Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A071706.25ON77177139490.0
SAKL0E01452g6.25ON73774718880.0
Kpol_1037.296.25ON74676018700.0
KNAG0M012306.25ON73875018400.0
YOR001W (RRP6)6.25ON73374818380.0
Suva_15.1766.25ON74575218320.0
ZYRO0C07678g6.25ON74175718200.0
KAFR0G026606.25ON73576218060.0
NCAS0H008606.25ON75576417840.0
Smik_15.1706.25ON77375717850.0
CAGL0E02585g6.25ON73776017700.0
Skud_15.1626.25ON73475317640.0
TPHA0J003706.25ON74375417520.0
TDEL0G044406.25ON73574217470.0
KLLA0D01309g6.25ON74475517390.0
NDAI0D008506.25ON79077617340.0
ACL001C6.25ON74575917270.0
Kwal_56.224476.25ON73574916640.0
KLTH0C11066g6.25ON73575115840.0
Ecym_30306.25ON74775115830.0
Kpol_467.11.380ON128974830.31
ZYRO0A04356g3.211ON2489100726.6
ADL067C7.246ON63995717.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07170
         (771 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6...  1525   0.0  
SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} simila...   731   0.0  
Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {O...   724   0.0  
KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {...   713   0.0  
YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nucle...   712   0.0  
Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001...   710   0.0  
ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} simila...   705   0.0  
KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.2...   700   0.0  
NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {O...   691   0.0  
Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001...   692   0.0  
CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} simila...   686   0.0  
Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001...   684   0.0  
TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON...   679   0.0  
TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.2...   677   0.0  
KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} simila...   674   0.0  
NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {O...   672   0.0  
ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON} S...   669   0.0  
Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001...   645   0.0  
KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {...   614   0.0  
Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to ...   614   0.0  
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    37   0.31 
ZYRO0A04356g Chr1 (350421..357890) [7470 bp, 2489 aa] {ON} simil...    32   6.6  
ADL067C Chr4 complement(560732..562651) [1920 bp, 639 aa] {ON} S...    32   7.0  

>TBLA0A07170 Chr1 (1784984..1787299) [2316 bp, 771 aa] {ON} Anc_6.25
           YOR001W
          Length = 771

 Score = 1525 bits (3949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 751/771 (97%), Positives = 751/771 (97%)

Query: 1   MLIVILKEYVIKTLLLTYPNTRPNFMSEDNCEELLENIVGVVRASTALAAQDVDFYKSLD 60
           MLIVILKEYVIKTLLLTYPNTRPNFMSEDNCEELLENIVGVVRASTALAAQDVDFYKSLD
Sbjct: 1   MLIVILKEYVIKTLLLTYPNTRPNFMSEDNCEELLENIVGVVRASTALAAQDVDFYKSLD 60

Query: 61  KKVSDSLNKTANDTLDIANSLLLSIDENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHF 120
           KKVSDSLNKTANDTLDIANSLLLSIDENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHF
Sbjct: 61  KKVSDSLNKTANDTLDIANSLLLSIDENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHF 120

Query: 121 IDALSKPNNFNGKYNETTFLDNNSRTNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEK 180
           IDALSKPNNFNGKYNETTFLDNNSRTNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEK
Sbjct: 121 IDALSKPNNFNGKYNETTFLDNNSRTNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEK 180

Query: 181 PNALKPLKDSLVLVPESGIVPTHYLQPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIW 240
           PNALKPLKDSLVLVPESGIVPTHYLQPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIW
Sbjct: 181 PNALKPLKDSLVLVPESGIVPTHYLQPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIW 240

Query: 241 IDTKESLADLLMDLRKQSEIAVDLEHHDLRSYYGITCLMQISTREQDYIVDTISLRDDLI 300
           IDTKESLADLLMDLRKQSEIAVDLEHHDLRSYYGITCLMQISTREQDYIVDTISLRDDLI
Sbjct: 241 IDTKESLADLLMDLRKQSEIAVDLEHHDLRSYYGITCLMQISTREQDYIVDTISLRDDLI 300

Query: 301 VLNEIFTNPNITKVFHGASMDIIWLQRDLGLYIVSLFDTFHASKALGLARHSLAYLLENY 360
           VLNEIFTNPNITKVFHGASMDIIWLQRDLGLYIVSLFDTFHASKALGLARHSLAYLLENY
Sbjct: 301 VLNEIFTNPNITKVFHGASMDIIWLQRDLGLYIVSLFDTFHASKALGLARHSLAYLLENY 360

Query: 361 ASFKTSKKYQLADWRRRPLTNNMLAYARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRN 420
           ASFKTSKKYQLADWRRRPLTNNMLAYARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRN
Sbjct: 361 ASFKTSKKYQLADWRRRPLTNNMLAYARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRN 420

Query: 421 VAKRRFEYLKFRPTVPLPNLYTLIEKEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARR 480
           VAKRRFEYLKFRPTVPLPNLYTLIEKEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARR
Sbjct: 421 VAKRRFEYLKFRPTVPLPNLYTLIEKEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARR 480

Query: 481 DDESPRYIMPTQVLISLISYTPTDSSGVISVSNMVTEHVRSNSTTLANLIKKALEXXXXX 540
           DDESPRYIMPTQVLISLISYTPTDSSGVISVSNMVTEHVRSNSTTLANLIKKALE     
Sbjct: 481 DDESPRYIMPTQVLISLISYTPTDSSGVISVSNMVTEHVRSNSTTLANLIKKALESTKSI 540

Query: 541 XXXXXXXXXXXXXXXDTNVASLISITEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFS 600
                          DTNVASLISITEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFS
Sbjct: 541 PNSSDSSSTFNMSRTDTNVASLISITEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFS 600

Query: 601 NIMTSSPKISDYSKDKTTSFKSEDMIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEIT 660
           NIMTSSPKISDYSKDKTTSFKSEDMIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEIT
Sbjct: 601 NIMTSSPKISDYSKDKTTSFKSEDMIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEIT 660

Query: 661 TENPIPTLEPKSTQKKTTKEINEDNEEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKK 720
           TENPIPTLEPKSTQKKTTKEINEDNEEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKK
Sbjct: 661 TENPIPTLEPKSTQKKTTKEINEDNEEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKK 720

Query: 721 IFQKKDETINGNSKKRKSFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771
           IFQKKDETINGNSKKRKSFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR
Sbjct: 721 IFQKKDETINGNSKKRKSFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771

>SAKL0E01452g Chr5 (108911..111124) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 737

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/747 (51%), Positives = 517/747 (69%), Gaps = 13/747 (1%)

Query: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85
           MS D  ++LL N+VG VRA++AL+AQD+DF+KSLD  +S S+  +++  L++ N +LLSI
Sbjct: 1   MSSDKPDKLLSNLVGTVRAASALSAQDLDFFKSLDSGISKSVEGSSSKLLNLINEVLLSI 60

Query: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145
           DEN   +E GKD   + W    +IMDNL EKSDH  DAL K N+ N   +   +LD++SR
Sbjct: 61  DENNDTIEYGKDNFQESWKDIGDIMDNLFEKSDHAFDAL-KRNSINQGNSNVQYLDDSSR 119

Query: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205
           +N NPSKRIEKPQL F  P+DNT+S PFKPLL  KP+AL+PL + L   PE+  +P+HY 
Sbjct: 120 SNLNPSKRIEKPQLNFKTPIDNTESHPFKPLLENKPHALRPLSEILKQTPETENIPSHYP 179

Query: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265
            PY YEID QEYNE +++IRDP P +PWE T  +W+DTKESL  LL +LR   EIAVDLE
Sbjct: 180 HPYGYEIDTQEYNESILQIRDPIPSQPWEDTDPVWVDTKESLQKLLNELRSAKEIAVDLE 239

Query: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325
           HHD RSYYGI CLMQISTRE+D++VDTI+LR++L VLNEIFT+P++ KVFHGA MDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQISTRERDWLVDTIALREELHVLNEIFTDPSVLKVFHGAFMDIIWL 299

Query: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385
           QRDLG+Y+VSLFDT+HAS++LGL RHSLAYLLE +A FKTSKKYQLADWR RPLT  M A
Sbjct: 300 QRDLGIYVVSLFDTYHASRSLGLPRHSLAYLLEKFAQFKTSKKYQLADWRIRPLTKPMRA 359

Query: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445
           YAR+DTHFLLNI+DQLRN+LI+QNKLA VLH+SRNVAKRRFEY  FRP +   ++++ IE
Sbjct: 360 YARADTHFLLNIYDQLRNSLIEQNKLAAVLHDSRNVAKRRFEYTSFRPKIVSADVFSPIE 419

Query: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505
           K+ PW++L+ QYNI   +E L++KL+EWRD IARRDDESPRY+MP Q+L+SL++  PTD 
Sbjct: 420 KDEPWRNLMYQYNIPLSREPLMRKLYEWRDTIARRDDESPRYVMPNQLLVSLVAIAPTDP 479

Query: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDTNVASLISI 565
           +GV+SVSN +T++VRSNS  L+NLIKK LE                    D  ++ ++SI
Sbjct: 480 AGVLSVSNFITDYVRSNSKMLSNLIKKTLESLKNGDVSTNNAGSSQLEEKD--LSQVLSI 537

Query: 566 TEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLF-SNIMTSSPKISDYSKDKTTSFKSED 624
           ++I N+CL+FNSL+     +   T+ +   S+LF  + + S+ +   YSK+         
Sbjct: 538 SQIQNMCLQFNSLASKVKKANSATNSMPKVSILFDGDHIFSNDRAVLYSKNSKIVIDENQ 597

Query: 625 MIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTTKEINED 684
           +  R + +SE LK +   + F     V   ++ E++ +    + +    +   T  +  +
Sbjct: 598 LQERKLEVSEKLKEVQEPD-FRLHVNVTTKETDEVSKD---VSEKDDVNRASETDPLETN 653

Query: 685 NEEIIVLKKVNRKYQKGKKDADKDSTV-VVDYSKAKKIFQKKDETINGNSKKRKSFDPYN 743
            +EIIVLKK  R   + +K     + V  +DY  A+K+     ++    + KR+ FDPY 
Sbjct: 654 KDEIIVLKKKKRHEPQDRKKVGNSTDVEPMDYKNAEKLLGNSKKSSKQKTTKRR-FDPYT 712

Query: 744 NDGDTDKVPRALKKRQTNTRGKNISYK 770
           ++   +  P++ KKR+  T GKN+S+K
Sbjct: 713 SE---NVGPQSAKKRKKPTPGKNMSFK 736

>Kpol_1037.29 s1037 complement(68981..71221) [2241 bp, 746 aa] {ON}
           complement(68981..71221) [2241 nt, 747 aa]
          Length = 746

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/760 (49%), Positives = 519/760 (68%), Gaps = 28/760 (3%)

Query: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85
           MSED  +ELL ++V  VRA+++LAAQDVDFY++LDK++S SLN+++ +  ++ N+LLLSI
Sbjct: 1   MSEDINKELLSSVVSTVRAASSLAAQDVDFYRNLDKEISTSLNESSKEITNMINTLLLSI 60

