y +  +   D      E+  +  +    +++ K    +
Sbjct: 640 DLFCVPQKPYFIQGGTFREQIIYPMSADQYFDMGYRDKELTHILGEVKL-DYLLKRDKGW 698

Query: 624 ETI--IGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMK 681
             +  +     +LSGG++QRI  AR +  KP+ ++LDEAT+A+  + E   +Y FG L+K
Sbjct: 699 RYLDAVAEWKDVLSGGERQRINFARIMFHKPRFVVLDEATNAISADME---DYLFG-LLK 754

Query: 682 SKSVTIVSIAHRLSTIRRSEYIIVLGNDGS 711
                 ++I+ R S I+  +  + +  DG+
Sbjct: 755 RYRFNFITISQRPSLIKYHDLALDISTDGT 784

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 113/242 (46%), Gaps = 21/242 (8%)

Query: 491  DGCIEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
            +    +RNL +    + E + +  N++  ++PGT   ++G SG GK+T+   L       
Sbjct: 890  EAIFHWRNLCYDVQIKTETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMG 949

Query: 550  --SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITYGLKREATPDEIREV 606
              +G + ID +   +  P+S+    G  QQ+ + L + ++R+++ +       P E+   
Sbjct: 950  VITGDVFIDGKPRDESFPRSI----GYCQQQDLHLKTATVRESLRFSAYLR-QPAEVSIA 1004

Query: 607  SKQCFCHNFI-----TKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEA 660
             K  +  + I      K+ DA   I+G  G  L+  Q++R+ I   L  KPK+L+ LDE 
Sbjct: 1005 EKNAYVEDIIKILEMEKYADA---IVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEP 1061

Query: 661  TSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETGKF 718
            TS LD ++  AI     KL       + +I H+ S I   E+  ++ +   G     G+ 
Sbjct: 1062 TSGLDSQTAWAICQLMRKLCNQGQAILCTI-HQPSAILMQEFDRLLFMQRGGQTCYFGEL 1120

Query: 719  KE 720
             E
Sbjct: 1121 GE 1122

>KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON} 
          Length = 1493

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 115/245 (46%), Gaps = 21/245 (8%)

Query: 488  IPGDGCIEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYY 546
            +  +    +RNL +    + E + +  N++  ++PGT   ++G SG GK+T+   L    
Sbjct: 847  VKSEAIFHWRNLCYDVQIKDETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERV 906

Query: 547  NPS--SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITYGLKREATPDEI 603
                 +G +L+D +   +  P+S+    G  QQ+ + L + ++R+++ +       P E+
Sbjct: 907  TMGVITGDVLVDGRPRDESFPRSI----GYCQQQDLHLKTSTVRESLRFSAYLR-QPAEV 961

Query: 604  REVSKQCFCHNFI-----TKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-L 657
                K  +    I      K+ DA   ++G  G  L+  Q++R+ I   L  KPK+L+ L
Sbjct: 962  SVEEKDAYVEEVIKILEMEKYADA---VVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFL 1018

Query: 658  DEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVET 715
            DE TS LD ++  +I     KL  S    I+   H+ S I   E+  ++ L   G  V  
Sbjct: 1019 DEPTSGLDSQTAWSICQLMRKL-ASHGQAILCTIHQPSAILMQEFDRLLFLQKGGKTVYF 1077

Query: 716  GKFKE 720
            G+  E
Sbjct: 1078 GELGE 1082

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_5.500
            YDR406W
          Length = 1499

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 119/252 (47%), Gaps = 24/252 (9%)

Query: 482  TIGEKFIPGDGCIEFRNLGFAYPTRP-ENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIAL 540
            T G + +       +RNL +  P +    ++  N++  ++PGT   ++G SG GK+T+  
Sbjct: 839  TNGARLLKSQAVFHWRNLCYDIPIKHGTRRLLDNVDGWVKPGTLTALMGASGAGKTTLLD 898

Query: 541  LLLRYYNPS--SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITYGLKRE 597
             L         +G +L+D +   +  P+S+    G  QQ+ + L + ++R+++ +     
Sbjct: 899  CLAERVTMGVITGDVLVDGRPRDESFPRSI----GYCQQQDLHLKTSTVRESLRFSAYLR 954

Query: 598  ATPDEIREVSKQCFCHNFI-----TKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKP 652
              P E+    K  +    I      K+ DA   ++G  G  L+  Q++R+ I   L  KP
Sbjct: 955  -QPAEVSVEEKDAYVEEVIKILEMEKYADA---VVGVAGEGLNVEQRKRLTIGVELAAKP 1010

Query: 653  KILI-LDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGND 709
            K+L+ LDE TS LD ++  +I     KL  S    I+   H+ S I   E+  ++ L + 
Sbjct: 1011 KLLVFLDEPTSGLDSQTAWSICQLMRKL-ASHGQAILCTIHQPSAILMQEFDRLLFLQDG 1069

Query: 710  GSVVETGKFKEL 721
            G   +T  F EL
Sbjct: 1070 G---QTTYFGEL 1078

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 83/194 (42%), Gaps = 27/194 (13%)

Query: 494 IEFRNLGFAY----PTRPEN--QVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYN 547
           + F+ LG  Y    P R  N  Q+ K +   ++PG  + ++G  G G +T    LL+  +
Sbjct: 137 VPFKILGKVYRRFRPARDSNSFQILKPMEGYLDPGELLVVLGRPGSGCTT----LLKTIS 192

Query: 548 PSSGQILIDNQDIMKLN---PKSLRQYM-GIV---QQEPVLMSGSIRDNITYGLKREATP 600
            ++    +D   ++  N   P+ +R++  G V    +  V +         Y + R  TP
Sbjct: 193 SNTHGFRVDKDSVISYNGLTPREMRKHFRGEVVYNAESDVHLPHLTVFETLYTVARLKTP 252

Query: 601 -DEIREVSKQCFCHNFITKFPDAYETIIGPHGTL--------LSGGQKQRIAIARALIKK 651
            + I+ V +  +  + IT    A   +     T         +SGG+++R++IA   I  
Sbjct: 253 TNRIKGVDRDTYARH-ITDVAIATYGLSHTKNTKVGNALVRGVSGGERKRVSIAEVSICG 311

Query: 652 PKILILDEATSALD 665
            K    D AT  LD
Sbjct: 312 SKFQCWDNATRGLD 325

>AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON}
            Non-syntenic homolog of Saccharomyces cerevisiae YPL058C
            (PDR12)
          Length = 1497

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 114/242 (47%), Gaps = 15/242 (6%)

Query: 488  IPGDGCIEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYY 546
            I  D    +R++ +    + E + +  N++  ++PGT   ++G SG GK+T+  +L    
Sbjct: 836  IGSDSIFHWRDVCYDIQIKNETRRILTNVDGWVKPGTLTALMGYSGAGKTTLLDVLANRV 895

Query: 547  NPS--SGQILIDNQDIMKLNPKSLRQYMGIVQQEPVL-MSGSIRDNITYGLKREATPDEI 603
                 +G I +D      L   S ++  G  QQ+ +   + ++RD + +       P  I
Sbjct: 896  RVGVVTGNIFVDGH----LRDTSFQRKTGYCQQQDLHGRTQTVRDALKFSAYLR-QPQSI 950

Query: 604  REVSKQCFCHNFITKFP-DAY-ETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEA 660
                K  +  + I     +AY + ++G  G  L+  Q++R+ I   L+ KP++L+ LDE 
Sbjct: 951  SRAEKNAYVEDIIKLLGMEAYADAVVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLDEP 1010

Query: 661  TSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETGKF 718
            TS LD ++  +I     KL+      + +I H+ S I   E+  +++L N G  V  G  
Sbjct: 1011 TSGLDSQTAWSICQLIKKLVNHGQAILCTI-HQPSAILMQEFDRLLLLSNGGRTVYFGPL 1069

Query: 719  KE 720
             E
Sbjct: 1070 GE 1071

>TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {ON}
           Anc_8.661 YPL147W
          Length = 915

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 97/207 (46%), Gaps = 29/207 (14%)

Query: 515 LNFKIEPGTSVCIVGPSGRGKSTIALLLLRYY--NPSSGQILIDNQDIMKLNPKSLRQYM 572
           L F   PG+S+ I+GP+  GKS+I  ++   +     +G + I  +D          + M
Sbjct: 676 LPFSYGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKNGLMSIPAED----------ELM 725

Query: 573 GIVQQEPVLMSGSIRDNITY----------GLKREATPDEIREVSKQCFCHNFITKFPDA 622
            I Q+      G+ RD I Y          GLK +     + +V  +            +
Sbjct: 726 CIPQRPYFSKGGTFRDQIIYPMGSDEFFDRGLKDKLLVQILADVKLEYLLKR---DKGWS 782

Query: 623 YETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKS 682
           Y   +     +LSGG+KQR+  AR L  KP+ +ILDEAT+A+ V+ E   +Y F K++K 
Sbjct: 783 YFDAVFDWKDVLSGGEKQRMNFARILFHKPRFVILDEATNAISVDME---DYLF-KMLKK 838

Query: 683 KSVTIVSIAHRLSTIRRSEYIIVLGND 709
                +SI+ R S ++  + ++ +  D
Sbjct: 839 YRFNFISISQRPSLVKYHDLLLEISED 865

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 101/203 (49%), Gaps = 31/203 (15%)

Query: 522 GTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVL 581
           G+S+ I+GP+G GKS+I  ++   + P      I N++ +   P      +  V Q+P  
Sbjct: 644 GSSLLILGPNGCGKSSIQRIIAEIW-P------IYNKNGLLSKPTEAN--LLCVPQKPYF 694

Query: 582 M-SGSIRDNITY----------GLKREATPDEIREVSKQCFCHNFITKFPDAYETI--IG 628
              G++RD I Y          GLK +     +REV       +++ K    +  +  + 
Sbjct: 695 TRGGTLRDQIIYPMSSDEFFDRGLKDKLLVQVLREVKL-----DYLLKRDKGWSYLDTVS 749

Query: 629 PHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIV 688
               +LSGG+KQR+  AR +  KP+ ++LDEAT+A+  + E   +Y F  ++K      +
Sbjct: 750 DWKDVLSGGEKQRMNFARIMFHKPRFVVLDEATNAISADME---DYLFN-VLKRYRFNFI 805

Query: 689 SIAHRLSTIRRSEYIIVLGNDGS 711
           +I+ R S I+  + ++ + +D S
Sbjct: 806 TISQRPSLIKYHDLLLEISDDNS 828

>ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} similar
           to uniprot|Q08234 Saccharomyces cerevisiae YOL075C
           Hypothetical ORF
          Length = 1270

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 105/241 (43%), Gaps = 33/241 (13%)

Query: 502 AYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTI---------ALLLLRYYNPSSGQ 552
            +  +   Q+ +++N   +PG    I+GPSG GKS++         + LL++++  S+G 
Sbjct: 678 GWLQKKTKQILQDVNAVFKPGMINAIMGPSGSGKSSLLNLISGRSNSSLLVKFH--STGS 735

Query: 553 ILIDNQDIMKLNPKSLRQYMG---------IVQQEPVLMSGSIRDNITYGLKREATPDEI 603
           IL++   I K   KS+  Y+          +  +E    + ++R +     +R +  DEI
Sbjct: 736 ILLNTNSISKEMFKSVCSYVSQDDDHLLASLTVRETFEFAAALRLHYMTSQQRRSKIDEI 795

Query: 604 REVSKQCFCHNFITKFPDAYETIIGPHGTL-LSGGQKQRIAIARALIKKPKILILDEATS 662
                   C N          T+IG      +SGG+K+R+ I   L+    IL+LDE TS
Sbjct: 796 LLALGLTHCEN----------TVIGNEFVKGISGGEKRRVTIGVQLLNNSPILLLDEPTS 845

Query: 663 ALDVESEGAINYTFGKLMKSKSVTIVSIAH--RLSTIRRSEYIIVLGNDGSVVETGKFKE 720
            LD  +  AI      L      T++   H  R    ++  ++++L   G     G   E
Sbjct: 846 GLDSFTSAAILEILENLCTEDGKTVIITIHQPRSELFQKFGHVLLLARSGRAAFNGSPNE 905