Query: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145
           +EN   LE GK+ +  +W  FSN+MDNL EKSD  +D +++    N   +E  +L ++++
Sbjct: 61  NENNEELESGKEGLEQYWKDFSNVMDNLFEKSDRSLDIITRSKTSNDNKSEFQYLSDSAQ 120

Query: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205
           ++SNPSKR+ KPQL FS+PVDN++S+PF PLL +KP+++K   DSL+++PES  +P+HY 
Sbjct: 121 SDSNPSKRVTKPQLQFSRPVDNSESKPFMPLLNDKPHSIKSFTDSLIIIPESEELPSHYA 180

Query: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265
            PYE EID QEYN  V+++ +P   +PW + S  W+DT E+L  +L  L++ +EIAVDLE
Sbjct: 181 HPYEVEIDKQEYNASVLQVAEPLKSQPWNSEST-WVDTSEALQSMLDKLKECTEIAVDLE 239

Query: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325
           HHD RSYYGI CLMQISTR++D++VDT++LRD+L +LNE+F +PNI KV HGA MDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQISTRKEDFLVDTLALRDELHILNEVFADPNILKVLHGAFMDIIWL 299

Query: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385
           QRDLGLY+VSLFDT+HAS+ALG  RHSLAYLLE YA+FKTSKKYQLADWR RPL+  M A
Sbjct: 300 QRDLGLYVVSLFDTYHASRALGFPRHSLAYLLEKYANFKTSKKYQLADWRVRPLSKPMHA 359

Query: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445
           YAR+DTHFLLNI+DQ+RN LI++NKLA VL ESRNVAKRRFEY +FRP VP P ++T IE
Sbjct: 360 YARADTHFLLNIYDQIRNQLIRENKLAEVLFESRNVAKRRFEYSRFRPKVPSPAVFTPIE 419

Query: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505
           KE PW++L+ QYN+   K  L++++WEWRDMIARRDDESPRYIMP Q++ISL+ YTP D 
Sbjct: 420 KEEPWRTLVYQYNVPSTKIELLKRIWEWRDMIARRDDESPRYIMPNQLMISLVEYTPIDP 479

Query: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDTNVAS-LIS 564
           +GVISVSN++T+HVRSNS  +ANLIKK+LE                        AS  ++
Sbjct: 480 AGVISVSNVMTDHVRSNSKVIANLIKKSLEDMKSVPAGALTAFQNIDYKIGQKFASDKLT 539

Query: 565 ITEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKTTSFKSED 624
           I++I N+   F  ++ + +  +   S  ++  +LFSNI  S  +I  Y  DK     +E 
Sbjct: 540 ISQIQNMTALFKEIASNPSIIEKDVSK-KIDPILFSNIFLSKNEIVLYDHDKRHVVTNEQ 598

Query: 625 MIARHIRLSEGLKGL--SANNSFIYQPPVEDIKSIEITTENP---------IPTLEPKST 673
           +  R    +E ++G    ANN+ +    +    S E+  E P          P +     
Sbjct: 599 LAGR----AEEVEGFMNEANNTTL---AINIESSAEMHVEEPEAKEKNALFSPPISNVEN 651

Query: 674 QKKTTKEINEDNEEIIVLKKVNRK--YQKGKKDADKDSTVVVDYSKAKKIFQKKDETING 731
              +  +  ED  +IIVLK V ++   +  KK     +  V+DYSK   I  K+      
Sbjct: 652 ASSSNTDGFEDMNDIIVLKDVKKRTNIKDHKKKQGMPNKEVIDYSKLDTILSKEKRE--- 708

Query: 732 NSKKRKSFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771
           NSKKRK  DP+  +   +  P+A KKR+   RGKN+S+KR
Sbjct: 709 NSKKRKG-DPFGEENGLEG-PKAAKKRKQINRGKNVSFKR 746

>KNAG0M01230 Chr13 complement(223471..225687) [2217 bp, 738 aa] {ON}
           Anc_6.25 YOR001W
          Length = 738

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/750 (49%), Positives = 501/750 (66%), Gaps = 16/750 (2%)

Query: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85
           M  +  ++LL   VG VRAS++L  QDV F+ +LD  V+ S+ +  N+ L++ N +L SI
Sbjct: 1   MDSEEQKKLLSKAVGTVRASSSLVGQDVQFFSNLDANVASSVKELGNEVLEMINDILFSI 60

Query: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYN-ETTFLDNNS 144
           DEN  P  E  +++ + W  F+N+ DNL EKSD  +D +++    NG+   E  +LD+  
Sbjct: 61  DENSKPFAESAEQVGESWRDFTNLTDNLFEKSDRSMDIIAQGTRKNGQAGSEVQYLDDLV 120

Query: 145 RTNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHY 204
             +S+  KRI KPQL FS+PVDN++S+PFKPLL EKPNALKPLK+SL +VP +  +P+HY
Sbjct: 121 GNDSSSGKRITKPQLHFSRPVDNSESQPFKPLLTEKPNALKPLKESLQMVPATENIPSHY 180

Query: 205 LQPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDL 264
             PY+YEI NQEYN +++E R P P  PW  +  +W+D+ E L  LL DL+K  E+A+DL
Sbjct: 181 PNPYDYEISNQEYNNDILETRAPIPSTPWHESEPVWVDSTEGLQSLLKDLKKYKELAIDL 240

Query: 265 EHHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIW 324
           EHHD RSYYGI CLMQISTR+ DY+VDTI+LRD+L +LN++FT+P +TKVFHGA MDIIW
Sbjct: 241 EHHDYRSYYGIVCLMQISTRDTDYLVDTIALRDELHILNQVFTDPMVTKVFHGAFMDIIW 300

Query: 325 LQRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNML 384
           LQRDLGLYIVSLFDTFHASKALG  +HSLAYLLE  A+FKTSKKYQLADWR RPL+  M 
Sbjct: 301 LQRDLGLYIVSLFDTFHASKALGFPKHSLAYLLETLANFKTSKKYQLADWRIRPLSKPMS 360

Query: 385 AYARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLI 444
            YAR+DTHFLLNIFDQ+RN LIK NKLAGVL ESR VAKRRFEY KFRP +  P+++T I
Sbjct: 361 VYARADTHFLLNIFDQMRNQLIKDNKLAGVLGESRKVAKRRFEYSKFRPKLAQPDVFTPI 420

Query: 445 EKEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTD 504
           EKE+PW++L+ QYN+  EKE LV+ L+EWRD IARRDDESPRYIMP Q+LISL +YTPTD
Sbjct: 421 EKESPWRTLMFQYNVTPEKEELVKALYEWRDTIARRDDESPRYIMPNQLLISLSAYTPTD 480

Query: 505 SSGVISVSNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDTNVASLIS 564
              ++SV++ VT+ VRSNS  LANLIK  +E                    +T+   +++
Sbjct: 481 PVSLVSVNSYVTDCVRSNSKVLANLIKSFVE-----SSKLGPQSSYTPNTENTSTPFVLT 535

Query: 565 ITEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKTTSFKSED 624
           +++I +I ++F  L++++ +S          S  F ++      +S Y+  KTT      
Sbjct: 536 LSQIKDIGMRFTKLTENFQSSSCQKISPLQRSSFFGDLSKGKVTVS-YNDAKTTPVSQSV 594

Query: 625 MIARHIRLSEGLKGLSANNSFIYQPP--VEDIKSIEITTENPIPTLEPKSTQKKTTKEIN 682
           + +R  + +E +K         Y+ P  VE +  + I +           T +K  K I 
Sbjct: 595 LESRSKQFNEYMKAF---GDIEYKIPSIVEPVMDLPIPSGTTSTESADSKTVEKPPKNIK 651

Query: 683 EDNEEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKKIF-QKKDETINGNSKKRKSFDP 741
           ED +EI+VLKKV R+  K K + +     +VDYSK  K+  Q++ +    N+  +K FDP
Sbjct: 652 EDMDEIVVLKKVKRELPKPKGNDEDAEREIVDYSKEDKVLVQRQFDKKKKNNNNKKRFDP 711

Query: 742 YNNDGDTDKVPRALKKRQTNTRGKNISYKR 771
           ++   +    P+A KKR+  T+GKN S+KR
Sbjct: 712 FSAISEG---PKAPKKRKAVTKGKNASFKR 738

>YOR001W Chr15 (326832..329033) [2202 bp, 733 aa] {ON}  RRP6Nuclear
           exosome exonuclease component; has 3'-5' exonuclease
           activity; involved in RNA processing, maturation,
           surveillance, degradation, tethering, and export; has
           similarity to E. coli RNase D and to human PM-Sc1 100
           (EXOSC10); mutant displays reduced transcription
           elongation in the G-less-based run-on (GLRO) assay
          Length = 733

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/748 (50%), Positives = 500/748 (66%), Gaps = 17/748 (2%)

Query: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85
           M+ +N + LL  ++ VVRA+++LA+QDVDFYK+LD+  S  L   A+   D+AN ++LSI
Sbjct: 1   MTSENPDVLLSRVINVVRAASSLASQDVDFYKNLDRGFSKDLKSKADKLADMANEIILSI 60

Query: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145
           DE+    E  ++ I D WN F NIMDNL+E SDH +D L+   N   + ++  +L   S 
Sbjct: 61  DEHHESFELKEEDISDLWNNFGNIMDNLLEMSDHSLDKLNCAINSKSRGSDLQYLGEFSG 120

Query: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205
            N +P+KR+EKPQL F  P+DN++S PF PLL EKPNALKPL +SL LV +    P+HY 
Sbjct: 121 KNFSPTKRVEKPQLKFKSPIDNSESHPFIPLLKEKPNALKPLSESLRLVDDDENNPSHYP 180

Query: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265
            PYEYEID+QEY+ E+++IR+  P K W+ +  IW+DT   L  +L DL+   EIAVDLE
Sbjct: 181 HPYEYEIDHQEYSPEILQIREEIPSKSWDDSVPIWVDTSTELESMLEDLKNTKEIAVDLE 240

Query: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325
           HHD RSYYGI CLMQISTRE+DY+VDT+ LR++L +LNE+FTNP+I KVFHGA MDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISTRERDYLVDTLKLRENLHILNEVFTNPSIVKVFHGAFMDIIWL 300

Query: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385
           QRDLGLY+V LFDT+HASKA+GL RHSLAYLLEN+A+FKTSKKYQLADWR RPL+  M A
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 360

Query: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445
           YAR+DTHFLLNI+DQLRN LI+ NKLAGVL+ESRNVAKRRFEY K+RP  P   +Y+ IE
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPLTPSSEVYSPIE 420

Query: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505
           KE+PWK L+ QYNI  E+E+LV++L++WRD+IARRDDESPR++MP Q+L +L++YTPTD 
Sbjct: 421 KESPWKILMYQYNIPPEREVLVRELYQWRDLIARRDDESPRFVMPNQLLAALVAYTPTDV 480

Query: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDTNVASLISI 565
            GV+S++N VTEHVR N+  LANLI+ AL                     D  +   IS+
Sbjct: 481 IGVVSLTNGVTEHVRQNAKLLANLIRDALR-NIKNTNEEATPIPSSETKADGILLETISV 539

Query: 566 TEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDK-TTSFKSED 624
            +I ++  +F+ L  + N SK     +  SS+L   I+        YSKD      K+ED
Sbjct: 540 PQIRDVMERFSVLC-NSNISKSRAKPVTNSSILLGKILPREEHDIAYSKDGLPNKVKTED 598