Query: 721 L 721
           +
Sbjct: 906 M 906

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 101/226 (44%), Gaps = 20/226 (8%)

Query: 509 NQVFKN-LNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS---SGQI---LIDNQDIM 561
           N+V  N  +  +  G+ + ++G SG GK+T+  +L    +      G+I   L DN +  
Sbjct: 34  NKVLVNSFSVDLPSGSVMAVMGGSGSGKTTLLNVLASKVSKGLQLDGEIHYALEDNSEHF 93

Query: 562 KLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPD 621
             + ++   Y+      P  ++      I   LK +++ ++  E+  Q           D
Sbjct: 94  NADTEASMAYLPQHDVLPARLTCRETLMIAADLKLKSSLEKKNEIVDQLLLE---LGLRD 150

Query: 622 AYETIIG-PHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLM 680
              T++G      LSGG+K+R+++A  L+  P  + LDE T+ LD  S   +  +  KL 
Sbjct: 151 CANTLVGDARNRGLSGGEKRRLSVATQLVSNPSFMFLDEPTTGLDAYSAFLLVKSLKKLA 210

Query: 681 KSKSVTIVSIAHRLSTIRRSEYIIVLG-----NDGSVVETGKFKEL 721
           +    + +   H+     RS+ + +L      + G+VV  GK  E+
Sbjct: 211 RDGQKSFIMSVHQ----PRSDIMFLLDSVCILSKGNVVYCGKTTEM 252

>Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR070W
            (REAL)
          Length = 1424

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 114/233 (48%), Gaps = 12/233 (5%)

Query: 492  GCIEFRNLGFAY-PTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIA-LLLLRYYNPS 549
            G   +RN+ F    +  + ++  N++    PGT   ++G SG GK+T+   L  R     
Sbjct: 773  GVFIWRNVSFTIRHSNGQRKLLDNVSGYCVPGTLTALIGESGAGKTTLLNTLAQRNVGTV 832

Query: 550  SGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSG-SIRDNITYGLKREATPDEIREVSK 608
            +G IL+D   +      S  +  G VQQ+ +  +  ++R+++ +   R   P  I +V K
Sbjct: 833  TGDILVDGLPM----DASFERRTGYVQQQDLHTAELTVRESLQFS-ARMRRPQSIPDVEK 887

Query: 609  QCFCHNFIT--KFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEATSALD 665
              +    I   +  +  E ++G  G  L+  Q+++++I   L+ KP +L+ LDE TS LD
Sbjct: 888  MEYVEKIIDILEMQEFSEALVGEIGYGLNVEQRKKLSIGVELVGKPDLLLFLDEPTSGLD 947

Query: 666  VESEGAINYTFGKLMKSKSVTIVSIAHRLSTI-RRSEYIIVLGNDGSVVETGK 717
             +S  +I     +L ++    + +I    +T+  + E +++LG  G  V  G+
Sbjct: 948  SQSAWSIVKMLKRLTQAGQSILCTIHQPSATLFEQFERLLLLGKGGQTVYFGE 1000

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 38/176 (21%), Positives = 73/176 (41%), Gaps = 23/176 (13%)

Query: 510 QVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILID------NQDIMKL 563
           ++ K+++   +PG  V ++G  G G S++        N  +G +  D      +Q  M  
Sbjct: 91  KILKDVSLLAKPGEMVLVLGRPGAGCSSLLKCAAGETNQFAGDLTGDISYDGISQKEMMQ 150

Query: 564 NPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAY 623
           + K+   Y G  +Q+      +++  + + +  +     +  V+       +I    D Y
Sbjct: 151 HYKADVIYNG--EQDVHFPYLTVKQTLDFAIACKMPAKRVNNVTGA----EYIAANRDFY 204

Query: 624 ETIIGPHGTL-----------LSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
             I G   T            +SGG+++R++IA AL  +  I   D AT  LD  +
Sbjct: 205 AQIFGLAHTYDTRVGNDFVSGVSGGERKRVSIAEALAARGSIYCWDNATRGLDAST 260

>TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON} 
          Length = 1510

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 112/239 (46%), Gaps = 21/239 (8%)

Query: 494  IEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS--S 550
              +RNL +    + E + +  N++  ++PGT   ++G SG GK+T+   L         +
Sbjct: 868  FHWRNLCYDVQIKSETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVIT 927

Query: 551  GQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITYGLKREATPDEIREVSKQ 609
            G I +D        P+S+    G  QQ+ + L + ++R+++ +  +    P ++    K 
Sbjct: 928  GDIFVDGLPRDTSFPRSI----GYCQQQDLHLTTATVRESLRFSAELR-QPADVSVSEKH 982

Query: 610  CFCHNFI-----TKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEATSA 663
             +    I      K+ DA   ++G  G  L+  Q++R+ I   L  KPK+L+ LDE TS 
Sbjct: 983  AYVEEVIKILEMEKYADA---VVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSG 1039

Query: 664  LDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETGKFKE 720
            LD ++  +I     KL K     + +I H+ S I   E+  ++ L   G  V  G+  +
Sbjct: 1040 LDSQTAWSICQLMKKLAKFGQAILCTI-HQPSAILMQEFDRLLFLQKGGKTVYFGELGD 1097

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 84/197 (42%), Gaps = 35/197 (17%)

Query: 510 QVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIM--KLNPKS 567
           Q+ K+++  I+PG  + ++G  G G +T   LL    + + G  L D  +I    L PK 
Sbjct: 171 QILKSVDGLIKPGELLVVLGRPGSGCTT---LLKSITSNTHGFQLTDESEISYDGLTPKE 227

Query: 568 LRQ-----------------YMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQC 610
           +++                 ++ + Q    +       N   G+ RE   D + +V+   
Sbjct: 228 IKKHYRGDVVYNAEADIHLPHLTVFQTLVTVAKLKTPQNRFKGVTREQFADHVTDVTMAT 287

Query: 611 F--CHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
           +   H   TK  +  + + G     +SGG+++R++IA   I   K    D AT  LD   
Sbjct: 288 YGLLHTRNTKVGN--DLVRG-----VSGGERKRVSIAEVTICGSKFQCWDNATRGLD--- 337

Query: 669 EGAINYTFGKLMKSKSV 685
             A    F + +K+++V
Sbjct: 338 -SATALEFIRALKTQAV 353

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 118/238 (49%), Gaps = 19/238 (7%)

Query: 491  DGCIEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
            D  + +R+L +    + E++ +  N++  ++PGT   ++G SG GK+T+   L       
Sbjct: 850  DSVVHWRDLCYEVRIKRESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAERVTTG 909

Query: 550  --SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITY-GLKREATPDEIRE 605
              +G I +D     KL  +S  + +G  QQ+ + L + ++R+++ +  + R+  P  +  
Sbjct: 910  VITGGIFVDG----KLRDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQ--PKSVPA 963

Query: 606  VSKQCFCH---NFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEAT 661
              K+ +     N +   P A + I+G  G  L+  Q++R+ I   L+ KPK+LI LDE T
Sbjct: 964  SEKRKYVEEVINVLEMEPYA-DAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPT 1022

Query: 662  SALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETGK 717
            S LD ++  +I     KL       + +I H+ S +   E+  ++ L   G  V  G+
Sbjct: 1023 SGLDSQTAWSICQLIRKLANRGQAILCTI-HQPSAVLIQEFDRLLFLQKGGETVYFGE 1079

 Score = 36.2 bits (82), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 81/189 (42%), Gaps = 35/189 (18%)

Query: 501 FAYPTRPEN--QVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQ 558
           +  P+R  +  Q+ K+++  + PG  + ++G  G G +T    LL+  + ++  + +   
Sbjct: 143 YVRPSRKSHKFQILKSMDGIVNPGELLVVLGRPGSGCTT----LLKSVSSNAHGVHVSED 198

Query: 559 DIMKLN---PKSLRQYM---------------GIVQQEPVLMSGSIR--DNITYGLKREA 598
             +  N   P  ++++                 I   + +L    ++   N   G+ RE+
Sbjct: 199 STISYNGIAPSEIKKHFRGEVVYNAETDIHIPNISVYQTLLTVARLKTPQNRIKGVDRES 258

Query: 599 TPDEIREVSKQCF--CHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI 656
             + I EV+   +   H   TK  +  E + G     +SGG+++R++IA   I   K   
Sbjct: 259 WANHIAEVAMAMYGLSHTRDTKVGN--EVVRG-----VSGGERKRVSIAEVTICGSKFQC 311

Query: 657 LDEATSALD 665
            D AT  LD
Sbjct: 312 WDNATRGLD 320

>Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar to
           Ashbya gossypii AFR232C
          Length = 609

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 117/287 (40%), Gaps = 64/287 (22%)

Query: 411 DMSFLVVLAYG----SYLVLHGSLTIGDLTAFMLYTDYTAN--SIFGLSNFYSEIMQGVG 464
           DM    + AYG    SY+     L    +  +    +  A+       +  Y+ +++   
Sbjct: 294 DMRLQKLTAYGGNYDSYVKTRSELETNQMKQYHKQQEEIAHIKKFIASAGTYANLVKQAK 353

Query: 465 AAKRLFD-----------LTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFK 513
           + +++ D           ++DR+ + R    E+  P    + F  + F+Y  +PEN +++
Sbjct: 354 SRQKILDKMEADGLVQPVVSDRVFSFRFPEVERLPPP--VLAFDEISFSYDEKPENNLYE 411

Query: 514 NLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI--------------LIDNQD 559
           NLNF ++  + V +VGP+G GKST+  ++     P  G++                D  D
Sbjct: 412 NLNFGVDMDSRVALVGPNGVGKSTLLKIMTGELTPQGGRVSRHTHVKLGVYSQHSQDQLD 471

Query: 560 IMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKF 619
           + K   + +R   G + ++     G +     YGL  E    ++                
Sbjct: 472 LTKSALEFVRDKYGHISEDFQYWRGQLG---RYGLTGEGQTVQM---------------- 512

Query: 620 PDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDV 666
                      GT LS GQ+ R+  A   + +P +L+LDE T+ LD+
Sbjct: 513 -----------GT-LSEGQRSRVVFALLALDQPNVLLLDEPTNGLDI 547

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 28/35 (80%)

Query: 634 LSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 226 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 260

>Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR153W
            (REAL)
          Length = 1510

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 111/242 (45%), Gaps = 21/242 (8%)

Query: 491  DGCIEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
            +    +RNL +    + E + +  N++  ++PGT   ++G SG GK+T+   L       
Sbjct: 865  EAIFHWRNLCYEVQIKTETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMG 924

Query: 550  --SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITYGLKREATPDEIREV 606
              +G I +D     K  P+S+    G  QQ+ + L + ++R+++ +       P E+   
Sbjct: 925  VITGDIFVDGIPRDKSFPRSI----GYCQQQDLHLKTATVRESLRFSAYLR-QPAEVSIE 979

Query: 607  SKQCFCHNFI-----TKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEA 660
             K  +    I      K+ DA   ++G  G  L+  Q++R+ I   L  KPK+L+ LDE 
Sbjct: 980  EKDRYVEEVIKILEMEKYADA---VVGIAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEP 1036

Query: 661  TSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETGKF 718
            TS LD ++  +I     KL       + +I H+ S I   E+  ++ +   G  V  G  
Sbjct: 1037 TSGLDSQTAWSICQLMKKLANHGQAILCTI-HQPSAILMQEFDRLLFMQRGGKTVYFGDL 1095

Query: 719  KE 720
             E
Sbjct: 1096 GE 1097

>YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter actively regulated by Pdr1p; also
            involved in steroid transport, cation resistance, and
            cellular detoxification during exponential growth
          Length = 1511

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 112/242 (46%), Gaps = 21/242 (8%)

Query: 491  DGCIEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
            +    +RNL +    + E + +  N++  ++PGT   ++G SG GK+T+   L       
Sbjct: 866  EAIFHWRNLCYEVQIKAETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMG 925

Query: 550  --SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITYGLKREATPDEIREV 606
              +G IL++     K  P+S+    G  QQ+ + L + ++R+++ +       P E+   
Sbjct: 926  VITGDILVNGIPRDKSFPRSI----GYCQQQDLHLKTATVRESLRFSAYLR-QPAEVSIE 980

Query: 607  SKQCFCHNFI-----TKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEA 660
             K  +    I      K+ DA   ++G  G  L+  Q++R+ I   L  KPK+L+ LDE 
Sbjct: 981  EKNRYVEEVIKILEMEKYADA---VVGVAGEGLNVEQRKRLTIGVELTAKPKLLVFLDEP 1037

Query: 661  TSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETGKF 718
            TS LD ++  +I     KL       + +I H+ S I   E+  ++ +   G  V  G  
Sbjct: 1038 TSGLDSQTAWSICQLMKKLANHGQAILCTI-HQPSAILMQEFDRLLFMQRGGKTVYFGDL 1096

Query: 719  KE 720
             E
Sbjct: 1097 GE 1098

>Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 bp,
           1288 aa] {ON} complement(92949..93236,93239..96817)
           [3867 nt, 1289 aa]
          Length = 1288

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 111/266 (41%), Gaps = 33/266 (12%)

Query: 477 PAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKS 536
           P I  T+ E  +  D    F N      +R   ++  +++   +PG    I+GPSG GKS
Sbjct: 671 PMITVTLSEISLQVDYIRLFENWKKGQISRLSKEILHSIDATFKPGMINAIMGPSGSGKS 730

Query: 537 TIALLLLRYYNPS-------SGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSG-SIRD 588
           ++  L+      S       SG +L++   +     K+L  Y  + Q +  L+   ++R+
Sbjct: 731 SLLNLIAGKQKSSLMSKFTKSGSLLLNRTPVSNELFKNLSSY--VTQDDSHLLPRLTVRE 788

Query: 589 NITYGLK----------REATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTL-LSGG 637
              Y  +          RE+  DE+        C N          TIIG      +SGG
Sbjct: 789 TFHYAAELRLYYLSKDERESKIDELIRALSLTHCQN----------TIIGDEFVKGISGG 838

Query: 638 QKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAH--RLS 695
           +K+R+ +   L+K P IL+LDE TS LD  +   I     KL    + T++   H  R  
Sbjct: 839 EKRRVTMGIQLLKDPPILLLDEPTSGLDSFTSATILEILEKLCVEFNKTVIITIHQPRSE 898

Query: 696 TIRRSEYIIVLGNDGSVVETGKFKEL 721
             R+   +++L   G     G   E+
Sbjct: 899 LFRKFGNVLLLAKSGRTAFNGSPDEM 924

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 102/222 (45%), Gaps = 28/222 (12%)

Query: 494 IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLL-------LRYY 546
           ++ R+L  A  ++  N +  N +  +  G+ + I+G SG GK+T+  +L       L Y 
Sbjct: 20  LQVRDLTIA-ASKTNNVLINNFSLDLPSGSVMAIIGGSGSGKTTLLNVLASKISGGLSY- 77

Query: 547 NPSSGQILIDNQ---------DIMKLNPKSLRQY--MGIVQQEPVLMSG-SIRDNITYG- 593
              S + ++DN          +I+  N ++      M  V Q+ +L +G + R+ + Y  
Sbjct: 78  -EGSIKYVLDNDSNTNNSQEPNIVSDNTETETSSVSMAYVPQQDILSAGLTCRETLMYSA 136

Query: 594 -LKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTL-LSGGQKQRIAIARALIKK 651
            LK + + +   +++ Q           D  +  +G +    LSGG+K+R+ IA  +I  
Sbjct: 137 ELKIQQSKEANNQLTSQLIDE---LGLKDCADIAVGDNTHRGLSGGEKRRLNIATHMIAN 193

Query: 652 PKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHR 693
           P I+ LDE T+ LD  S   +  T  KL K    T +   H+
Sbjct: 194 PSIMFLDEPTTGLDAYSAFLVIKTLKKLAKEGGRTFIMSIHQ 235

>SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147W PXA1
           Pxa1p and Pxa2p appear to be subunits of a peroxisomal
           ATP-binding cassette transporter necessary for transport
           of long-chain fatty acids into peroxisomes ABC family
           long-chain fatty acid transporter
          Length = 836

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 99/195 (50%), Gaps = 27/195 (13%)

Query: 521 PGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPV 580
           PG+S+ I+GP+  GKS+I  ++   + P      I N++ +   P S+  +  I Q+   
Sbjct: 605 PGSSLLILGPNSCGKSSIQRIIAEIW-P------IYNKNGLLSIPTSVNLFC-IPQKPYF 656

Query: 581 LMSGSIRDNITY----------GLKREATPDEIREVSKQCFC-HNFITKFPDAYETIIGP 629
           L  G++RD I Y          G K +     ++EV  +     +   K+ DA    +  
Sbjct: 657 LQGGTLRDQIIYPMSTDEFFDRGHKDKDLVQALQEVKLEYLLKRDRGWKYLDA----VAD 712

Query: 630 HGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVS 689
              +LSGG++QR+  AR +  +P+ ++LDEAT+A+  + E   +Y F  ++K      ++
Sbjct: 713 WKDVLSGGERQRMNFARIMFHRPRFVVLDEATNAISADME---DYLFN-MLKRYRFNFIT 768

Query: 690 IAHRLSTIRRSEYII 704
           I+ R S I+  ++++
Sbjct: 769 ISQRPSLIKYHDFLL 783

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 99/196 (50%), Gaps = 21/196 (10%)

Query: 522 GTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVL 581
           G+S+ I+GP+G GKS+I  ++   + P     + +   ++ + P++    +  + Q+P  
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIAEIW-P-----VYNKNGLLSIPPEN---NIFFIPQKPYF 688

Query: 582 -MSGSIRDNITYGLKREATPD------EIREVSKQCFCHNFITKFPD-AYETIIGPHGTL 633
              G++RD I Y +  +   D      E+ ++  +      + +     Y   +     L
Sbjct: 689 SRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVKLDYLLKRAVGLTYLDAVADWKDL 748

Query: 634 LSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHR 693
           LSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K      +SI+ R
Sbjct: 749 LSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISISQR 804

Query: 694 LSTIRRSEYIIVLGND 709
            + I+  E ++ +G +
Sbjct: 805 PTLIKYHEMLLEIGEN 820

>NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661
          Length = 897

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 125/278 (44%), Gaps = 51/278 (18%)

Query: 464 GAAKRLFD--LTDRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPE--------NQVFK 513
           G  +R F+    + I  I P+   K    DG    + L F  P   +         Q FK
Sbjct: 595 GTVQRNFNGIRLENIDVIIPSKAAK----DGIKLIKKLTFQIPPHIDPMTSKTDSTQDFK 650

Query: 514 NLN------FKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKS 567
            +N      F    G+S+ I+GP+  GK++I  ++   + P      I N++ + L+  S
Sbjct: 651 QINDMSSIPFIHGSGSSLLILGPNSSGKTSIQRIIAEIW-P------IYNKNGL-LSVPS 702

Query: 568 LRQYMGIVQQEPVLMSGSIRDNITY----------GLKREATPDEIREVSKQCFCHNFIT 617
                 I Q+     SG++RD I Y          GLK       ++EV+ +     ++ 
Sbjct: 703 QENIFCIPQRPYFTSSGTLRDQIIYPMSSDEFFDRGLKDSLLIQILKEVNLK-----YLM 757

Query: 618 KFPDA--YETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYT 675
           K      Y   +     LLSGG+KQRI  AR L  KP+ ++LDEAT+A+  + E   +Y 
Sbjct: 758 KRSKGLTYLDTVADWKDLLSGGEKQRINFARILFHKPRFIVLDEATNAISQDME---DYL 814

Query: 676 FGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLG--NDGS 711
           F  ++K      ++I+ R S I+  + ++ +   NDG+
Sbjct: 815 FN-ILKKYRFNFITISQRPSLIKYHDLLLEISDHNDGT 851

>TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1036

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 114/244 (46%), Gaps = 12/244 (4%)

Query: 482 TIGEKFIPGD--GCIEFRNLGF-AYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTI 538
           T+ E F+  D    + F N+ +    ++ +  + K ++  I+PG  + ++G SG GK+T+
Sbjct: 363 TLDESFLKSDNAAALSFENITYNVSSSKTDENILKGISGIIKPGQMMALLGGSGAGKTTL 422

Query: 539 --ALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKR 596
              L + R     +G I ++  DI +   K   + +G V Q+  L+              
Sbjct: 423 LDILAMKRKTGQVTGSIKVNGSDIPR---KDFTKLIGFVDQDDYLLPTLTVYETVLNSAL 479

Query: 597 EATPDEIREVSKQCFCHNFITKFP--DAYETIIGPHGTL-LSGGQKQRIAIARALIKKPK 653
              P      +KQ   +  + +    D  + +IG      +SGG+K+R++IA  L+  P 
Sbjct: 480 LRLPRSFSFAAKQTRVYQVLEELRILDIKDRVIGNDFERGISGGEKRRVSIACELVTSPL 539

Query: 654 ILILDEATSALDVESEGAINYTFGKLMKSKSVTIV-SIAHRLSTIRRSEYIIVLGNDGSV 712
           IL LDE TS LD  +   +     +L K+ + T+V SI    S I +    +VL ++G +
Sbjct: 540 ILFLDEPTSGLDANNANNVVECLVRLAKTYNRTLVLSIHQPRSNIFQLFDKLVLLSNGEM 599

Query: 713 VETG 716
           V +G
Sbjct: 600 VYSG 603

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 114/235 (48%), Gaps = 33/235 (14%)

Query: 522 GTSVCIVGPSGRGKSTIALLLLR---YYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQE 578
           G+S+ I+GP+G GKS+I  ++      YN  +G + I +++ +   P           Q+
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIAEIWPVYN-KNGLLSIPSENNIFFIP-----------QK 685

Query: 579 PVL-MSGSIRDNITYGLKREATPD------EIREVSKQCFCHNFITK-FPDAYETIIGPH 630
           P     G++RD I Y +  +   D      E+ ++  +      + +     Y   I   
Sbjct: 686 PYFSRGGTLRDQIIYPMSSDEFFDRGFRDKELVQILVEVKLDYLLKRGVGLTYLDAIADW 745

Query: 631 GTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSI 690
             LLSGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K      +SI
Sbjct: 746 KDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISI 801

Query: 691 AHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADPTSE-LSKLLNEKQSRANKKE 744
           + R + I+  E ++ +G +      GK+ +L A  T E ++ + NE +    K E
Sbjct: 802 SQRPTLIKYHEMLLEIGEN----RDGKW-QLQAVGTDEAITSIDNEIEELERKLE 851

>ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} highly
            similar to gnl|GLV|CAGL0M01760g Candida glabrata
            CAGL0M01760g and similar to YOR153W uniprot|P33302
            Saccharomyces cerevisiae YOR153W PDR5 Short- lived
            membrane ABC (ATP-binding cassette) transporter actively
            exports various drugs expression regulated by Pdr1p also
            involved in steroid transport cation resistance and
            cellular detoxification during exponential growth
          Length = 1503

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 115/240 (47%), Gaps = 17/240 (7%)

Query: 491  DGCIEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
            +    +RNL +    + E + +  N++  ++PGT   ++G SG GK+T+   L       
Sbjct: 845  EAIFHWRNLCYDVQIKSETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMG 904

Query: 550  --SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITY-GLKREATPDEIRE 605
              +G I ++     KL  +S  + +G  QQ+ + L + ++R+++ +  + R+  P  +  
Sbjct: 905  VITGDIFVNG----KLRDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQ--PKSVPA 958

Query: 606  VSKQCFCHNFIT--KFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEATS 662
              K+ +    I   +     + I+G  G  L+  Q++R+ I   L+ KPK+L+ LDE TS
Sbjct: 959  SEKRKYVEEVIKILEMEPYADAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLVFLDEPTS 1018