Query: 625 MIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTTKEINED 684
           +  R       L  L      I +P V  +K  EI T +P       ++    + EI  D
Sbjct: 599 IRIRAQNFKSALANLEDIIFEIEKPLVVPVKLEEIKTVDP-------ASAPNHSPEI--D 649

Query: 685 N-EEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKKIFQKKDETINGNSKKRKSFDPYN 743
           N ++++VLKK N + ++  K+        VDYSK   I   K    N   KKR+ FDP +
Sbjct: 650 NLDDLVVLKKKNIQKKQPAKEKGVTEKDAVDYSKIPNILSNKPGQNNRQQKKRR-FDPSS 708

Query: 744 NDGDTDKVPRALKKRQTNTRGKNISYKR 771
           +D +    PRA KKR+   +GKN+S+KR
Sbjct: 709 SDSNG---PRAAKKRRPAAKGKNLSFKR 733

>Suva_15.176 Chr15 (301216..303453) [2238 bp, 745 aa] {ON} YOR001W
           (REAL)
          Length = 745

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/752 (50%), Positives = 496/752 (65%), Gaps = 31/752 (4%)

Query: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85
           M+ +N + LL  +V V+RA+++LAAQDVDFY++LD+  S  L   ++   ++ N ++LSI
Sbjct: 19  MASENSDVLLSKVVNVIRAASSLAAQDVDFYRNLDRDFSKILQSKSSKLTEMVNGIVLSI 78

Query: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145
           DE+   LE  ++ I D W  F NIMDNL+EKSDH +D L++ +N N    +  +L + S 
Sbjct: 79  DEHHDSLELKEEEISDLWKDFGNIMDNLLEKSDHSLDNLNRTSNSNNSAADLQYLGDFSG 138

Query: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205
            +S P+KR+EKPQL F  P+DN++S PF PLL EKPNALKPL DSL ++      P HY 
Sbjct: 139 KDSQPTKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRMIETEENSPGHYP 198

Query: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265
            PYEYEID+QEYN  +++I+   P KPW+ +  IWI++K +L  +L DL+   EIAVDLE
Sbjct: 199 HPYEYEIDHQEYNPNILQIKPEIPSKPWDASEPIWINSKATLKSMLEDLKNAHEIAVDLE 258

Query: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325
           HHD RSYYG+ CLMQ+STRE+DY+VDT+ LR+DL +LNE+FTNP+I KVFHGA MDIIWL
Sbjct: 259 HHDYRSYYGVVCLMQVSTRERDYLVDTLELREDLHILNEVFTNPSIVKVFHGAFMDIIWL 318

Query: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385
           QRDLGLY+V LFDT+HASKA+GL RHSLAYLLEN+A+FKTSKKYQLADWR RPL+  M A
Sbjct: 319 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIRPLSKPMTA 378

Query: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445
           YAR+DTHFLLNI+DQLRN LI+ NKLAGVL+ESRNVAKRRFEY K+RP  P   +Y+  E
Sbjct: 379 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPITPSSKVYSPTE 438

Query: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505
           KE PW+ L+ QYNI  E+E LV+ L+EWRD+IARRDDESPR+IMP Q+L +L++YTP D 
Sbjct: 439 KENPWRVLMYQYNIAPEREELVKDLYEWRDVIARRDDESPRFIMPNQLLAALVAYTPIDV 498

Query: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDTNVASL--I 563
            GV+S+SN VT+HVR N+  LANLIK AL                         ASL  I
Sbjct: 499 IGVVSLSNGVTDHVRQNAKILANLIKSALRSMKDTHKESAEIVSSKFKS-----ASLEAI 553

Query: 564 SITEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDK-TTSFKS 622
           ++++I +I  +F+  S + + ++  +     SS+LF  I+        Y         K 
Sbjct: 554 TVSQIRDIMDRFSVFSSN-SVTEDRSMDSTASSILFGKILPYEEGDIVYEDSGLPHKVKV 612

Query: 623 EDMIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTTKEIN 682
           EDM  R  R +  L GL            EDIK      E P+   + +  + +TT E  
Sbjct: 613 EDMRDRAQRFNSALVGL------------EDIK---FEVEKPVNVEKSEMVKIETTPEPP 657

Query: 683 ---EDNEEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKKIFQKKDETINGNSKKRKSF 739
              ED +E++VLKK     ++  K +D  +   VDYSK   +   K    N   +KR+ F
Sbjct: 658 TKIEDPDEVVVLKKKRIHKKQVAKRSDVAAEEAVDYSKIPNVLSSKPGQNNKQQRKRR-F 716

Query: 740 DPYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771
           DP  ND +    PRA KK++  TRGKN+S+KR
Sbjct: 717 DPSFNDSEG---PRAPKKKRPTTRGKNVSFKR 745

>ZYRO0C07678g Chr3 (582236..584461) [2226 bp, 741 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 741

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/757 (50%), Positives = 511/757 (67%), Gaps = 27/757 (3%)

Query: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85
           M+E++ E+LL  +VG VRA+ ALAAQDVDFY+SLDK V+ SL+KT+N+ + + NS LL I
Sbjct: 1   MAEESNEQLLPKVVGTVRAAAALAAQDVDFYRSLDKGVAKSLDKTSNELVSMINSTLLCI 60

Query: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145
           D+N   LE GK+++ D    FSN+MDNL EKSD  +D L +    + K     +LD+ +R
Sbjct: 61  DQNSRLLEGGKEKLEDSRKDFSNLMDNLFEKSDRSLDIL-RGRAPDRKGAALMYLDDAAR 119

Query: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205
           ++  P+KRI KPQ+ F +P+DNT++ PFKPLL  KP+AL+PL D + LV     +P HY 
Sbjct: 120 SDMIPAKRILKPQVRFQRPIDNTETHPFKPLLENKPHALRPLSDCVRLVQADEDIPEHYP 179

Query: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265
           QPYEYEI+NQEYNE +++I +P P KPW+ +  +W+D KESL  +L DL+K +EIAVDLE
Sbjct: 180 QPYEYEIENQEYNESILKIAEPIPSKPWDGSEPVWVDNKESLDSMLQDLKKSTEIAVDLE 239

Query: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325
           HHD RSYYGI CLMQ+STR+ DY+VDT++LRDDL+VLNE+F NP I KVFHGA MDIIWL
Sbjct: 240 HHDYRSYYGIVCLMQVSTRQTDYLVDTLALRDDLVVLNEVFANPLIVKVFHGAFMDIIWL 299

Query: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385
           QRDLGLYIVSLFDT+HAS+ALG  RHSLAYLLE +ASFKTSKKYQLADWR RPL+  M A
Sbjct: 300 QRDLGLYIVSLFDTYHASRALGFPRHSLAYLLETFASFKTSKKYQLADWRVRPLSKAMSA 359

Query: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445
           YAR+DTHFLLNI+DQLRN LI +NKLAGVL ESRNVAKR F+Y K+RP VP  ++Y+ ++
Sbjct: 360 YARADTHFLLNIYDQLRNKLIIENKLAGVLAESRNVAKRSFQYSKYRPKVPNSSVYSPVD 419

Query: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505
           +   WK L+ QYNI  EKEILV+ L+EWRD IARRDDESPRY+MP Q+L  L+ YTP D 
Sbjct: 420 RADGWKVLMNQYNIPLEKEILVKNLYEWRDTIARRDDESPRYVMPNQLLAYLVDYTPLDP 479

Query: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDTNVASLISI 565
           +GVISVS  VT+HVR+N+  LANLI K+L+                    D  ++ ++++
Sbjct: 480 TGVISVSPTVTDHVRTNAKALANLIVKSLQQIADAGSDIKVESVQHKDQHD--LSQVLTV 537

Query: 566 TEINNICLKFNSLSKHYNTSKFLTSGI----EVSSLLFSNIMTSSPKISDYSKDKTTSFK 621
            +I +   +F+ LSK +   K L+ G       SS++F NI+ +      Y +       
Sbjct: 538 GQIESQVSQFHDLSKAF---KGLSQGTNSSNSSSSIIFGNILHAPCGFVGYGRSLKKPVT 594

Query: 622 SEDMIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQ------- 674
            + +  R + LSE L+ + A  +   Q   E+ +  E+T E   P  + K ++       
Sbjct: 595 DKQIEKRKLELSEALEFIDAETATTIQ---EEDRGSELTHE---PADDKKVSENDESKKE 648

Query: 675 KKTTKEINEDNEEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKKIFQKKDETINGNSK 734
           +    E  ED  EII LKKV  + +K K+  + +    +DY K+KKI + + ++    S 
Sbjct: 649 EAKETEPEEDKNEIITLKKVKDRGKKSKRSNESEPEEPIDYKKSKKILETEKKS---KST 705

Query: 735 KRKSFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771
           K+++FDPY    D    P+  KKR+   RGK+ S+KR
Sbjct: 706 KKRAFDPYAASNDAGNAPKPKKKRRM-ARGKSASFKR 741

>KAFR0G02660 Chr7 (549718..551925) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/762 (48%), Positives = 501/762 (65%), Gaps = 56/762 (7%)

Query: 32  EELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSIDENCSP 91
           ++LL ++V  VRAS+ LAAQDVDFY+SLD +VS S+N+  ++  D+ NS++LSIDEN   
Sbjct: 7   KKLLSDVVNTVRASSTLAAQDVDFYRSLDSEVSHSINEVTDELNDMVNSIILSIDENYET 66

Query: 92  LEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALS-----KPNNFNGKYNETTFLDNNSRT 146
           L+EGK+ + + W   SNI+DNL EKSD  +D L      KP N   +Y      +N + T
Sbjct: 67  LDEGKEELTESWKSLSNIVDNLFEKSDRSLDILKTGAKKKPTNPPFEY-----FENATTT 121

Query: 147 NSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYLQ 206
            + P KRI KPQL F  P+DN++S PF PLL EKPNALK + +S  L+     VP HY  
Sbjct: 122 ENIPQKRINKPQLKFVPPIDNSESHPFIPLLKEKPNALKTIDESTKLINSDENVPEHYAH 181

Query: 207 PYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLEH 266
           PYEYEIDNQ YN+ ++++R+P P K W  T  +W+D  ESL  +L D++K +EIA+DLEH
Sbjct: 182 PYEYEIDNQPYNDSILQVREPIPSKSWSETEGVWVDNVESLNHMLNDIKKYTEIAIDLEH 241

Query: 267 HDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWLQ 326
           HD R+YYGI CLMQISTRE DY+VDTI+LR+DL VLNE+FT+P++ KV HGA MDIIWLQ
Sbjct: 242 HDYRTYYGIVCLMQISTRETDYLVDTIALRNDLKVLNEVFTDPSVVKVLHGAFMDIIWLQ 301

Query: 327 RDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLAY 386
           RDLGLYIVSLFDTFHAS+ALG  RHSLAYLLE +A+FKTSKKYQLADWR RPL+  M AY
Sbjct: 302 RDLGLYIVSLFDTFHASRALGFPRHSLAYLLEEFANFKTSKKYQLADWRVRPLSKAMTAY 361