Query: 663  ALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETGKFKE 720
             LD ++  +I     KL       + +I H+ S +   E+  ++ L   G  V  G+  E
Sbjct: 1019 GLDSQTAWSICQLMKKLSNHGQAILCTI-HQPSAMLMQEFDRLLFLQKGGKTVYFGELGE 1077

>TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1621

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 112/241 (46%), Gaps = 27/241 (11%)

Query: 491  DGCIEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
            +    ++NL +    + EN+ +  N++  ++PGT   ++G SG GK+T+   L       
Sbjct: 971  ESIFHWKNLCYDINIKGENRRILSNVDGWVKPGTLTALMGASGAGKTTLLDCLAERTTMG 1030

Query: 550  --SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNIT--------YGLKREA 598
              +G + +D     KL  +S  + +G  QQ+ + L + ++R+++         Y + R+ 
Sbjct: 1031 IVTGDMFVDG----KLRDESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPYSVSRKE 1086

Query: 599  TPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-L 657
                + EV K       I +     E I+G  G  L+  Q++R+ I   L  KPK+L+ L
Sbjct: 1087 KELYVEEVIK-------ILEMEKYAEAIVGVPGEGLNVEQRKRLTIGVELAAKPKLLLFL 1139

Query: 658  DEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVET 715
            DE TS LD ++  +I     KL       + +I H+ S I   E+  ++ L   G  V  
Sbjct: 1140 DEPTSGLDSQTAWSICKLMRKLANHGQAILFTI-HQPSAILMQEFDRLLFLQKGGKTVYF 1198

Query: 716  G 716
            G
Sbjct: 1199 G 1199

>KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {ON}
           Anc_3.534 YER036C
          Length = 608

 Score = 64.3 bits (155), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 93/194 (47%), Gaps = 21/194 (10%)

Query: 474 DRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGR 533
           DR+ + R    E+  P    + F N+ FAY   PE+ +++NL+F ++  + + +VGP+G 
Sbjct: 373 DRVFSFRFPQVERLPPP--VLAFDNISFAYDGNPEHNLYENLDFGVDMDSRIALVGPNGV 430

Query: 534 GKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYG 593
           GKST+  ++       +GQ++     + +     L  Y    Q +  L   ++       
Sbjct: 431 GKSTLLKIM-------TGQLMAQAGRVSRHTHVKLGVYSQHSQDQLDLTKSAL------- 476

Query: 594 LKREATPDEIREVSKQC-FCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKP 652
              E   D+   +S+   +    + ++    E+     GTL S GQ+ R+  A   +++P
Sbjct: 477 ---EFVRDKYSSISQDFQYWRGQLGRYGLTGESQTVQMGTL-SEGQRSRVVFALLALEQP 532

Query: 653 KILILDEATSALDV 666
            +L+LDE T+ LD+
Sbjct: 533 NVLLLDEPTNGLDI 546

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 28/35 (80%)

Query: 634 LSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 259

>NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_5.500
          Length = 1543

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 112/234 (47%), Gaps = 13/234 (5%)

Query: 491  DGCIEFRNLGFAYPTRPE-NQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
            +    +R+L +  P + E  ++  N++  ++PGT   ++G SG GK+T+   L       
Sbjct: 875  EAIFHWRDLCYDVPIKKEVRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMG 934

Query: 550  --SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITY-GLKREATPDEIRE 605
              +G I +D     +L  +S  + +G  QQ+ + L + ++R+++ +    R+     I E
Sbjct: 935  TITGNIYVDG----RLRDESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPAAVSIEE 990

Query: 606  VSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEATSAL 664
             +K       I +     + ++G  G  L+  Q++R+ I   L  KPK+L+ LDE TS L
Sbjct: 991  KNKYVEEVIRILEMEAYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGL 1050

Query: 665  DVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETG 716
            D ++  A      KL ++    + +I H+ S I   ++  ++ L   G  V  G
Sbjct: 1051 DSQTAWATCQLMRKLAENGQAILCTI-HQPSAILMQDFDRLLFLQKGGQTVYFG 1103

>KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} similar
           to uniprot|P41909 Saccharomyces cerevisiae YPL147W PXA1
           Pxa1p and Pxa2p appear to be subunits of a peroxisomal
           ATP-binding cassette transporter necessary for transport
           of long-chain fatty acids into peroxisomes ABC family
           long-chain fatty acid transporter
          Length = 845

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 114/238 (47%), Gaps = 35/238 (14%)

Query: 522 GTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVL 581
           G+S+ I+GP+  GKS+I  +L   + P      I N++ +   P S    +  V Q P  
Sbjct: 615 GSSLLILGPNSCGKSSIERILTEIW-P------IYNKNGLLSTPPS--HDLFCVPQRPYF 665

Query: 582 MSG-SIRDNITYGLKREATPDE----------IREVSKQCFCHNFITKFPDA--YETIIG 628
           + G + RD I Y +  E   +           +REV       +++ K      Y   I 
Sbjct: 666 IQGGTFRDQIIYPMTYEQFHERGHKDTYLVQILREVRL-----DYLLKRDRGLNYFDAIA 720

Query: 629 PHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIV 688
               +LSGG+KQR+   R +  +P+ ++LDEAT+A+ V+ E  + +T   ++K      +
Sbjct: 721 DWKDVLSGGEKQRMNFTRIMFHRPRFVVLDEATNAISVDMEDHL-FT---MLKRYRFNFI 776

Query: 689 SIAHRLSTIRRSEYIIVL--GNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKE 744
           SI+ R S I+  +Y++ L  G D S+   G   E      +E+ + LN+K ++  + E
Sbjct: 777 SISQRPSLIKYHDYLLELTNGTDWSLQALGS-DEAILSIENEI-ETLNQKLTKVKEWE 832

>KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON} 
          Length = 1517

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 100/207 (48%), Gaps = 11/207 (5%)

Query: 520  EPGTSVCIVGPSGRGKSTI-ALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQE 578
            +PGT   ++G SG GK+T+   L  R     +G +L++   I      S  +  G VQQ+
Sbjct: 891  KPGTLTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGHPI----DTSFERRTGYVQQQ 946

Query: 579  PVLMSG-SIRDNITYGLKREATPDEIREVSKQCFCHNFIT--KFPDAYETIIGPHGTLLS 635
             + +S  ++R+++ +   R   P  + +  K  +    I      D  E ++G  G+ L+
Sbjct: 947  DIHISELTVRESLQFS-ARMRRPQSVTDKEKMTYVEKIIHVLDMEDYAEALVGTVGSGLN 1005

Query: 636  GGQKQRIAIARALIKKPKILI-LDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRL 694
              Q+++++I   L+ KP +L+ LDE TS LD +S  AI     KL  S    + +I    
Sbjct: 1006 VEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLKKLAHSGQSILCTIHQPS 1065

Query: 695  STI-RRSEYIIVLGNDGSVVETGKFKE 720
            +T+  + + +++L   G  V  G   E
Sbjct: 1066 ATLFEQFDRLLLLKKGGQTVYFGNIGE 1092

>Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR070W
            (REAL)
          Length = 1421

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 109/219 (49%), Gaps = 11/219 (5%)

Query: 508  ENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIA-LLLLRYYNPSSGQILIDNQDIMKLNPK 566
            + ++  N++    PGT   ++G SG GK+T+   L  R     +G +L++   I      
Sbjct: 791  KRKLLDNVSGYCVPGTLTALIGESGAGKTTLLNTLAQRNVGTITGDMLVNGLPI----DA 846

Query: 567  SLRQYMGIVQQEPVLMSG-SIRDNITYGLKREATPDEIREVSKQCFCHNFIT--KFPDAY 623
            S  +  G VQQ+ + ++  ++R+++ +   R   P  I +  K  +    I+  +  +  
Sbjct: 847  SFARRTGYVQQQDIHIAELTVRESLQFS-ARMRRPQSIPDTEKMEYVEKIISILEMQEFS 905

Query: 624  ETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEATSALDVESEGAINYTFGKLMKS 682
            E ++G  G  L+  Q+++++I   L+ KP +L+ LDE TS LD +S  A+     +L +S
Sbjct: 906  EALVGEIGHGLNVEQRKKLSIGVELVGKPDLLLFLDEPTSGLDSQSAWAVIKVLKRLARS 965

Query: 683  KSVTIVSIAHRLSTI-RRSEYIIVLGNDGSVVETGKFKE 720
                + +I    +T+  + +++++LG  G  +  G   E
Sbjct: 966  GQSILCTIHQPSATLFEQFDWLLLLGKGGRTIYFGGIGE 1004

 Score = 35.0 bits (79), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 83/188 (44%), Gaps = 21/188 (11%)

Query: 511 VFKNLNFKIEPGTSVCIVGPSGRG-----KSTIALLLLRYYNPSSGQILIDN--QDIMKL 563
           + K+++   +PG  V ++G  G G     KS            ++G I  D   Q  M  
Sbjct: 92  ILKSVSLLAKPGEMVLVLGRPGAGCSSFLKSAAGETSQFAGGVATGAISYDGIPQKEMMR 151

Query: 564 NPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFC---HNFITK-- 618
           + KS   Y G  +Q+      +++  + + +  +     + +V+++ +      F  K  
Sbjct: 152 HYKSDVIYNG--EQDVHFPHLTVKQTLDFAIGCKMPAKRVNDVTREEYVATTREFYAKIF 209

Query: 619 -FPDAYETIIGPHG-TLLSGGQKQRIAIARALIKKPKILILDEATSALD----VESEGAI 672
                Y+T +G    + +SGG+++R++IA AL  +  I   D AT  LD    +E   AI
Sbjct: 210 GLTHTYDTKVGNDFISGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTALEFAQAI 269

Query: 673 NYTFGKLM 680
             T GKL+
Sbjct: 270 R-TMGKLL 276

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 100/240 (41%), Gaps = 55/240 (22%)

Query: 474 DRIPAIRPTIGEKFIPGD--GC-------IEFRNLGFAYPTRPENQVFKNLNFKIEPGTS 524
           +++P + P   EK I      C       I+ +++ F Y   P+  + K++N  I+  + 
Sbjct: 503 EKLPVLEPPEQEKSIDFKFPDCEKLSPPIIQLQDVSFGYS--PDKLLLKDVNLDIQMDSR 560

Query: 525 VCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSG 584
           + +VG +G GK+T+  ++L    P SG +          NP+ LR               
Sbjct: 561 IALVGANGCGKTTLLKVMLEQLRPLSGYV--------SRNPR-LR--------------- 596

Query: 585 SIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHG----------TLL 634
                I Y  +      ++   +       F  K  + Y   +G  G           LL
Sbjct: 597 -----IGYFTQHHVDSMDLSTSAVDWMSKTFPGKTDEEYRRHLGSFGITGTLGLQKMQLL 651

Query: 635 SGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI-----NYTFGKLMKSKSVTIVS 689
           SGGQK R+A A   +  P ILILDE ++ LD     A+     N+T G LM S  +++++
Sbjct: 652 SGGQKSRVAFAALCLNNPHILILDEPSNHLDTTGIDALVDAMKNFTGGILMVSHDISVIN 711

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 634 LSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAH 692
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +KS   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSH 422

>KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] {ON}
            similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011W SNQ2 ABC transporter
          Length = 1499

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 112/235 (47%), Gaps = 18/235 (7%)

Query: 492  GCIEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKST-IALLLLRYYNPS 549
            G   +RN+ +  P R   + +  N++    PGT   ++G SG GK+T +  L  R     
Sbjct: 851  GIFIWRNVCYTIPYRGSTRRLLDNVSGYCAPGTLTALMGESGAGKTTLLNTLAQRNVGII 910

Query: 550  SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITYGLKREATPDEIREVSK 608
            +G +L++   I      S  +  G VQQ+ V +   ++R+++ +   R   P  + E  K
Sbjct: 911  TGDMLVNGNHI----DASFERRTGYVQQQDVHVKEMTVRESLQFA-ARMRRPQSVPEAEK 965

Query: 609  QCFCHNFI-----TKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEATS 662
              +  + I      ++ DA   ++G  G  L+  Q+++++I   L  KP +L+ LDE TS
Sbjct: 966  MAYVEDIIEILDMEEYADA---LVGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTS 1022