Query: 387 ARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIEK 446
           AR+DTHFLLNI+DQLRN L++ NKL GVL+ESRNVAKRRFEY KFRP VP PN+Y+ +EK
Sbjct: 362 ARADTHFLLNIYDQLRNRLVETNKLVGVLNESRNVAKRRFEYSKFRPRVPSPNVYSALEK 421

Query: 447 EAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDSS 506
           E PW++L+ QYNI  E+E L++ L+EWRDMIARRDDESPRYIMP Q++++L++YTPTD +
Sbjct: 422 EDPWRTLMFQYNIPSEREDLLKGLFEWRDMIARRDDESPRYIMPNQLMVTLVAYTPTDPA 481

Query: 507 GVISVSNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDTNVASLISIT 566
           GVIS S +VT++VRSNS  +ANLIK AL                       +   + +++
Sbjct: 482 GVISASQVVTDYVRSNSKIIANLIKNALTRAKDQNRQLQFVADNHTRESYRSTDKM-TVS 540

Query: 567 EINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPK---ISDYSKDKTTSFKSE 623
           +I      F  +++   T        +  S   SN   S  K   I +Y   +  S K +
Sbjct: 541 QIKETASVFIQIAEKLGTCN--NDQQQSKSFARSNYFGSLSKKLDIIEYKNGEKHSVKQQ 598

Query: 624 DMIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTTKEINE 683
            +++R    ++ +  L+   +  Y+ PV                 EP   QK   +E+ +
Sbjct: 599 QLVSRFNTYTKQVNELT---NVRYELPVHK---------------EPPQLQKDDVEEVKK 640

Query: 684 -------------DNEEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKKIFQKKDETIN 730
                        D +E++VLKKVNR+  K K + + +    +DYSK++KI +   +   
Sbjct: 641 TIIADSIPAKPEIDLDEVVVLKKVNRQPNKTKLE-ENEKIDFIDYSKSEKILKGDKQRKK 699

Query: 731 GNSKKRKSFDPY--NNDGDTDKVPRALKKRQTNTRGKNISYK 770
             SKKR+ FDP+  +N+G     P+A +KR++ TRG+N+SYK
Sbjct: 700 RESKKRQ-FDPFAASNEG-----PKAARKRKSGTRGRNLSYK 735

>NCAS0H00860 Chr8 complement(156180..158447) [2268 bp, 755 aa] {ON}
           Anc_6.25 YOR001W
          Length = 755

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/764 (48%), Positives = 497/764 (65%), Gaps = 27/764 (3%)

Query: 26  MSEDNCEE---LLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLL 82
           MSE + E+   LL  +V  VRA++ALAAQDVDFY+S+DK ++ SL +++N   D+ NS+L
Sbjct: 1   MSEQSQEQEKTLLPKVVNTVRAASALAAQDVDFYRSIDKDIAHSLEQSSNQIADMINSVL 60

Query: 83  LSIDENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDN 142
           LSIDEN   ++  K+ + D W  F N+MDNL EKSD  ID +++ +  +   +   ++D 
Sbjct: 61  LSIDENSEQVDGTKENLEDIWKDFGNLMDNLFEKSDRSIDIITRGHGGSNGQSGMQYIDE 120

Query: 143 NSRTNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPT 202
            S  +  P K+I KPQL F+ P+DNT+S PF PLL EKP ALKPL++S+ ++PE    P 
Sbjct: 121 FSGRDLTPGKQILKPQLKFTTPIDNTESHPFIPLLKEKPFALKPLEESMQMIPEDETSPM 180

Query: 203 HYLQPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAV 262
           HY QPYEYEID+QEYN+ +++ +DP P   W     IW+DT   L  ++ DL   +EIAV
Sbjct: 181 HYPQPYEYEIDHQEYNDLILQKKDPIPSTSWTDNEPIWVDTVSQLQSIMPDLEASTEIAV 240

Query: 263 DLEHHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDI 322
           DLEHHD R+YYGITCLMQISTR+ DY++DT++LR+DL +LN +F NP ITKVFHGA MDI
Sbjct: 241 DLEHHDYRTYYGITCLMQISTRKNDYLIDTLALREDLQILNNVFANPMITKVFHGAFMDI 300

Query: 323 IWLQRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNN 382
           IWLQRDLGLY+V LFDTFHAS+A+GL +HSLAYLLE +A FKTSKKYQLADWR RPL+  
Sbjct: 301 IWLQRDLGLYVVGLFDTFHASRAMGLPKHSLAYLLEKFAQFKTSKKYQLADWRIRPLSKA 360

Query: 383 MLAYARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPN--L 440
           M AYAR+DTHFLLNIFDQ+RN+LI+QNKLAGVL ESRNVAKRRFEY  FRP V   N  +
Sbjct: 361 MHAYARADTHFLLNIFDQMRNSLIEQNKLAGVLKESRNVAKRRFEYSSFRPKVLQTNGLV 420

Query: 441 YTLIEKEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISY 500
           Y+ IEK+ PWK+++ QYNI  +KE L+++L++WRD IARRDDESPR++MP Q+L+SL++Y
Sbjct: 421 YSPIEKDDPWKTIMFQYNIPPQKEPLLKELYQWRDKIARRDDESPRFVMPNQLLVSLVAY 480

Query: 501 TPTDSSGVISVSNMVTEHVRSNSTTLANLIKKALEXXXXXX---XXXXXXXXXXXXXXDT 557
           TP D+ GV+SVSN VT++VRSNS  LANLIK  L                          
Sbjct: 481 TPIDAPGVVSVSNSVTDYVRSNSKILANLIKNCLAKMKDNKFLDNNVAEEGISVVPETGH 540

Query: 558 NVASLISITEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKT 617
           +++  ++I ++ N+  KF  LS  +N S            LF  I  +      Y  D  
Sbjct: 541 DLSQKLTIHQLQNLKSKFQLLSDKFNNSVKTRLSNHDQLYLFDGISFADDVTIKYFADGK 600

Query: 618 TSFKSEDMIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKT 677
               +E    R  +  + +K L      I  P +E+ K  +   ++ IP +   +  +  
Sbjct: 601 IQTTAEQYKERSEQFDDAMKQLEEVEYCI--PVIEENKQTQ--DQDNIPPITVATNAEGQ 656

Query: 678 TKEI---NEDNEEIIVLKKVNR-KYQKGK-KDADKDSTVVVDYSKAKKIFQKKDETING- 731
             E+    ED +E+IVL+K N+ K  K K K+ ++    ++DY K  K+      +  G 
Sbjct: 657 VNEMIEKPEDLDEVIVLRKTNKNKSIKNKPKNREEPELEIIDYFKTAKVLTNDKNSRGGR 716

Query: 732 --NSKKRKSFDPYN--NDGDTDKVPRALKKRQTNTRGKNISYKR 771
             N  KRK FDPY+  N+G     P A KKR+  TRGKN+S+KR
Sbjct: 717 NNNGNKRKRFDPYSAANEG-----PAAPKKRKNVTRGKNVSFKR 755

>Smik_15.170 Chr15 (294013..296334) [2322 bp, 773 aa] {ON} YOR001W
           (REAL)
          Length = 773

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/757 (49%), Positives = 487/757 (64%), Gaps = 29/757 (3%)

Query: 23  PNFMSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLL 82
           P  M+  N + LL  +V V+RA+++LA QDVDFYK+LD++    L   ++   D+AN ++
Sbjct: 38  PYVMASQNPDVLLSKVVNVIRAASSLAGQDVDFYKNLDREFGKVLKSKSDKLADMANEII 97

Query: 83  LSIDENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDAL-----SKPNNFNGKYNET 137
           LSIDE+    E   + I   WN F NIMDNL+E SDH +D L     SKPN  + +Y   
Sbjct: 98  LSIDEHHESFELKDEDISGLWNDFGNIMDNLLEMSDHSLDKLNRAVTSKPNGADLQY--- 154

Query: 138 TFLDNNSRTNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPES 197
             L + S  N +P+KR+EKPQL F  P+DN++S PF PLL EKPNALKPL DSL L+ E 
Sbjct: 155 --LGDFSEKNLSPAKRVEKPQLKFKTPIDNSESHPFIPLLKEKPNALKPLSDSLRLIEED 212

Query: 198 GIVPTHYLQPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQ 257
              P+HY  PYEYEID+QEY   +++IR   P K W  +  IWIDT   L  +L +L+  
Sbjct: 213 DNTPSHYPHPYEYEIDHQEYGSNILQIRKEIPSKSWNDSEPIWIDTMPKLESMLEELKNV 272

Query: 258 SEIAVDLEHHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHG 317
            EIAVDLEHHD RSYYGI CLMQISTRE+DY+VDT+ LR+ L +LNE+FT+P+I KVFHG
Sbjct: 273 QEIAVDLEHHDYRSYYGIVCLMQISTREKDYLVDTLELRETLHILNEVFTDPSIVKVFHG 332

Query: 318 ASMDIIWLQRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRR 377
           A MDIIWLQRDLGLY+V LFDT+HASKA+GL RHSLAYLLEN+A+FKTSKKYQLADWR R
Sbjct: 333 AFMDIIWLQRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRIR 392

Query: 378 PLTNNMLAYARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPL 437
           PL+  M+AYAR+DTHFLLNI+DQLRN LI+ NKLAGVL+ESRNVAKRRFEY K+RP +P 
Sbjct: 393 PLSKPMIAYARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKYRPRIPS 452

Query: 438 PNLYTLIEKEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISL 497
             +Y+ IEKEAPW+ L+ QYNI  EKE LV+ L++WRD+IARRDDESPR++MP Q+L +L
Sbjct: 453 SEVYSPIEKEAPWRVLMYQYNITSEKEELVKDLYQWRDVIARRDDESPRFVMPNQLLAAL 512

Query: 498 ISYTPTDSSGVISVSNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDT 557
           ++YTP D  GVIS++N +TEHVR N+  L NLIK +L                     + 
Sbjct: 513 VAYTPIDVIGVISLTNGITEHVRQNAKVLVNLIKNSLRHIKDTYKEDSPVTFSESMTNEV 572

Query: 558 NVASLISITEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKT 617
           ++ + I+I +I +I  +F+ LS + N S          S+L   I+        Y  +  
Sbjct: 573 SLEA-ITIPQIRDIMERFSVLS-NSNVSNCRAKNGATPSILLGRILPLEENDIAYKNNGL 630

Query: 618 TS-FKSEDMIARHIRLSEGLKGLSANNSFIYQPPV--EDIKSIEITTENPIPTLEPKSTQ 674
            +  K ED+ AR    +  L  L      + +P +   ++K IE      +P        
Sbjct: 631 PNRVKFEDIRARAQSFNSALSNLEDCMLEVEKPHILPTNVKKIERINTEDVP-------- 682

Query: 675 KKTTKEINEDNEEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKKIFQKKDETINGNSK 734
            K +  I E+ ++I+VLKK N    +     D      +DYSK   +   K +      K
Sbjct: 683 -KHSATI-ENPDDIVVLKKKNIHRTQSMNAKDTMGEKAIDYSKIPNVLSSKSDQNRRQQK 740