Query: 663  ALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTI-RRSEYIIVLGNDGSVVETG 716
             LD +S  AI     +L ++    + +I    +T+  + + +++L   G  V  G
Sbjct: 1023 GLDSQSSWAIVQLMRRLAEAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFG 1077

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 75/190 (39%), Gaps = 44/190 (23%)

Query: 506 RPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNP 565
           R    + +N N    PG  + ++G  G G S+       +    SG+  +DN + ++   
Sbjct: 168 RKTRDIVRNANILARPGEMILVLGRPGAGCSS-------FLKTVSGE--VDNFEEVRGEI 218

Query: 566 KSLRQYMGIVQQE-------PVLMSG---------SIRDNITYGLKREATPDEIREVSKQ 609
                Y GI Q+E        V+ +G         +++  + + L        +   S+ 
Sbjct: 219 S----YDGISQKEMMAKFKTDVIYNGETDVHFPHLTVQQTLDFALSCTTPQKRLDNASRS 274

Query: 610 CFCHNFITKFPDAYETIIGPHGTL-----------LSGGQKQRIAIARALIKKPKILILD 658
                +IT   + Y TI G   T            +SGG+++R++IA AL  +  I   D
Sbjct: 275 ----EYITAMRELYGTIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALASRGSIYCWD 330

Query: 659 EATSALDVES 668
            AT  LD  +
Sbjct: 331 NATRGLDAST 340

>Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 93/195 (47%), Gaps = 19/195 (9%)

Query: 522 GTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVL 581
           G+S+ I+GP+G GKS+I  ++   +   +   L        L+  S      I Q+    
Sbjct: 638 GSSLLILGPNGCGKSSIQRIIADVWPVYNKNGL--------LSIPSENNIFCIPQKPYFS 689

Query: 582 MSGSIRDNITYGLKREATPD------EIREVSKQCFCHNFITK-FPDAYETIIGPHGTLL 634
             G++RD I Y +  +   D      E+ ++  +      + +     Y   +     LL
Sbjct: 690 RGGTLRDQIIYPMSSDEFFDRGFKDKELVQILAEVRLDYLLKRGVGLTYLDAVADWKDLL 749

Query: 635 SGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRL 694
           SGG+KQR+  AR +  KP  ++LDEAT+A+ V+ E   +Y F  L+K      +SI+ R 
Sbjct: 750 SGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLKRYRFNFISISQRP 805

Query: 695 STIRRSEYIIVLGND 709
           + I+  E ++ +G +
Sbjct: 806 TLIKYHEMLLEIGEN 820

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 64/249 (25%), Positives = 121/249 (48%), Gaps = 35/249 (14%)

Query: 494 IEFRNLGFAYPTRPENQ----VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLL--RYYN 547
           + F N+ +  P+  +N     + KN++  ++PG  + I+G SG GK+T+  +L   R   
Sbjct: 433 LSFENISYNVPSISDNNSERDILKNVSGIVKPGEIMAILGGSGAGKTTLLDILAFKRKSG 492

Query: 548 PSSGQILIDNQDIMKLNPKSLRQYMGIVQQ-----------EPVLMSGSIR--DNITYGL 594
             SG I I+ +++ +   + + + +G V Q           E VL S  +R  +++T+  
Sbjct: 493 HVSGDIKINGKNVSR---EIISKMIGFVDQDDFLFPTLTVYEAVLNSALLRLPNSMTFYQ 549

Query: 595 KREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTL-LSGGQKQRIAIARALIKKPK 653
           K++     + E+           +  +  + +IG      +SGG+K+R++IA  L+  P 
Sbjct: 550 KQQRVFQVLEEL-----------RIYNIKDRLIGDDFERGISGGEKRRVSIACELVTSPL 598

Query: 654 ILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHR-LSTIRRSEYIIVLGNDGSV 712
           IL LDE TS LD  +   +     +L K+ + T+V   H+  S I      +VL + G +
Sbjct: 599 ILFLDEPTSGLDSNNANNVVECLVRLAKNYNRTLVLTIHQPRSNIFHLFSKLVLLSSGEM 658

Query: 713 VETGKFKEL 721
           V +G+ + +
Sbjct: 659 VYSGEIRRV 667

>ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa]
            {ON} highly similar to uniprot|P33302 Saccharomyces
            cerevisiae YOR153W PDR5 Short-lived membrane ABC (ATP-
            binding cassette) transporter actively exports various
            drugs expression regulated by Pdr1p also involved in
            steroid transport cation resistance and cellular
            detoxification during exponential growth
          Length = 1486

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 112/235 (47%), Gaps = 15/235 (6%)

Query: 491  DGCIEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
            +    +RNL +    + + + +  N++  ++PGT   ++G SG GK+T+   L       
Sbjct: 841  EAIFHWRNLSYDVQIKKDTRRILDNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMG 900

Query: 550  --SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITYGLKREATPDEIREV 606
              +G + ++ +      P+S+    G  QQ+ + L + ++R+++ +       P  + E 
Sbjct: 901  VITGDVFVNGKPRDTSFPRSI----GYCQQQDLHLTTSTVRESLRFSAYLR-QPSTVSEQ 955

Query: 607  SKQCFCHNFITKFP-DAY-ETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEATSA 663
             K  +    I     +AY + ++G  G  L+  Q++R+ I   L+ KPK+L+ LDE TS 
Sbjct: 956  EKDDYVEQVIKILEMEAYADAVVGVAGEGLNVEQRKRLTIGVELVAKPKLLLFLDEPTSG 1015

Query: 664  LDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETG 716
            LD ++  ++     KL K     + +I H+ S I   E+  ++ +   G  V  G
Sbjct: 1016 LDSQTAWSVCQLMKKLAKHGQAILCTI-HQPSAILMQEFDRLLFMQRGGKTVYFG 1069

>ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} similar
           to uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1062

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 115/241 (47%), Gaps = 29/241 (12%)

Query: 494 IEFRNLGFAYPTRPENQ--VFKNLNFKIEPGTSVCIVGPSGRGKSTI--ALLLLRYYNPS 549
           + F+++ +  P   +N   V   ++  ++PG  + ++G SG GK+T+   L + +     
Sbjct: 396 LTFKDIVYQVPINRDNSETVLNEVSGVVQPGEMMALLGGSGAGKTTLLDILAMKKKAGKV 455

Query: 550 SGQILIDNQDIMKLNPKSLRQYMGIVQQ-----------EPVLMSGSIRDNITYGLKREA 598
           SGQI ++ + I K   K   + +G V Q           E VL S  +R  +   L  EA
Sbjct: 456 SGQIKVNGKSISK---KDYTKLIGFVDQDDYLLQTLTVFETVLNSALLR--LPRALPFEA 510

Query: 599 TPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTL-LSGGQKQRIAIARALIKKPKILIL 657
               + +V ++        +  D  + IIG      +SGG+K+R++IA  L+  P IL L
Sbjct: 511 KRSRVYKVLEE-------LRILDIKDKIIGNEFERGISGGEKRRVSIACELVTSPLILFL 563

Query: 658 DEATSALDVESEGAINYTFGKLMKSKSVTIV-SIAHRLSTIRRSEYIIVLGNDGSVVETG 716
           DE TS LD  +   +     +L ++   T+V SI    S I +    +VL ++G +V +G
Sbjct: 564 DEPTSGLDANNASNVVDCLVRLARNYGRTLVLSIHQPRSNIFQMFDKLVLLSNGEMVYSG 623

Query: 717 K 717
           +
Sbjct: 624 E 624

>TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa]
           {ON} Anc_3.534 YER036C
          Length = 610

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 92/194 (47%), Gaps = 21/194 (10%)

Query: 474 DRIPAIRPTIGEKFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGR 533
           DR+ + R +  ++  P    + F ++ FAY  +PEN ++ +LNF ++  + + +VGP+G 
Sbjct: 375 DRVFSFRFSQVDRLPPP--VLSFDDISFAYDGKPENNLYNHLNFGVDMDSRIALVGPNGV 432

Query: 534 GKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYG 593
           GKST+  ++       SG++        + +   L  Y    Q +  L   ++       
Sbjct: 433 GKSTLLKIMTGELQAQSGRV-------SRHSHVKLGVYSQHSQDQLDLTKSAL------- 478

Query: 594 LKREATPDEIREVSKQC-FCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKP 652
              E   D+  E+S+   +    + ++    E      GTL S GQ+ R+  A   ++ P
Sbjct: 479 ---EFVRDKYPEISQDFQYWRGQLGRYGLTGEAQTVQMGTL-SEGQRSRVVFALLALEAP 534

Query: 653 KILILDEATSALDV 666
            +L+LDE T+ LD+
Sbjct: 535 NVLLLDEPTNGLDI 548

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 28/35 (80%)

Query: 634 LSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.427
           YCR011C
          Length = 1047

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 112/244 (45%), Gaps = 35/244 (14%)

Query: 494 IEFRNLGFAYP----TRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTI--ALLLLRYYN 547
           + F N+ +  P    ++ E +V  ++   ++PG  + I+G SG GK+T+   L + R   
Sbjct: 396 LSFENISYDVPGAKDSKIEEKVLNSITGMVKPGQMLAIMGGSGAGKTTLLDILAMKRKTG 455

Query: 548 PSSGQILIDNQDIMKLNPKSLRQYMGIVQQ-----------EPVLMSGSIR--DNITYGL 594
              G I ++   I+    K   + +G V Q           E VL S  +R   ++ +  
Sbjct: 456 RVQGTIAVNGHSILN---KLYSKMIGFVDQDDFLLPTLTVYETVLNSALLRLPRSMPFTA 512

Query: 595 KREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTL-LSGGQKQRIAIARALIKKPK 653
           KR+     + E+           +  D  + IIG      +SGG+K+R++IA  L+  P 
Sbjct: 513 KRKRVNRVLEEL-----------RIMDIKDRIIGNDFERGISGGEKRRVSIACELVTSPA 561

Query: 654 ILILDEATSALDVESEGAINYTFGKLMKSKSVTIV-SIAHRLSTIRRSEYIIVLGNDGSV 712
           IL LDE TS LD  +   +     +L K+ + T+V SI    S I      +VL +DG +
Sbjct: 562 ILFLDEPTSGLDANNANNVIECLVRLAKNYNRTLVLSIHQPRSNIFNLFDKLVLLSDGEM 621

Query: 713 VETG 716
           + +G
Sbjct: 622 IYSG 625

>Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR406W
            (REAL)
          Length = 1445

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 114/243 (46%), Gaps = 23/243 (9%)

Query: 491  DGCIEFRNLGFAYPTRP-ENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
            +    +R+L +  P +  E ++  N+N  ++PGT   ++G SG GK+T+   L       
Sbjct: 797  EAIFHWRDLCYDVPVKGGERRILNNVNGWVKPGTLTALMGASGAGKTTLLDCLAERVTMG 856

Query: 550  --SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITY-GLKREATPDEIRE 605
              +G I +D     +L  +S  + +G  QQ+ + L + ++R+++ +    R+ +   + E
Sbjct: 857  VITGGIFVDG----RLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSVEE 912

Query: 606  VSKQCFCHNFI-----TKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDE 659
             +K  +    I      K+ DA   ++G  G  L+  Q++R+ I   L  +PK+L+ LDE
Sbjct: 913  KNK--YVEEVIKILEMEKYSDA---VVGIAGEGLNVEQRKRLTIGVELAARPKLLVFLDE 967

Query: 660  ATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETGK 717
             TS LD ++         KL       + +I H+ S I   ++  ++ L   G  V  G 
Sbjct: 968  PTSGLDSQTAWDTCQLMRKLATHGQAILCTI-HQPSAILMQQFDRLLFLQRGGQTVYFGD 1026

Query: 718  FKE 720
              E
Sbjct: 1027 LGE 1029

>Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR406W
            (REAL)
          Length = 1445

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/243 (25%), Positives = 114/243 (46%), Gaps = 23/243 (9%)

Query: 491  DGCIEFRNLGFAYPTRP-ENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
            +    +R+L +  P +  E ++  N+N  ++PGT   ++G SG GK+T+   L       
Sbjct: 797  EAIFHWRDLCYDVPVKGGERRILNNVNGWVKPGTLTALMGASGAGKTTLLDCLAERVTMG 856

Query: 550  --SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITY-GLKREATPDEIRE 605
              +G I +D     +L  +S  + +G  QQ+ + L + ++R+++ +    R+ +   + E
Sbjct: 857  VITGGIFVDG----RLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPSSVSVEE 912

Query: 606  VSKQCFCHNFI-----TKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDE 659
             +K  +    I      K+ DA   ++G  G  L+  Q++R+ I   L  +PK+L+ LDE
Sbjct: 913  KNK--YVEEVIKILEMEKYSDA---VVGIAGEGLNVEQRKRLTIGVELAARPKLLVFLDE 967

Query: 660  ATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETGK 717
             TS LD ++         KL       + +I H+ S I   ++  ++ L   G  V  G 
Sbjct: 968  PTSGLDSQTAWDTCQLMRKLATHGQAILCTI-HQPSAILMQQFDRLLFLQRGGQTVYFGD 1026

Query: 718  FKE 720
              E
Sbjct: 1027 LGE 1029

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 100/237 (42%), Gaps = 50/237 (21%)

Query: 494 IEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQ 552
           I+ +++ F Y    EN  + K++N  ++  + + +VG +G GK+T+  +++    P+ G 
Sbjct: 532 IQLQDVSFGYE---ENSPLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTKGY 588

Query: 553 ILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFC 612
           +          NP+ LR                    I Y  +      ++   +     
Sbjct: 589 V--------SRNPR-LR--------------------IGYFTQHHVDSMDLNTSAVDWMS 619

Query: 613 HNFITKFPDAYETIIGPHG----------TLLSGGQKQRIAIARALIKKPKILILDEATS 662
             F  K  + Y   +G  G           LLSGGQK R+A A   +  P IL+LDE ++
Sbjct: 620 KTFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSN 679

Query: 663 ALDVESEGAI-----NYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVE 714
            LD     A+     N+T G LM S  +++  I H  S I  SE   V   DG++ +
Sbjct: 680 HLDTAGLDALIDALKNFTGGVLMVSHDISV--IDHVCSEIWVSEDGTVKRFDGTIYD 734

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 634 LSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAH 692
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSH 422

>SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|P40024 Saccharomyces cerevisiae
           YER036C
          Length = 608

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/271 (20%), Positives = 117/271 (43%), Gaps = 32/271 (11%)

Query: 411 DMSFLVVLAYG----SYLVLHGSLTIGDLTAFMLYTDYTAN--SIFGLSNFYSEIMQGVG 464
           DM    + AYG    SY+     L    +  +    +  A+       +  Y+ +++   
Sbjct: 293 DMRLQQLTAYGGNYDSYVKTRSELETNQMKQYSKQQEEIAHIKKFIASAGTYANLVKQAK 352

Query: 465 AAKRLFDLTDRIPAIRPTIGEK-----FIPGDG----CIEFRNLGFAYPTRPENQVFKNL 515
           + +++ D  +    ++  + +K     F P +      + F ++ F+Y   PEN +++ L
Sbjct: 353 SRQKILDKMEADGLVQAVVADKVFSFRFPPVERLPPPVLAFDDISFSYDDNPENNLYEKL 412

Query: 516 NFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIV 575
           NF ++  + + +VGP+G GKST+  ++     P SG++            +     +G+ 
Sbjct: 413 NFGVDMDSRIALVGPNGVGKSTLLKIMTGQLMPQSGRV-----------SRHTHVKLGVY 461

Query: 576 QQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLS 635
            Q         +  + +   R+  P+  ++     +    + ++    E      GTL S
Sbjct: 462 SQHSQDQLDLTKSPLEF--VRDKYPNISQDFQ---YWRGQLGRYGLTGEAQTSQMGTL-S 515

Query: 636 GGQKQRIAIARALIKKPKILILDEATSALDV 666
            GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 516 EGQRSRVVFALLALEQPNVLLLDEPTNGLDI 546

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 28/35 (80%)

Query: 634 LSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 225 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 259

>ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON}
            Non-syntenic homolog of Saccharomyces cerevisiae YDR011W
            (SNQ2), YNR070W and YPL058C (PDR12)
          Length = 1488

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 101/209 (48%), Gaps = 17/209 (8%)

Query: 521  PGTSVCIVGPSGRGKSTIA-LLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEP 579
            PGT   ++G SG GK+T+   L  R     +G +L++   I      S  +  G VQQ+ 
Sbjct: 880  PGTLTALMGESGAGKTTLLNTLAQRNVGVITGDMLVNGLPI----DASFERRTGYVQQQD 935

Query: 580  V-LMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFI-----TKFPDAYETIIGPHGTL 633
            V +   ++R+++ +   R   P+ + E  K  +    I     + F DA   ++G  G  
Sbjct: 936  VHVKEMTVRESLQFS-ARLRRPESVSEAEKMNYVEKIIEILGMSDFADA---LVGDAGYG 991

Query: 634  LSGGQKQRIAIARALIKKPKILI-LDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAH 692
            L+  Q+++++I   L+ KP +L+ LDE TS LD +S  AI     +L +S    + +I  
Sbjct: 992  LNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSSWAIVQLLKRLAQSGQAILCTIHQ 1051

Query: 693  RLSTI-RRSEYIIVLGNDGSVVETGKFKE 720
              +T+  + + +++L   G  V  G   E
Sbjct: 1052 PSATLFEQFDRLLLLQKGGQTVYFGDIGE 1080

>YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}
           Putative ABC transporter
          Length = 1294

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 107/233 (45%), Gaps = 29/233 (12%)

Query: 510 QVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS-------SGQILIDNQDIMK 562
           ++ +++N   +PG    I+GPSG GKS++  L+      S       SG I+ ++  + +
Sbjct: 708 EILQSVNAIFKPGMINAIMGPSGSGKSSLLNLISGRLKSSVFAKFDTSGSIMFNDIQVSE 767

Query: 563 LNPKSLRQYM---------GIVQQEPVLMSGSIR-DNITYGLKREATPDEIREVSKQCFC 612
           L  K++  Y+          +  +E +  + ++R  ++T   + E T + IR +  +  C
Sbjct: 768 LMFKNVCSYVSQDDDHLLAALTVKETLKYAAALRLHHLTEAERMERTDNLIRSLGLK-HC 826

Query: 613 HNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI 672
            N I       E + G     +SGG+K+R+ +   L+  P IL+LDE TS LD  +   I
Sbjct: 827 ENNII----GNEFVKG-----ISGGEKRRVTMGVQLLNDPPILLLDEPTSGLDSFTSATI 877

Query: 673 NYTFGKLMKSKSVTIVSIAH--RLSTIRRSEYIIVLGNDGSVVETGKFKELYA 723
                KL + +  TI+   H  R    +R   +++L   G     G   E+ A
Sbjct: 878 LEILEKLCREQGKTIIITIHQPRSELFKRFGNVLLLAKSGRTAFNGSPDEMIA 930

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 88/200 (44%), Gaps = 37/200 (18%)

Query: 522 GTSVCIVGPSGRGKSTIALLL-------------LRYYNPSSG---------QILIDNQD 559
           G+ + ++G SG GK+T+  +L             +RY    +G         +  +D QD
Sbjct: 55  GSVMAVMGGSGSGKTTLLNVLASKISGGLTHNGSIRYVLEDTGSEPNETEPKRAHLDGQD 114

Query: 560 IMKLNPKSLRQYMGIVQQEPVLMSG-SIRDNITYG--LKREATPDEIREVSKQCFCHNFI 616
               +P      M  + Q+ VL    + R+ + +   LK  ++     E +K+      I
Sbjct: 115 ----HPIQKHVIMAYLPQQDVLSPRLTCRETLKFAADLKLNSS-----ERTKKLMVEQLI 165

Query: 617 TKF--PDAYETIIGPHGTL-LSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAIN 673
            +    D  +T++G +    LSGG+K+R++I   +I  P I+ LDE T+ LD  S   + 
Sbjct: 166 EELGLKDCADTLVGDNSHRGLSGGEKRRLSIGTQMISNPSIMFLDEPTTGLDAYSAFLVI 225

Query: 674 YTFGKLMKSKSVTIVSIAHR 693
            T  KL K    T +   H+
Sbjct: 226 KTLKKLAKEDGRTFIMSIHQ 245

>KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} similar to
            uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2 ABC
            transporter
          Length = 1483

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/268 (26%), Positives = 129/268 (48%), Gaps = 24/268 (8%)

Query: 491  DGCIEFRNLGFAYPTRP-ENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
            +G   ++++ +  P +  E  +  N++  ++PGT   ++G SG GK+T+   L +  +  
Sbjct: 834  EGIFLWKDICYTIPYKGGERLLLDNVSGYVKPGTLTALMGESGAGKTTLLNTLAQRTDIG 893

Query: 550  --SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITYG--LKREAT-PDEI 603
              +G +L++ + I      S  +  G VQQ+ V +   ++R+++ +   ++R  T PDE 
Sbjct: 894  VVTGDMLVNGKPI----DASFERRTGYVQQQDVHIKEMTVRESLQFSARMRRPLTVPDE- 948

Query: 604  REVSKQCFCHNFITKFP-DAY-ETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEA 660
                K  +    I      AY E ++G  G  L+  Q+++++IA  L+ KP +L+ LDE 
Sbjct: 949  ---EKLDYVEKVIEILDMSAYGEALVGNIGYGLNVEQRKKLSIAVELVAKPNLLLFLDEP 1005

Query: 661  TSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETGKF 718
            TS LD +S  AI     KL  +    + +I H+ S     E+  +++L   G  V  G  
Sbjct: 1006 TSGLDSQSAWAIVQLLKKLAGAGQSILCTI-HQPSATLFEEFDRLLLLRKGGQTVYFGDI 1064

Query: 719  KELYADPTSELSKLLNEKQSRANKKEAP 746
             E     ++ LS        R  +KE P
Sbjct: 1065 GE---HSSTLLSYFERNGARRCEEKENP 1089

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 81/183 (44%), Gaps = 28/183 (15%)

Query: 511 VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLL---LRYYNPSSGQILID---NQDIMKLN 564
           +  N+N  + PG  + ++G  G G ST    +   L ++   SG I  D    +D++K  
Sbjct: 160 IISNVNLLVRPGEMLLVLGRPGSGCSTFLKTMAGELSHFKGVSGDISYDGVSQKDMLKYF 219

Query: 565 PKSLRQYMGIVQQE-PVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAY 623
            KS   Y G +    P L   +++  + + +  +     I + ++Q     +I    D Y
Sbjct: 220 -KSDVIYNGEMDVHFPHL---TVQQTLDFAVACKTPSKRINDFTRQ----QYIEFIRDLY 271

Query: 624 ETIIGPHGTL-----------LSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAI 672
            TI G   T            +SGG+++R++IA AL  +  I   D AT  LD  +  A+
Sbjct: 272 ATIFGLKHTYNTKVGDDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDAST--AL 329

Query: 673 NYT 675
            YT
Sbjct: 330 EYT 332

>KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.661
           YPL147W
          Length = 871

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/197 (26%), Positives = 94/197 (47%), Gaps = 20/197 (10%)

Query: 522 GTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVL 581
            +S+ I+GP+G GKS+I  ++   +   +   L+   D   L        + I Q+    
Sbjct: 640 ASSLLILGPNGCGKSSIQRIIAEIWPIYNKNGLLSKPDSSSL--------LCIPQKPYFT 691

Query: 582 MSGSIRDNITYGLKREATPDE------IREVSKQCFCHNFITKFPD-AYETIIGPHGTLL 634
             G+ RD I Y +  +   D       +  +  +      + + P  +Y   +     +L
Sbjct: 692 RGGTFRDQIIYPMSSDEFFDNGFKDKVLVWILSEVHLDYLLKRAPGWSYLDEVTEWKDVL 751