Query: 735 KRKSFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771
           KR+S DP  ND D    PRA KK++  TRG+N+S+KR
Sbjct: 741 KRRS-DPLFNDSDG---PRAAKKKRPATRGRNVSFKR 773

>CAGL0E02585g Chr5 (246427..248640) [2214 bp, 737 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001w RRP6
          Length = 737

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/760 (49%), Positives = 503/760 (66%), Gaps = 37/760 (4%)

Query: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85
           MS D+ + +L+ ++  VRAS ALA+QDV+F+KS+D  V++SL K+      + N++LLSI
Sbjct: 1   MSSDSGDNVLKKVMETVRASNALASQDVEFHKSIDTSVANSLEKSMKSMASVMNNILLSI 60

Query: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145
           D N   L+   + + +    FSN+MD L EK+D  +D L++ ++ N       FLD+ + 
Sbjct: 61  DNNNEKLDGTNENLEEVCKEFSNVMDVLFEKADRSLDILNRKSSTNDNKKNMQFLDDVNV 120

Query: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205
             ++PS+RI KPQL F  PVDN++S PFKPLL+EKPNALK +++S  LV  +  +P H+ 
Sbjct: 121 AENDPSRRISKPQLNFKTPVDNSESHPFKPLLIEKPNALKSIEESTQLVLATEDIPEHFQ 180

Query: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265
           QPYEYEI NQEYN +++E ++P P   W  T+AIW+D   SL D++ +L+K SEIAVDLE
Sbjct: 181 QPYEYEILNQEYNNDILEKKEPIPSTSWVDTNAIWVDNINSLQDMMQELKKSSEIAVDLE 240

Query: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325
           HHD RSYYG+ CLMQISTR QDYIVDTI+LRDDL +LNE+FTNP ITKVFHGA MDIIWL
Sbjct: 241 HHDFRSYYGLVCLMQISTRTQDYIVDTIALRDDLKMLNEVFTNPLITKVFHGAFMDIIWL 300

Query: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385
           QRDLGLYIVSLFDTFHASKALGL +HSLAYLLE YA+FKTSKKYQLADWRRRPL+  M+A
Sbjct: 301 QRDLGLYIVSLFDTFHASKALGLPKHSLAYLLEKYANFKTSKKYQLADWRRRPLSKAMMA 360

Query: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445
           YAR+DTHFLLNIFDQ+RN LI   KLAGVL ESRNVA RRFEY K++P +P+ N++T +E
Sbjct: 361 YARADTHFLLNIFDQMRNGLISSGKLAGVLRESRNVALRRFEYSKYKPKIPVANIFTPVE 420

Query: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505
           KE+PW++L+ QYNI  +KE L+++L+EWRDM+ARRDDESPRY+MP Q+L+SL++Y P D 
Sbjct: 421 KESPWRTLMYQYNIPVDKEPLIRELYEWRDMMARRDDESPRYVMPNQLLVSLVAYGPVDP 480

Query: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDTNVASLISI 565
             V+SVS++VT+HVR NS TLANLIKK LE                      +    +  
Sbjct: 481 ISVVSVSSVVTDHVRRNSKTLANLIKKKLEEIKLGEVKSINNRLPSSLDVSQDELQFLPS 540

Query: 566 TEINNICLKF----NSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKTTSFK 621
            +I  +   F    N L++   + + +T     SS++ S I+        Y      S +
Sbjct: 541 HKIELMTGAFKEIENQLTQATKSKQAMT-----SSVVLSEILLHPEHAVKYHNGSACSVE 595

Query: 622 SEDMIARHIR-LSEGLKGLSANNSFIYQPPVEDIKSIEITTEN-PIPTLE---PKSTQKK 676
             ++  R++  +   L   S N + +          +E +  N P+ T E    KS Q +
Sbjct: 596 ESELKDRYLSYIKATLLAASKNINMV----------LETSNSNAPLETEETHNKKSDQIQ 645

Query: 677 TTKEINEDNEEIIVL--KKVNRKYQKGKKDADKDSTVV---VDYSKAKKIFQKKDETING 731
              E  ED +EI+VL  KK++   QK K D   D  +V   VDYSKA  I    +  +  
Sbjct: 646 VIPEKQEDMDEIVVLKKKKIHSNDQKAKHD---DGDIVEEPVDYSKA-NILASDNREVKK 701

Query: 732 NSKKRKSFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771
             KKR  FDPY++ G+    P+A KKR+  T+GK IS+K+
Sbjct: 702 KDKKR-VFDPYSSTGEG---PKAAKKRRLVTKGKKISFKK 737

>Skud_15.162 Chr15 (286822..289026) [2205 bp, 734 aa] {ON} YOR001W
           (REAL)
          Length = 734

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/753 (49%), Positives = 481/753 (63%), Gaps = 26/753 (3%)

Query: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85
           M  +N + L   IV VVRA+++LA+QDVDFYK+L+++ S+ L   ++   D+ N ++LSI
Sbjct: 1   MPSENPDVLFSKIVKVVRAASSLASQDVDFYKNLEREFSNVLKSKSDKLTDMVNEIILSI 60

Query: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145
           DE+    E  +D I   W  F NIMDNL+E SDH +D L+   N      E  +L + S 
Sbjct: 61  DEHHESFELKEDEISGLWKDFGNIMDNLLEMSDHSLDKLNHTANSKVSGAELQYLGDFSG 120

Query: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205
            +S  +KR+EKPQL F K +DN++S PF PLL EKPNALKPL +SL L       P+HYL
Sbjct: 121 KDSLSTKRLEKPQLKFKKSIDNSESHPFIPLLKEKPNALKPLSESLRLAEAEENNPSHYL 180

Query: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265
            PY YEID+QEY+ +V++I+   P K W+ +  IWIDTK  L  +L DL+  SEIAVDLE
Sbjct: 181 HPYAYEIDHQEYSSDVLQIKKEIPSKSWDDSEPIWIDTKTKLGLMLEDLKNASEIAVDLE 240

Query: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325
           HHD RSYYGI CLMQ+STRE+DY+VDTI LRD L +LNE+FT+P I KVFHGA MDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQVSTRERDYLVDTIELRDALHILNEVFTDPLIVKVFHGAFMDIIWL 300

Query: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385
           QRDLGLY+V LFDT+HASKA+GL RHSLAYLLEN+A+FKTSKKYQLADWR RPL+  M A
Sbjct: 301 QRDLGLYVVGLFDTYHASKAIGLPRHSLAYLLENFANFKTSKKYQLADWRARPLSKPMTA 360

Query: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445
           YAR+DTHFLLNI+DQLRN LI+ NKLAGVL+ESRNVAKRRFEY K RP  P   +Y+ IE
Sbjct: 361 YARADTHFLLNIYDQLRNKLIESNKLAGVLYESRNVAKRRFEYSKHRPRTPSSEVYSPIE 420

Query: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505
           KE PW+ L+ QYNI  EKE LV+ L+ WRD IARRDDESPR++MP Q+L +L++Y P D 
Sbjct: 421 KENPWRVLMYQYNITSEKEELVKDLYLWRDFIARRDDESPRFVMPNQLLAALVAYAPIDV 480

Query: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDTNVASLISI 565
            GV+S++N VTEHVR N+  LANLI+ AL                     D     +I+I
Sbjct: 481 IGVVSLTNGVTEHVRQNAKVLANLIENAL-GNIKDTNKKTTSITSSESKPDGISLEVITI 539

Query: 566 TEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKT-TSFKSED 624
           ++I +I  +F+ LS     +    +G   SS+L    +        Y K  T    K ED
Sbjct: 540 SQIRDIMERFSLLSNSGVINNRTKTGDSTSSILLGKTLPFEECGISYGKKGTPNKVKVED 599

Query: 625 MIARHIRLSEGLKGLSANNSFIYQPP------VEDIKSIEITTENPIPTLEPKSTQKKTT 678
           + AR  + +  L GL  N  F  + P      VE  +++EI +   +P+           
Sbjct: 600 IKARAQKFNSALAGLE-NIMFELEKPVTVPASVEKGEAVEIESAPELPSKA--------- 649

Query: 679 KEINEDNEEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKKIFQKKDETINGNSKKRKS 738
               E  ++IIVLKK     ++  K  D      VDYSK   +   K    N   ++++ 
Sbjct: 650 ----ESFDDIIVLKKKKMHKKQPAKGKDMTVKEAVDYSKMPSVLSSKPGQ-NRKQQRKRR 704

Query: 739 FDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771
           FDP +ND +    PRA KK++   RGKN+S+KR
Sbjct: 705 FDPSSNDSEG---PRAAKKKRPAPRGKNMSFKR 734

>TPHA0J00370 Chr10 complement(81371..83602) [2232 bp, 743 aa] {ON}
           Anc_6.25 YOR001W
          Length = 743

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/754 (47%), Positives = 493/754 (65%), Gaps = 24/754 (3%)

Query: 30  NCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSIDENC 89
           N +ELL  +V  VRA++ALAAQDVDFY+SLDK+++ SL  T+    D+ NS++ S+DEN 
Sbjct: 2   NADELLPLVVSSVRAASALAAQDVDFYRSLDKEIASSLTNTSQKVTDMINSIISSVDENS 61

Query: 90  SPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSRTNSN 149
             L EGK+ + + W    N++D+L E +DH IDALSK +  +    +  +L+++    S+
Sbjct: 62  EGLVEGKENLDESWKDIGNLLDSLFELADHSIDALSKASQKSSNDPKMKYLNDSLNFESD 121

Query: 150 PSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYLQPYE 209
              R+ KPQL FS PVDN+++ PF+PLL +KPNA+ PL + L +V  +   P HY QPYE
Sbjct: 122 NVTRLSKPQLNFSVPVDNSETHPFRPLLTDKPNAVVPLDEVLKIVDGTEDTPQHYPQPYE 181

Query: 210 YEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLEHHDL 269
            EID QEYNE+V++  DP P K WE T AIW+D +ESLA +L +L+  +E+AVDLEHHD 
Sbjct: 182 TEIDKQEYNEQVLQFSDPIPSKVWEETEAIWVDNEESLAAMLNELKTATELAVDLEHHDF 241

Query: 270 RSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWLQRDL 329
           RSYYGITCLMQISTR  DY+VDTI+LRD L VLN +FT+P ITK+ HGA MDIIWLQRDL
Sbjct: 242 RSYYGITCLMQISTRNTDYLVDTIALRDKLQVLNVVFTDPKITKILHGAFMDIIWLQRDL 301

Query: 330 GLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLAYARS 389
           GLYIVSLFDT+HAS+ALG  RHSLAYLLE +A FKTSK+YQLADWR RPL+  M AYAR+
Sbjct: 302 GLYIVSLFDTYHASRALGFPRHSLAYLLERFAHFKTSKQYQLADWRTRPLSKAMNAYARA 361

Query: 390 DTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIEKEAP 449
           DTHFLLNIFDQLRN LI+++KLA +LHESR VAKRRFEY K++PT+P   +++  E + P
Sbjct: 362 DTHFLLNIFDQLRNMLIQEDKLASMLHESRKVAKRRFEYSKYKPTLPSSAVFSPTESDMP 421