Query: 635 SGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRL 694
           SGG+KQR+  AR L  KPK ++LDEAT+A+  + E   +Y F  L K +  + ++I+ R 
Sbjct: 752 SGGEKQRMNFARILFHKPKFIVLDEATNAISADME---DYLFNMLKKFR-FSFITISQRP 807

Query: 695 STIRRSEYIIVLGN-DG 710
           S I+  + ++ + + DG
Sbjct: 808 SLIKYHDMLLEIADRDG 824

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 108/250 (43%), Gaps = 60/250 (24%)

Query: 494 IEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQI 553
           I+ +++ F Y  +  N + K++N  ++  + + +VG +G GK+T+               
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTL--------------- 574

Query: 554 LIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFCH 613
                  +K+  + LR   G V +     +G +R  I Y  +      ++   +      
Sbjct: 575 -------LKVMMEQLRPLQGYVSR-----NGRLR--IGYFTQHHVDSMDLTTSAVDWMSK 620

Query: 614 NFITKFPDAYETIIGPHG----------TLLSGGQKQRIAIARALIKKPKILILDEATSA 663
            F  K  + Y   +G  G           LLSGGQK R+A A   +  P ILILDE ++ 
Sbjct: 621 TFPGKNDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 664 LDVESEGAI-----NYTFGKLMKSKSVTIV-SIAHRL-----STIRR--------SEYII 704
           LD     A+     N++ G LM S  ++++ S+ + +      T+++         ++II
Sbjct: 681 LDTTGLDALIDALKNFSGGVLMVSHDISVINSVCNEIWVSEEGTVKKFGGSIYDYRDHII 740

Query: 705 VLGNDGSVVE 714
            L ND  VV+
Sbjct: 741 SLANDAGVVK 750

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%), Gaps = 4/59 (6%)

Query: 634 LSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAH 692
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATLLVVSH 422

>YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Positive
           regulator of the Gcn2p kinase activity, forms a complex
           with Gcn1p; proposed to stimulate Gcn2p activation by an
           uncharged tRNA
          Length = 752

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 97/240 (40%), Gaps = 55/240 (22%)

Query: 474 DRIPAIRP-----TIGEKFIPGDGC----IEFRNLGFAYPTRPENQVFKNLNFKIEPGTS 524
           +++P + P     TI  KF   D      I+ +++ F Y     N + K++N  ++  + 
Sbjct: 503 EKLPVLEPPEQDKTIDFKFPECDKLSPPIIQLQDVSFGYD--ENNLLLKDVNLDVQMDSR 560

Query: 525 VCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSG 584
           + +VG +G GK+T+                      +K+  + LR   G V + P L  G
Sbjct: 561 IALVGANGCGKTTL----------------------LKIMMEQLRPLKGFVSRNPRLRIG 598

Query: 585 SIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPHG----------TLL 634
                  Y  +      ++   +      +F  K  + Y   +G  G           LL
Sbjct: 599 -------YFTQHHVDSMDLTTSAVDWMSKSFPGKTDEEYRRHLGSFGITGTLGLQKMQLL 651

Query: 635 SGGQKQRIAIARALIKKPKILILDE-----ATSALDVESEGAINYTFGKLMKSKSVTIVS 689
           SGGQK R+A A   +  P IL+LDE      T+ LD   E   N+  G LM S  ++++ 
Sbjct: 652 SGGQKSRVAFAALCLNNPHILVLDEPSNHLDTTGLDALVEALKNFNGGVLMVSHDISVID 711

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 634 LSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAH 692
            SGG + R+++ARAL  +P +L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPNTVLTVSH 422

>TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {ON}
           Anc_8.661 YPL147W
          Length = 888

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 56/207 (27%), Positives = 101/207 (48%), Gaps = 33/207 (15%)

Query: 523 TSVCIVGPSGRGKSTIALLLLRY---YNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEP 579
           +S+ I+G +  GK++I  ++ +    YN  SG + I   D +   P          Q+  
Sbjct: 648 SSLLILGSNSCGKTSIQRIIAKLWPIYN-KSGLLSIPTDDNLLFIP----------QKPY 696

Query: 580 VLMSGSIRDNITYGLKREATPDEIREV--SKQCFCH-------NFITKFPDAYETI--IG 628
            L  G++RD I Y +    +PDE  ++  + +           +++ K    +  +  I 
Sbjct: 697 FLKGGTLRDQIIYPM----SPDEFFDIGLNDKLLIDILTDVKLDYLIKRDQGWMYLDHIA 752

Query: 629 PHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIV 688
               LLSGG+KQR+  AR L  +PK +ILDEAT+A+ ++ E   +Y F  L+K      V
Sbjct: 753 EWKDLLSGGEKQRMNFARILFHRPKFIILDEATNAISIDME---DYLFN-LLKRYRFNFV 808

Query: 689 SIAHRLSTIRRSEYIIVLGNDGSVVET 715
           +I+ R S I+  + ++ + +  +  +T
Sbjct: 809 TISQRPSLIKYHDLLLEINHSSNSDDT 835

>NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {ON} 
          Length = 1502

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 115/233 (49%), Gaps = 16/233 (6%)

Query: 521  PGTSVCIVGPSGRGKST-IALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEP 579
            PGT   ++G SG GK+T +  L  R     +G +LI+ + I      S  +  G VQQ+ 
Sbjct: 883  PGTMTALMGESGAGKTTLLNTLAQRNVGIITGDMLINGRPI----DASFERRTGYVQQQD 938

Query: 580  VLMSG-SIRDNITYG--LKR-EATPDEIREVSKQCFCHNFITKFPDAYETIIGPHGTLLS 635
            V ++  ++R+++ +   ++R +A PDE +    +   H  +    +  E ++G  G  L+
Sbjct: 939  VHIAELTVRESLQFSARMRRAQAIPDEEKMAYVEKIIH--VLDMQEYAEALVGEIGRGLN 996

Query: 636  GGQKQRIAIARALIKKPKILI-LDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRL 694
              Q+++++I   L+ KP +L+ LDE TS LD +S  AI     KL ++    + +I    
Sbjct: 997  VEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIIQLLRKLAQAGQSILCTIHQPS 1056

Query: 695  STI-RRSEYIIVLGNDGSVVETGKFKELYADPTSELSKLLNEKQSRANKKEAP 746
            +T+  + + +++L   G  V    F ++  +  + L         + ++KE P
Sbjct: 1057 ATLFEQFDRLLLLKKGGQTV---YFGDVGKNSRTLLDYFEGNGARKCDRKENP 1106

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 76/177 (42%), Gaps = 25/177 (14%)

Query: 510 QVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLL----RYYNPSSGQILIDN--QDIMKL 563
           ++ +N+N   E G  V ++G  G G S+   +      ++    +G+I  D   QD M  
Sbjct: 175 KILQNVNALAEAGEMVLVLGRPGAGCSSFLKVTAGETDQFAGGVTGEIAYDGIPQDEMMK 234

Query: 564 NPKSLRQYMGIVQQE-PVLMSGSIRDNITYGLKREATPDEIREVSKQCFCHNFITKFPDA 622
             ++   Y G +    P L   +++  + + +  +     + +VSK+     +I    + 
Sbjct: 235 KYRADVIYNGELDVHFPYL---TVQQTLDFAIACKTPAKRVNDVSKE----EYIKSTREL 287

Query: 623 YETIIGPHGTL-----------LSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
           Y TI G   T            +SGG+++R++IA AL     I   D AT  LD  +
Sbjct: 288 YATIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAANGTIYCWDNATRGLDAST 344

>NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {ON}
            Anc_5.500
          Length = 1551

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 112/238 (47%), Gaps = 13/238 (5%)

Query: 491  DGCIEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
            +    +RNL +    + E + +  N++  ++PGT   ++G SG GK+T+   L       
Sbjct: 870  EAIFHWRNLCYDVQIKKETRRILSNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMG 929

Query: 550  --SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITY-GLKREATPDEIRE 605
              +G+I +D     +L   S  + +G  QQ+ + L + ++R+++ +    R+     I E
Sbjct: 930  VITGKICVDG----RLRDTSFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPANISIEE 985

Query: 606  VSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEATSAL 664
             +K       I +     + ++G  G  L+  Q++R+ I   L  KPK+L+ LDE TS L
Sbjct: 986  KNKYVEEVIDILEMEPYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGL 1045

Query: 665  DVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETGKFKE 720
            D ++  A      KL  +    + +I H+ S +   E+  ++ L   G  V  G+  +
Sbjct: 1046 DSQTAWATCQLMRKLADNGQAILCTI-HQPSAVLMQEFDRLLFLQKGGKTVYFGELGD 1102

>ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 861

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 95/201 (47%), Gaps = 27/201 (13%)

Query: 522 GTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVL 581
           G S+ I+GP+  GKS+I  ++   + P     + +   ++ +   S    +  V Q P  
Sbjct: 631 GASLLILGPNSCGKSSIQRIITEVW-P-----VYNKNGLLSIPAPS---NLFCVPQRPYF 681

Query: 582 M-SGSIRDNITY----------GLKREATPDEIREVSKQCFCHNFITKFPDAYETIIGPH 630
              G+ RD I Y          GLK +     ++EV         I     +Y   +   
Sbjct: 682 TRGGTFRDQIIYPMSSDEFFDRGLKDKNLARILKEVHLDYLLDREIGC---SYMDAVADW 738

Query: 631 GTLLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSI 690
             +LSGG+KQR+  AR L  +P+ ++LDEAT+A+ V+ E   +Y F  L+K      ++I
Sbjct: 739 KDVLSGGEKQRMNFARILFHRPRFVVLDEATNAISVDME---DYLFN-LLKRYRFNFITI 794

Query: 691 AHRLSTIRRSEYIIVLGNDGS 711
           + R S I+  + ++ + + GS
Sbjct: 795 SQRPSLIKYHDMLLEVDSSGS 815

>ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-syntenic
            homolog of Saccharomyces cerevisiae YOR153W (PDR5) and
            YDR406W (PDR15)
          Length = 1512

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 112/240 (46%), Gaps = 15/240 (6%)

Query: 486  KFIPGDGCIEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLR 544
            K I  D    +RN+ +    + E + +  N++  ++PGT   ++G SG GK+T+  +L  
Sbjct: 846  KKIGSDKIFHWRNVCYDVQIKKETRRILTNVDGWVKPGTLTALMGSSGAGKTTLLDVLAN 905

Query: 545  YYNPS--SGQILIDNQDIMKLNPKSLRQYMGIVQQEPVL-MSGSIRDNITYGLKREATPD 601
                   +G + +D          S ++  G  QQ+ +   + ++RD + +       P 
Sbjct: 906  RVRVGVVTGDMFVDGLP----RGASFQRNTGYCQQQDLHGCTQTVRDALKFSAYLR-QPQ 960

Query: 602  EIREVSKQCFCHNFITKFP-DAY-ETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LD 658
             + E     +  + I     +AY + I+G  G  L+  Q++R+ I   L+ KP++L+ LD
Sbjct: 961  SVSEAEIDAYVEDIIRLLEMEAYADAIVGVTGEGLNVEQRKRLTIGVELVAKPELLLFLD 1020

Query: 659  EATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETG 716
            E TS LD ++  ++     KL       + +I H+ S I   E+  +++L + G  V  G
Sbjct: 1021 EPTSGLDSQTAWSVCQLMRKLANHGQAVLCTI-HQPSAILMQEFDRLLLLASGGRTVYFG 1079

>TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5.500
            YDR406W
          Length = 1509

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 57/235 (24%), Positives = 112/235 (47%), Gaps = 13/235 (5%)

Query: 494  IEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS--S 550
              +RNL +    + E++ +  N++  ++PGT   ++G SG GK+T+   L         +
Sbjct: 863  FHWRNLCYDIKIKKEDRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLADRTTMGVIT 922

Query: 551  GQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITY-GLKREATPDEIREVSK 608
            G+I ++     +L  +S  + +G  QQ+ + L + ++R+++ +    R+     I E +K
Sbjct: 923  GEIFVNG----RLRDESFPRTIGYCQQQDLHLKTSTVRESLRFSAYLRQPAKVSIEEKNK 978