Query: 450 WKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDSSGVI 509
           W+S++ QYNI  +K  LV++LWEWRD IARRDDESPRYIMP Q++ SL+ Y PT+ +GVI
Sbjct: 422 WRSMIYQYNIPSQKVELVKRLWEWRDTIARRDDESPRYIMPNQLIASLVEYVPTNPAGVI 481

Query: 510 SVSNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDTNVASLISITEIN 569
           SV+ M+T+ VRSN+  +ANLIK  LE                     +  ++ +S ++I 
Sbjct: 482 SVNRMMTDPVRSNAKAIANLIKSTLEDMKNNNISTTVVSTTAKDKETS--SNDLSTSQIK 539

Query: 570 NICLKFNSLSKHYNTSKF----LTSGIEVSSLLFSNIMTSSPKISDYSKDKTTSFKSEDM 625
            I  +F ++ + Y+++      +TS     SL+FS I  S   I  Y K        + +
Sbjct: 540 FIVSQFENILEKYSSNNSNLNDVTSKEGKDSLVFSKIFNSRDDIITYDKGTKHLITEQQL 599

Query: 626 IARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKK----TTKEI 681
             R   +   +K         +   V+D    + + + P P  E   +Q        KE 
Sbjct: 600 SDRQKEVDAAMKQAE---EIAFSMEVQDTH--KESMKQPFPEPEEVISQSHLPAFEDKEE 654

Query: 682 NEDNEEIIVLK----KVNRKYQKGKKDADKDSTVVVDYSKAKKIFQKKDETINGNSKKRK 737
            ED +EIIVLK    + NR+++   + AD D T V+DYSK  KI  + +     N +K  
Sbjct: 655 QEDLDEIIVLKDTKDRRNRQHRGRGRSADSDHT-VIDYSKGDKILSQDNRRRTPNKRK-- 711

Query: 738 SFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771
            +DP++ D + + +  A K+R+   + +N+S+KR
Sbjct: 712 -YDPFSADNNENALQGA-KRRRPTAKNRNVSFKR 743

>TDEL0G04440 Chr7 (805881..808088) [2208 bp, 735 aa] {ON} Anc_6.25
           YOR001W
          Length = 735

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/742 (49%), Positives = 481/742 (64%), Gaps = 15/742 (2%)

Query: 32  EELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSIDENCSP 91
           ++LL  +V  +RAS+ALAAQDVDF++SL + +  SL++T+   + + NSLL SID+N  P
Sbjct: 7   DQLLRKVVDTIRASSALAAQDVDFHRSLSRPIGKSLDETSTRMVSLINSLLSSIDQNSEP 66

Query: 92  LEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSRTNSNPS 151
           L EGK+ + ++W  FSN+MDNL E SD   D L++         +  FLDN+S  +S PS
Sbjct: 67  LVEGKETLNEYWKDFSNMMDNLFELSDCSADILTRAPGSRKDGEKLKFLDNSSSNDSIPS 126

Query: 152 KRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYLQPYEYE 211
           KRI KPQL F  PV+NT+ +PF PLL EKP AL+PL   +V  P +  VP HY QPYEYE
Sbjct: 127 KRISKPQLNFKNPVNNTEIQPFVPLLKEKPFALRPLISDIV--PGNDAVPEHYAQPYEYE 184

Query: 212 IDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLEHHDLRS 271
           I++QEY E V+   +P P KPWETT A+W+D  E L  ++ DL+  +EIAVDLEHHD RS
Sbjct: 185 IEHQEYGESVIVKSEPIPSKPWETTEALWVDNIEVLKTMISDLKSVTEIAVDLEHHDYRS 244

Query: 272 YYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWLQRDLGL 331
           YYGI CLMQISTRE+DY++DTI+LRDDL +LNE+F NP I KVFHGA MDIIWLQRDLGL
Sbjct: 245 YYGIVCLMQISTRERDYLIDTIALRDDLQILNEVFANPKILKVFHGAFMDIIWLQRDLGL 304

Query: 332 YIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLAYARSDT 391
           Y+VSLFDTFHAS+A+GL RHSLAYLLE +A+FKTSKKYQLADWR RPL+  M AYAR+DT
Sbjct: 305 YVVSLFDTFHASRAIGLPRHSLAYLLEKFANFKTSKKYQLADWRLRPLSKAMNAYARADT 364

Query: 392 HFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIEKEAPWK 451
           HFLLNI+DQLRNTLI+QNKLAGVL ESRNVAKRRFEY KFRP  P P +Y  I+K  PWK
Sbjct: 365 HFLLNIYDQLRNTLIEQNKLAGVLAESRNVAKRRFEYSKFRPIAPSPTVYCPIDKPDPWK 424

Query: 452 SLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDSSGVISV 511
            L+ QY+I   +E LV+KL++WRD IARRDDESPRY+MP Q+L+ L    PT+   VISV
Sbjct: 425 VLMFQYSISPNREELVKKLYDWRDTIARRDDESPRYVMPNQLLVELARQAPTEPINVISV 484

Query: 512 SNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDTNVASLISITEINNI 571
           +++VT+HVRSNS  LA+LIK  L                      T+ ASL+++ +I  +
Sbjct: 485 NSIVTDHVRSNSLVLAHLIKNTL----ASSDKESDKGTFEADNNSTDAASLLTVPQIQKL 540

Query: 572 CLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKTTSFKSEDMIARHIR 631
              F  +S+ +   +        SS +F++I+TS     +Y  +       +++  R  +
Sbjct: 541 AACFAGVSRAFTILQNEYKDGRSSS-IFTDILTSEDDAVNYVGNNMDHITKKELGKRAAK 599

Query: 632 LSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTTKEINEDNEEIIVL 691
             + ++      S+ Y P  E  K      E   P  E     K++     ED +EII L
Sbjct: 600 ALQSMEQFDEATSY-YMPIPEIAKESNTMEEIRPPAPE---EVKESPSPPKEDMDEIITL 655

Query: 692 KKVNRKYQKGKKD--ADKDSTVVVDYSKAKKIFQKKDETINGNSKKRKSFDPYNNDGDTD 749
           KK+ ++  +  K+    +     VDY+K KK+     +      K++    PY     + 
Sbjct: 656 KKIKKQKSQSPKELGISEREIPAVDYTKTKKVLATNQDKNKDKKKRKFD--PYAASNHSS 713

Query: 750 KVPRALKKRQTNTRGKNISYKR 771
             PRA KKR+   R +N+S+KR
Sbjct: 714 DAPRAPKKRKPVNRERNVSFKR 735

>KLLA0D01309g Chr4 (114713..116947) [2235 bp, 744 aa] {ON} similar
           to uniprot|Q12149 Saccharomyces cerevisiae YOR001W RRP6
           Exonuclease component of the nuclear exosome contributes
           to the quality-control system that retains and degrades
           aberrant mRNAs in the nucleus
          Length = 744

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/755 (47%), Positives = 498/755 (65%), Gaps = 20/755 (2%)

Query: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85
           MS ++ + LL ++V  VR+S+ALAAQD+DFYKSLD  ++ SL  T+ + L + N LLLSI
Sbjct: 1   MSSEDKDTLLSSLVQTVRSSSALAAQDIDFYKSLDSNINASLEDTSTNILSLINDLLLSI 60

Query: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145
           D N   +++GKD   D W   SNIMDNL EKSDH +D +   N  N       +L+++ R
Sbjct: 61  DPNNDVIQQGKDSFVDSWKSISNIMDNLFEKSDHALDNIRAGNGGNAGGPSLKYLNDDDR 120

Query: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205
           +N+ PSKRIEKPQL F  PVDNT+  PFKPLL  KP++L+P + SL +VPE   +P+HY 
Sbjct: 121 SNNKPSKRIEKPQLSFKTPVDNTELHPFKPLLEYKPHSLQPFEISLKMVPEEESIPSHYP 180

Query: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265
            PYEYEID+Q+YN+ ++   +P P K W+ T AIW+DT E L  +  +L K +E+A+DLE
Sbjct: 181 HPYEYEIDHQKYNDSILVATEPIPSKDWDETEAIWVDTVEGLNKMKDELSKATELAIDLE 240

Query: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325
           HHD RSYYGI CLMQIS RE D+IVDTI+LR++L +LN+IFT+PN+TKV HGA MDIIWL
Sbjct: 241 HHDYRSYYGIVCLMQISDREHDWIVDTIALREELYILNDIFTDPNVTKVLHGAFMDIIWL 300

Query: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385
           QRDLGLYIV LFDT+HAS+ LG  +HSLAYLLE +A+FKTSKKYQLADWR RPLT  MLA
Sbjct: 301 QRDLGLYIVGLFDTYHASRMLGFPKHSLAYLLERFANFKTSKKYQLADWRIRPLTKPMLA 360

Query: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445
           YAR+DTHFLLNIFD+LRN+L++QNK++ VLHESR VAKRRFEY  FRP VP   +++ IE
Sbjct: 361 YARADTHFLLNIFDKLRNSLLEQNKMSDVLHESRKVAKRRFEYSSFRPKVPSSAVFSPIE 420

Query: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505
           K+ PWK+++ QYNI   KE+L+++L+EWRD IARRDDESPRY+MP Q+L+SL++  PT+ 
Sbjct: 421 KDEPWKNIMFQYNIPASKELLLRRLYEWRDTIARRDDESPRYVMPNQLLVSLVAGAPTEP 480

Query: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDTNVASLISI 565
             V+SVS+ V+EH+R+NS  +ANLIK+ LE                     T++A++I+ 
Sbjct: 481 INVLSVSSYVSEHLRTNSKVIANLIKRTLEDLKGNSNSSAIPLLESAESNGTDLANIITT 540

Query: 566 TEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKIS-DYSKDKTTSFKSED 624
           ++I +I   F+SL+   N+ K         S+LF+ I       +  Y+    T     +
Sbjct: 541 SQIKSIQNIFHSLASEINSQKLNNEQNSEKSVLFNGISNLDVNTAVRYTPKTRTLIPQHE 600

Query: 625 MIARHIRLSEGLKGLSANNSF--IYQPPVEDIKSIEITTE---NPIPTLEPKSTQKKTTK 679
           ++ R   ++  L+    +     I  P  ED    +++ +   N + T +P      + +
Sbjct: 601 LLKRQHEITRTLEQEYTDRQAQSIVLPSNEDEAPTQVSNDENRNEVITSDP------SQE 654

Query: 680 EINEDNEEIIVLKKVNRKYQ---KGKKDADKDSTVVVDYSKAKKIFQKKDETINGNSKKR 736
           EI E+ +E+I L+K  R+ Q   K K  +   S  ++DY+    +        N    K+
Sbjct: 655 EIEENKDEVITLRK--RQSQSNNKRKTISPPASHEIMDYAAGSDLLNSTKNNTNSQKHKK 712

Query: 737 KSFDPYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771
           + FDPY+ +      P+ +KK+    +GKN+S+KR
Sbjct: 713 RRFDPYSVEHVG---PQPIKKKSKPAKGKNVSFKR 744

>NDAI0D00850 Chr4 complement(190801..193173) [2373 bp, 790 aa] {ON}
           Anc_6.25 YOR001W
          Length = 790

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/776 (49%), Positives = 508/776 (65%), Gaps = 47/776 (6%)

Query: 32  EELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSIDENCSP 91
           ++LL  +V  VRAS ALAAQDVDFY+S+DK  + +L +T +   D+ NS+LL++DEN   
Sbjct: 26  DQLLPQVVQTVRASVALAAQDVDFYRSMDKTTAKTLKETTSQLADMINSVLLAVDENSET 85

Query: 92  LEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSRTNSNPS 151
           L+  K+ + D W  FSN+MDNL+EKSD  +D L +  N N   +   +LD  S  +   S
Sbjct: 86  LDGTKENLEDNWKDFSNLMDNLLEKSDRSMDMLLRSKNTNTNNSNMQYLDEYSGRDDTSS 145

Query: 152 KR--IEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYLQPYE 209
           KR  I KPQL F  PVDNT++ PF PLL  KPNALK L +S+ L+P    VP HY QPYE
Sbjct: 146 KRRAIGKPQLEFDVPVDNTETHPFIPLLKSKPNALKSLDESIQLLPVDENVPEHYAQPYE 205

Query: 210 YEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLEHHDL 269
           YEIDNQ YN++++++ DP P +PW  T+AIW+DT ESL  ++ DL   +E AVDLEHHD 
Sbjct: 206 YEIDNQPYNDKILQLSDPIPSQPWMETTAIWVDTPESLQSMIKDLNNCTEFAVDLEHHDY 265

Query: 270 RSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWLQRDL 329
           R+YYGI CLMQISTR QDYIVDT+ LR  L  LNE FTNP ITKV HGA MDIIWLQRDL
Sbjct: 266 RTYYGIVCLMQISTRTQDYIVDTLKLRSHLQPLNEPFTNPQITKVLHGAFMDIIWLQRDL 325

Query: 330 GLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLAYARS 389
           GLYIVSLFDTFHAS+ALG  ++SLAYLLE +++FKTSKKYQ+ADWR RPL+  M +YARS
Sbjct: 326 GLYIVSLFDTFHASRALGFPKNSLAYLLEKFSNFKTSKKYQMADWRIRPLSKAMNSYARS 385

Query: 390 DTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIEKEAP 449
           DTHFLLNIFDQ+RN L++  KLAGVL ESRNVAKRRFEY+K+RP +    +Y+ IEK  P
Sbjct: 386 DTHFLLNIFDQMRNKLVQDGKLAGVLKESRNVAKRRFEYVKYRPLITSSAVYSPIEKIDP 445

Query: 450 WKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDSSGVI 509
           WK+L+ QYNI   KE+L+++L++WRD IARRDDESPRYIMP Q+L+SL++Y P + +GV+
Sbjct: 446 WKTLMYQYNIPLAKELLLKELYQWRDKIARRDDESPRYIMPNQLLVSLVAYAPVEPAGVV 505

Query: 510 SVSNMVTEHVRSNSTTLANLIKKAL-------EXXXXXXXXXXXXXXXXXXXXDTNVASL 562
           SVSNMVT+HVRSNS  LANLIK  L       +                    + +++  
Sbjct: 506 SVSNMVTDHVRSNSKILANLIKNCLTKIKDTTDADSLILQQEQNQPGTSTTTTNVDLSEQ 565

Query: 563 ISITEINNICLKFNSLSKHYNTSKFLTSGI-----EVSSLLFSNIMTSSPKIS------D 611
           +SI ++N +  +F SL    N  + +T+       + S LL ++ M+ + +         
Sbjct: 566 LSIHQLNTLKSQFLSLYSKVNHIEGVTNNARNAEKKNSFLLCTDHMSFNDEDGKNFIKYS 625

Query: 612 YSKDKTTSFKSEDMIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPK 671
            S DK     +E+++ R     + ++ L       Y  P+ + + + + +E   P++ P 
Sbjct: 626 VSPDKKDKITTEELLKREEMFDQAMEQL---QQVEYSIPIPENEIVVVESEQQEPSI-PA 681

Query: 672 STQKKTTKEIN---EDNEEIIVLKKVNRKYQKGKK-------DADKDSTVVVDYSKAKKI 721
           +  + TT   +   ED +EIIVLKK NR   KGKK       D D+    V+DYSK +K+
Sbjct: 682 ANAEITTAVASRKKEDLDEIIVLKKTNR--NKGKKRERKHSDDDDEGEIEVIDYSKMEKV 739

Query: 722 F----QKKDETINGNSKKRKSFDPY--NNDGDTDKVPRALKKRQTNTRGKNISYKR 771
                 K+++  N N  KRK FDPY  NN+G     PRA KKR+  TRGKN+S+KR
Sbjct: 740 LDNSNTKRNQNKNNNGNKRKRFDPYNVNNEG-----PRAPKKRKAMTRGKNVSFKR 790

>ACL001C Chr3 complement(354804..357041) [2238 bp, 745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR001W
           (RRP6)
          Length = 745

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/759 (47%), Positives = 487/759 (64%), Gaps = 28/759 (3%)

Query: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85
           M+  + + L + IV  +RA+ AL+AQD+DFY+SL   V   L+ T+   + + N LLLS+
Sbjct: 1   MASTDEDPLFKRIVSTIRAAAALSAQDIDFYRSLHPSVGQELDDTSATVVSLINELLLSV 60

Query: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSR 145
           DEN + L+ G+D   D W   SN+MDN+ EKSDH  D++   ++   +     +L ++S 
Sbjct: 61  DENNNELKPGRDNFEDSWKELSNVMDNIFEKSDHAFDSIKHGSSSRNEGVNMQYLADSSH 120

Query: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205
            +S PSKRIEKPQLLF  PVDNT+  PFKPLL EKP+ALKPL++SL+L PE   VP HY 
Sbjct: 121 DDSTPSKRIEKPQLLFKTPVDNTELHPFKPLLKEKPHALKPLEESLMLAPEEENVPAHYP 180

Query: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265
            PYEYEID Q YN+ V+E+R+    +PWE T  IW+D  ESL+ +L +L++  E+AVDLE
Sbjct: 181 HPYEYEIDKQPYNDSVLEVRERIDPQPWEATEPIWVDNVESLSQMLDELKEVKELAVDLE 240

Query: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325
           HHD RSYYGI CLMQIS+R +D++VDTI+LRDDL VLN I  +P + KVFHGA MD+IWL
Sbjct: 241 HHDYRSYYGIVCLMQISSRSKDWLVDTIALRDDLHVLNVILPDPTVVKVFHGAFMDMIWL 300

Query: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385
           QRDLGLY+VSLFDT+HAS+ALG  +HSLAYLLE +A FKTSKKYQLADWR RPL   +  
Sbjct: 301 QRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFAKFKTSKKYQLADWRVRPLPKPLRD 360

Query: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445
           YARSDTHFLL+I+D LRN L+K  KLA VL+ SRNVAKRRFEY  FRP +P  N+Y+ IE
Sbjct: 361 YARSDTHFLLSIYDDLRNALVKAGKLAEVLNASRNVAKRRFEYTSFRPRIPDSNVYSPIE 420

Query: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505
              PW+ L+ QYN+   KE L++KL+EWRD +ARRDDES RY+MP Q+L+SL+S +P+++
Sbjct: 421 STEPWRKLMYQYNLPPSKEPLLKKLYEWRDTVARRDDESVRYVMPNQLLVSLVSLSPSET 480

Query: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDTNVASLISI 565
           +GV+SVS  VT++VRSN+ TLANLIK+ LE                     +N A+ +S+
Sbjct: 481 AGVLSVSTYVTDYVRSNARTLANLIKRTLETIKAGTASVAEFSSSERAL--SNPAATLSL 538

Query: 566 TEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKTTSFKSEDM 625
             I N+   F SL                SSLLF++ + + P   +Y+  +        +
Sbjct: 539 HMIQNLDDHFRSLLMEAQKQSGSICSQHSSSLLFNSDLATGPSAVEYTNGQKHVIGDNVL 598

Query: 626 IARHIRLSEGLKGLSANNSFIYQP--PVEDIK--SIEITTENP-----IPTLEPKSTQKK 676
             R   L +          F  QP  PV DI+  S + ++ENP     I   EP+ +Q +
Sbjct: 599 QTRKHALLQ---------KFTSQPVEPVTDIEAPSHQSSSENPQVSEDISPSEPQESQNE 649

Query: 677 TTK-EINEDNEEIIVLKKVNRKYQKGKKDADKDSTVVVDYSKAKKIFQKKDETI----NG 731
             K E + +  EI+VL+K  + + +  K      T  VDYS AK++  K   +     + 
Sbjct: 650 VQKDEPDFEKSEIVVLRKKKKAHAQKPKGTSSSPTETVDYSNAKEVLGKGTSSTAKRGDK 709

Query: 732 NSKKRKSFDPYNNDGDTDKVPRALKKRQTNTRGKNISYK 770
           +  +++ FDPY  D +    P  +KK+   ++GK+IS+K
Sbjct: 710 DRPRKRKFDPYGQDNN---APSGVKKKNKPSKGKSISFK 745

>Kwal_56.22447 s56 (133578..135785) [2208 bp, 735 aa] {ON} YOR001W
           (RRP6) - involved in 5.8S rRNA processing [contig 185]
           FULL
          Length = 735

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/749 (46%), Positives = 474/749 (63%), Gaps = 25/749 (3%)

Query: 28  EDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSIDE 87
           ED    +L  +VG +RAS+A++AQDVDFYKSLD  +S+SL++T+   L + N +++SID+
Sbjct: 6   EDKRSSILTQVVGTIRASSAISAQDVDFYKSLDSTISESLDETSAKLLSLINDVVISIDD 65

Query: 88  NCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETTFLDNNSRTN 147
           N   +E G+  + + WN    +MD L EKS+H + A+ K  + N   N   +LD++    
Sbjct: 66  NNDLIEPGRAGLENSWNNIGEVMDLLFEKSEHALAAMKKKGS-NIIGNNLQYLDDSQPLT 124

Query: 148 SNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYLQP 207
                +I KPQ  FS+PVDNT+S PFKPLLV+KPNAL+PL D L L  E   +P HY  P
Sbjct: 125 DTTLTKITKPQASFSRPVDNTESHPFKPLLVQKPNALRPLDDVLQLTVEEEGIPAHYPHP 184

Query: 208 YEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLEHH 267
           YEYEID+QEY+E V+EIR P P KPWE T A W+D   +L D++ +L K  E+A+DLEHH
Sbjct: 185 YEYEIDHQEYDESVLEIRPPIPSKPWEETDATWVDNLGTLNDMIRELSKAKELAIDLEHH 244

Query: 268 DLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWLQR 327
           D R+YYGITCLMQISTRE D++VDTI+LRD L VLNEIFTNP + KVFHGA MD+IWLQR
Sbjct: 245 DYRTYYGITCLMQISTRENDWLVDTIALRDHLWVLNEIFTNPKVIKVFHGAFMDVIWLQR 304

Query: 328 DLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLAYA 387
           DLGLY+VSLFDTFHAS+ LG  +HSLAYLLE YA FKTSKKYQLADWR RPL+  + AYA
Sbjct: 305 DLGLYLVSLFDTFHASRLLGFPKHSLAYLLERYAHFKTSKKYQLADWRIRPLSKPLKAYA 364