Query: 609  QCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEATSALDVE 667
                   I +     + ++G  G  L+  Q++R+ I   L+ KP +L+ LDE TS LD +
Sbjct: 979  YVEEVIKILEMEHYADAVVGVAGEGLNVEQRKRLTIGVELVAKPALLVFLDEPTSGLDSQ 1038

Query: 668  SEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETGKFKE 720
            +  +I     KL       + +I H+ S +   E+  ++ +   G  V  G   E
Sbjct: 1039 TAWSICQLMRKLANHGQAILCTI-HQPSAMLMQEFDRLLFMRRGGETVYFGDLGE 1092

>KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1555

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 110/234 (47%), Gaps = 19/234 (8%)

Query: 494  IEFRNLGFAYPTRPEN---QVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS- 549
              +R+L   Y  + +N   ++  N++  ++PGT   ++G SG GK+T+   L        
Sbjct: 908  FHWRDL--CYDVKIKNGTRRILSNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGV 965

Query: 550  -SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITYGLKREATPDEIREVS 607
             +G I +D     KL   S  + +G  QQ+ + L + S+R+++ +       P  + +  
Sbjct: 966  ITGYIYVDG----KLRDTSFPRSIGYCQQQDLHLKTASVRESLRFSAYLR-QPASVSKEE 1020

Query: 608  KQCFCHNFITKFP-DAY-ETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEATSAL 664
            K  +    I     +AY + I+G  G  L+  Q++R+ I   L  KP++L+ LDE TS L
Sbjct: 1021 KDAYVEEVIKILEMEAYADAIVGVAGEGLNVEQRKRLTIGVELAAKPRLLVFLDEPTSGL 1080

Query: 665  DVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETG 716
            D ++  A      KL +     + +I H+ S I   E+  ++ L   G  V  G
Sbjct: 1081 DSQTAWATCQLMRKLAEHGQAILCTI-HQPSAILMQEFDRLLFLQKGGQTVYFG 1133

>Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}
            YOR153W (PDR5) - multidrug resistance transporter [contig
            336] FULL
          Length = 1474

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 121/267 (45%), Gaps = 22/267 (8%)

Query: 467  KRLFDLTDRIPAIRPTIGE-KFIPGDGCIEFRNLGFAYPTRP-ENQVFKNLNFKIEPGTS 524
            KRLFD T  + +    +G  +    +    +++L +  P +    ++  +++  ++PGT 
Sbjct: 799  KRLFDDTTEVGSSISVLGNVQLSKSEAIFHWKSLCYDVPIKGGTRRILDHVDGWVKPGTL 858

Query: 525  VCIVGPSGRGKSTIALLLLRYYNPS--SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-L 581
              ++G SG GK+T+   L         +G ILI+          S  + +G  QQ+ + L
Sbjct: 859  TALMGASGAGKTTLLDCLASRVTTGVVTGDILINGNK----RDASFARSIGYCQQQDLHL 914

Query: 582  MSGSIRDNITYGLKREATPDEIREVSKQCFCHNFI-----TKFPDAYETIIGPHGTLLSG 636
             + ++R+++ +       P  +    K  +    I      K+ DA   ++G  G  L+ 
Sbjct: 915  QTATVRESLRFAAHLR-QPQSVPSSEKDKYVDEVIKILEMEKYADA---VVGVAGEGLNV 970

Query: 637  GQKQRIAIARALIKKPKILI-LDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLS 695
             Q++R+ I   L  +PK+L+ LDE TS LD ++  +I     KL       + +I H+ S
Sbjct: 971  EQRKRLTIGVELAARPKLLLFLDEPTSGLDSQTAWSICQLMRKLANHGQAILCTI-HQPS 1029

Query: 696  TIRRSEY--IIVLGNDGSVVETGKFKE 720
             +   E+  ++ L   G  V  G+  +
Sbjct: 1030 ALLMQEFDRLLFLQRGGQTVYFGELGD 1056

>SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa]
            {ON} highly similar to uniprot|P32568 Saccharomyces
            cerevisiae YDR011W SNQ2 ABC transporter
          Length = 1484

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/268 (23%), Positives = 125/268 (46%), Gaps = 26/268 (9%)

Query: 488  IPGDGCIEFRNLGFAYPTRP-ENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIA-LLLLRY 545
            +  +G   ++++ +  P +  + Q+  N++    PGT   ++G SG GK+T+   L  R 
Sbjct: 831  LQSEGVFLWKDVCYTIPFKGGQRQLLDNISGYCAPGTLTALMGESGAGKTTLLNTLAQRN 890

Query: 546  YNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITYGLKREATPDEIR 604
                +G +L++   I      S  +  G VQQ+ + +   ++R+++ +   R   P+ I 
Sbjct: 891  VGIITGDMLVNGSPI----DASFERRTGYVQQQDIHIKEMTVRESLQFS-ARMRRPESIP 945

Query: 605  EVSKQCFCHNFI-----TKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LD 658
            +  K  +    I      ++ DA   ++G  G  L+  Q+++++I   L  KP +L+ LD
Sbjct: 946  DSEKMSYVEKLIEILGMQEYADA---LVGDVGYGLNVEQRKKLSIGVELAAKPNLLLFLD 1002

Query: 659  EATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTI-RRSEYIIVLGNDGSVVETGK 717
            E TS LD ++  AI     KL ++    + +I    +T+  + + +++L   G  V    
Sbjct: 1003 EPTSGLDSQASWAIVQLLKKLAQAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTV---- 1058

Query: 718  FKELYADPTSELSKLLNEKQSRANKKEA 745
                Y  P  E S++L +   R   ++ 
Sbjct: 1059 ----YFGPIGEHSRVLLDYFERNGARQC 1082

>Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON}
           complement(67726..68058) [333 nt, 111 aa]
          Length = 110

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 32/73 (43%), Positives = 50/73 (68%), Gaps = 3/73 (4%)

Query: 642 IAIARALIKKPKILILDEATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSE 701
           I +ARAL++  KIL++DEAT+++D E++  +  T     + + VTIV+IAHRL TI   +
Sbjct: 2   ICLARALLRSTKILLIDEATASIDYEADAKLQETIQ--TEFQDVTIVAIAHRLQTIIDYD 59

Query: 702 YIIVLGNDGSVVE 714
            I+VL + G V+E
Sbjct: 60  KILVL-DAGQVIE 71

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 61.6 bits (148), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 110/242 (45%), Gaps = 54/242 (22%)

Query: 493 CIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQ 552
            + F  + FAY   PE+ +++NLNF ++  + + +VGP+G GKST+  ++     P +G+
Sbjct: 392 VLAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGR 451

Query: 553 ILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQCFC 612
           +            +     +G+  Q         +D +   L + A      E  ++ + 
Sbjct: 452 V-----------SRHTHVKLGVYSQHS-------QDQLD--LTKSAL-----EFVREKYS 486

Query: 613 HNFITKFPDAYETIIGPHGT----------LLSGGQKQRIAIARALIKKPKILILDEATS 662
           H  I++    +   +G +G            LS GQ+ R+  A   ++ P IL+LDE T+
Sbjct: 487 H--ISQDFQYWRGQLGRYGLTGDGQKAQMGTLSEGQRSRVVFALLALQAPNILLLDEPTN 544

Query: 663 ALDVES----EGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGN------DGSV 712
            LD+ +      AIN TF     +  V +VS   RL   + ++ I V+ N      DGS+
Sbjct: 545 GLDIPTIDSLAEAIN-TF-----NGGVVVVSHDFRLLD-KIAQDIFVVENKTAYRWDGSI 597

Query: 713 VE 714
           +E
Sbjct: 598 LE 599

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 28/35 (80%)

Query: 634 LSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON} 
          Length = 610

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 102/221 (46%), Gaps = 28/221 (12%)

Query: 456 YSEIMQGVGAAKRLFDLTDRIPAIRPTIGEK-----FIPGDG----CIEFRNLGFAYPTR 506
           Y+ +++   + +++ D  +    I+P   +K     F P +      + F ++ F+Y   
Sbjct: 346 YANLVKQAKSRQKILDKMEADGLIQPVQADKVFSFRFPPVERLPPPVLAFDSISFSYDGN 405

Query: 507 PENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPSSGQILIDNQDIMKLNPK 566
           PEN +++NL+F ++  + + +VGP+G GKST+  ++     P SG++            +
Sbjct: 406 PENNLYENLDFGVDMDSRIALVGPNGVGKSTLLKIMTGELTPQSGRV-----------SR 454

Query: 567 SLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIREVSKQC-FCHNFITKFPDAYET 625
                +G+  Q     S    D     L  E   D+   +S+   +    + ++    E 
Sbjct: 455 HTHVKLGVYSQH----SQDQLDLTKSAL--EFVRDKYPNISQDFQYWRGQLGRYGLTGEG 508

Query: 626 IIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALDV 666
                GT LS GQ+ R+  A   +++P +L+LDE T+ LD+
Sbjct: 509 QTVQMGT-LSEGQRSRVVFALLALEQPNVLLLDEPTNGLDI 548

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 28/35 (80%)

Query: 634 LSGGQKQRIAIARALIKKPKILILDEATSALDVES 668
           +SGG K R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5.500
          Length = 1509

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 115/239 (48%), Gaps = 23/239 (9%)

Query: 491  DGCIEFRNLGFAYPTRPENQ-VFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRYYNPS 549
            +    +RNL +    + E + +  N++  ++PGT   ++G SG GK+T+   L       
Sbjct: 861  EAIFHWRNLCYDVQIKTETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMG 920

Query: 550  --SGQILIDNQDIMKLNPKSLRQYMGIVQQEPV-LMSGSIRDNITY-GLKREATPDEIRE 605
              +G++ ++     +L  +S  + +G  QQ+ + L + ++R+++ +    R+ +   I E
Sbjct: 921  VITGEVSVNG----RLRDESFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPSDVSIEE 976

Query: 606  VSKQCFCHNFI-----TKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDE 659
             +K  +    I      K+ DA   ++G  G  L+  Q++R+ I   L  KPK+L+ LDE
Sbjct: 977  KNK--YVEEIIKILEMEKYADA---VVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDE 1031

Query: 660  ATSALDVESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEY--IIVLGNDGSVVETG 716
             TS LD ++  +I     KL       + +I H+ S I   E+  ++ +   G  V  G
Sbjct: 1032 PTSGLDSQTAWSICQLMKKLADHGQAILCTI-HQPSAILMQEFDRLLFMQRGGKTVYFG 1089

>KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] {ON} 
          Length = 1501

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 111/236 (47%), Gaps = 12/236 (5%)

Query: 492  GCIEFRNLGFAYPTRP-ENQVFKNLNFKIEPGTSVCIVGPSGRGKST-IALLLLRYYNPS 549
            G   +R++ F  P    + ++  N++    PGT   ++G SG GK+T +  L  R     
Sbjct: 851  GVFIWRDVCFTIPYDGGQRRLLDNVSGYCIPGTMTALMGESGAGKTTLLNTLAQRNVGVI 910

Query: 550  SGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSG-SIRDNITYGLKREATPDEIREVSK 608
            +G +L++   I      S  +  G VQQ+ + ++  ++R+++ +   R   P  I +  K
Sbjct: 911  TGDMLVNGHPI----DTSFERRTGYVQQQDIHIAEMTVRESLRFS-ARMRRPQHIPDAEK 965

Query: 609  QCFCHNFIT--KFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILI-LDEATSALD 665
              +    I      +  E ++G  G+ L+  Q+++++I   L  KP +L+ LDE TS LD
Sbjct: 966  LDYVEKIIQVLNMEEYAEALVGALGSGLNVEQRKKLSIGVELAAKPDLLLFLDEPTSGLD 1025

Query: 666  VESEGAINYTFGKLMKSKSVTIVSIAHRLSTI-RRSEYIIVLGNDGSVVETGKFKE 720
             +S  AI     KL  S    + +I    +T+  + + +++L   G  V  G   E
Sbjct: 1026 SQSSWAIIQLLKKLAASGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDIGE 1081

 Score = 41.2 bits (95), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 77/178 (43%), Gaps = 27/178 (15%)

<