Query: 388 RSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIEKE 447
           R+DTHFLLNI+DQ+RN+LI+Q KLA  LH SR VAKRRFEY KFRPTV    +Y+ +E+E
Sbjct: 365 RADTHFLLNIYDQMRNSLIEQGKLAQSLHNSRGVAKRRFEYTKFRPTVMTSEVYSPVERE 424

Query: 448 APWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDSSG 507
            PW+SL+  YNI   K  L+++L+EWRD IARRDDESPRY+MP Q+L++L+   PTD+ G
Sbjct: 425 DPWRSLIFHYNIPQSKSFLLKRLYEWRDTIARRDDESPRYVMPNQLLVALVMNAPTDTYG 484

Query: 508 VISVSNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDTNVASLISITE 567
           ++SV++ VTEHVRSN+ +L+ LIKK L                     D+N + + S   
Sbjct: 485 LLSVTSFVTEHVRSNAKSLSQLIKKTL-------ASPQDLFTDQINHMDSNKSMVDSKLS 537

Query: 568 INNICLKFNSLSKHYNTSKFLT----SGIEVSSLLFSNIMTSSPKISDYSKDKTTSFKSE 623
             ++     +  ++   S+ L     + +   SL     + +   +S Y   +    +  
Sbjct: 538 PGDVKANHQNFDQYTRKSRELVIHGPTVVRGCSLFPGKPLPNEAYVS-YQGTQVHHIEPT 596

Query: 624 DMIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTTKEINE 683
            +  R   +++ +   +AN +   Q  VE   + E++ E  +   E K     T  ++ E
Sbjct: 597 VLDDRRELVAQNIT-TTANVTEKLQVAVEKTPAPEVSDE--LDEGEAKELSDDTVSQLKE 653

Query: 684 DNEEIIVLKKVNRKYQKGK--KDADKDSTVVVDYSKAKKIFQKKDETINGNSKKRKSFDP 741
           D +EI+VLK+     Q     K+A+ +   ++D+   KKI      T +   K  K FDP
Sbjct: 654 DKDEIVVLKRRKALPQSSSPPKNAEGNPKEILDFKNNKKIMTA---TASVPRKSTKRFDP 710

Query: 742 YNNDGDTDKVPRALKKRQTNTRGKNISYK 770
           Y         P  +K+R+  TRG   S+K
Sbjct: 711 YAIQASG---PDGVKRRK-KTRGIQKSFK 735

>KLTH0C11066g Chr3 complement(910359..912566) [2208 bp, 735 aa] {ON}
           similar to uniprot|Q12149 Saccharomyces cerevisiae
           YOR001W RRP6 Exonuclease component of the nuclear
           exosome contributes to the quality-control system that
           retains and degrades aberrant mRNAs in the nucleus
          Length = 735

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/751 (44%), Positives = 473/751 (62%), Gaps = 30/751 (3%)

Query: 27  SEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSID 86
           SED    +L  ++  +RAS+A+ AQDV FYK+LD  ++ S+N  +   L + N +LLS+D
Sbjct: 7   SEDGS--VLNQVIATIRASSAVTAQDVSFYKNLDPSIATSVNNISARLLGLINDILLSVD 64

Query: 87  ENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETT-FLDNNSR 145
           EN   +E+G + +   W+    +MD L EKS+H + A  K +N  G+ ++T  +LD++  
Sbjct: 65  ENNDIIEQGSEGLESAWSNVGEVMDLLFEKSEHALAAGEKRDN--GELSKTVQYLDDSPS 122

Query: 146 TNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTHYL 205
            +    K+I KPQLLF +P+DN++S PFKPLL +KP+AL+ L +SL L  E   VP HY 
Sbjct: 123 LHDGAPKKILKPQLLFKRPIDNSESHPFKPLLKKKPHALRSLDESLRLTAEQEDVPAHYP 182

Query: 206 QPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVDLE 265
           QPYEYEID+QEYNE V++I +P P  PW+ T A W+D  ++L  +L +L   +EIA+DLE
Sbjct: 183 QPYEYEIDHQEYNESVLQISEPVPSLPWDETEAEWVDNTDALKLMLNELLLANEIAIDLE 242

Query: 266 HHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDIIWL 325
           HHD R+YYGITCLMQISTRE+D+++DTI+LRDDL +LNE+FT+P ITKV HGA MDIIWL
Sbjct: 243 HHDYRTYYGITCLMQISTREKDWLIDTIALRDDLWILNEVFTDPKITKVLHGAFMDIIWL 302

Query: 326 QRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNMLA 385
           QRDLGLYIVSLFDT+HAS+ LG  +HSLAYLLE YA FKTSKKYQL+DWR RPL   + A
Sbjct: 303 QRDLGLYIVSLFDTYHASRLLGSPKHSLAYLLERYAHFKTSKKYQLSDWRVRPLPKALKA 362

Query: 386 YARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTLIE 445
           YAR+DTHFLLNI+D +RN+LI+QNKL+ VLH+SRNVAKRRFE+  FRP +   ++++ IE
Sbjct: 363 YARADTHFLLNIYDNMRNSLIEQNKLSQVLHDSRNVAKRRFEFTTFRPKIVTSHVFSPIE 422

Query: 446 KEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPTDS 505
           +E PW++L+ QYNI   K +LV++L+EWRDM+ARRDDESPRY++P Q+L+SL    PT  
Sbjct: 423 REDPWRTLMFQYNIPQSKSLLVRRLYEWRDMVARRDDESPRYVIPNQLLVSLAVNAPTTP 482

Query: 506 SGVISVSNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDTNVASLISI 565
           + +++ S  VTEH+R N+ +LA LIKK+LE                     T ++S    
Sbjct: 483 ALIMATSTFVTEHIRQNAKSLALLIKKSLESSSNEFGQLLNSANTVQNSSPTKMSS---- 538

Query: 566 TEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKTTSFKSEDM 625
            +I      F    + ++  K    GI + S LF        +   Y + + +      +
Sbjct: 539 EDIEKNSRMFEKFLEDFSYEKAADCGISLGSSLFQKKFVPCEEYVSYQESRASLVDHNSL 598

Query: 626 IARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQKKTTKEIN--- 682
             R  ++S+  +        I +P V     I   + + +   E  +   ++ +E N   
Sbjct: 599 ENRRHQVSKKYEA----ERDIARPQVH----IRAASSHAVCDKEAGAEDNESAEEENKAR 650

Query: 683 -EDNEEIIVLKKVNRKYQKGKKDADKDSTVV--VDYSKAKKIFQKKDETINGNSKKRKSF 739
            E+ +E+IVLK+      K ++  DK +  +  +D   A+KI +      N   + +K F
Sbjct: 651 KEEMDEVIVLKQRKTLADKEQRAVDKATPSIEPLDLQSARKILEAPS---NNVRRPKKRF 707

Query: 740 DPYNNDGDTDKVPRALKKRQTNTRGKNISYK 770
           DPY         P ++KKR+  T+G   S++
Sbjct: 708 DPY---ATLAAGPPSVKKRK-KTKGLQKSFR 734

>Ecym_3030 Chr3 (58929..61172) [2244 bp, 747 aa] {ON} similar to
           Ashbya gossypii ACL001C
          Length = 747

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/751 (44%), Positives = 463/751 (61%), Gaps = 9/751 (1%)

Query: 26  MSEDNCEELLENIVGVVRASTALAAQDVDFYKSLDKKVSDSLNKTANDTLDIANSLLLSI 85
           MS DN + LL  I+G VRA+++LAAQD+DF + LD  V + L++T+   + + N ++LS 
Sbjct: 1   MSSDNKDALLTKILGTVRAASSLAAQDIDFCRHLDASVGELLDETSQYIVSLLNEVILST 60

Query: 86  DENCSPLEEGKDRIPDFWNGFSNIMDNLIEKSDHFIDALSKPNNFNGKYNETT--FLDNN 143
            +  + LE GKD +   W   SNI+DNL EKSDH +D L K  + +    +T   +L+ +
Sbjct: 61  SKANNDLEVGKDNLEAAWKDLSNIIDNLFEKSDHSLDVLQKLLSSSSSQLDTNMQYLNVD 120

Query: 144 SRTNSNPSKRIEKPQLLFSKPVDNTDSRPFKPLLVEKPNALKPLKDSLVLVPESGIVPTH 203
           S+ +   S+RI KPQL F  PVDN++  PFKPLL  KP+ALKPL++   L  E+  VP H
Sbjct: 121 SQRDGKLSQRIVKPQLQFKIPVDNSECHPFKPLLKVKPHALKPLEEVSSLTVETECVPAH 180

Query: 204 YLQPYEYEIDNQEYNEEVVEIRDPTPYKPWETTSAIWIDTKESLADLLMDLRKQSEIAVD 263
           Y  PYEYEIDNQ Y++ V+ I++P     W+    IW+D   +L D+L  L+   EIAVD
Sbjct: 181 YPHPYEYEIDNQPYDDSVLTIKEPIEPSNWDENEPIWVDNITALNDMLNGLKNVKEIAVD 240

Query: 264 LEHHDLRSYYGITCLMQISTREQDYIVDTISLRDDLIVLNEIFTNPNITKVFHGASMDII 323
           LEHHD RSYYG+ CLMQISTRE D++VDTI+LR DL VLNEIFT+P+I KVFHGA MDII
Sbjct: 241 LEHHDYRSYYGLVCLMQISTRESDWLVDTIALRQDLQVLNEIFTDPSILKVFHGAFMDII 300

Query: 324 WLQRDLGLYIVSLFDTFHASKALGLARHSLAYLLENYASFKTSKKYQLADWRRRPLTNNM 383
           WLQRDLGLY+VSLFDT+HAS+ALG  +HSLAYLLE +A+FKTSKKYQLADWR RPL+  M
Sbjct: 301 WLQRDLGLYVVSLFDTYHASRALGFPKHSLAYLLETFANFKTSKKYQLADWRIRPLSKPM 360

Query: 384 LAYARSDTHFLLNIFDQLRNTLIKQNKLAGVLHESRNVAKRRFEYLKFRPTVPLPNLYTL 443
             YAR+DTHFLLNI+D+LRN+LIK++KL+GVLH SRNVAKRRFEY  FRP V  P +++ 
Sbjct: 361 KTYARADTHFLLNIYDKLRNSLIKEDKLSGVLHASRNVAKRRFEYTSFRPKVLSPTVFSP 420

Query: 444 IEKEAPWKSLLIQYNIQDEKEILVQKLWEWRDMIARRDDESPRYIMPTQVLISLISYTPT 503
           IEK+ PW++L+ QYN+ D KE L++KL++WRDM+AR+DDES RY+MP Q+L+SL++  P+
Sbjct: 421 IEKDDPWRTLMSQYNVPDIKEPLMRKLYKWRDMVARKDDESVRYVMPNQLLVSLVTLAPS 480

Query: 504 DSSGVISVSNMVTEHVRSNSTTLANLIKKALEXXXXXXXXXXXXXXXXXXXXDTNVASLI 563
           D SG+++V + + +HVR+N+  L N+I K +E                          + 
Sbjct: 481 DPSGLLTVKSYIPDHVRANARVLCNIINKTMEEIKSGSHEGQSIENVTTTYVSAQDPEM- 539

Query: 564 SITEINNICLKFNSLSKHYNTSKFLTSGIEVSSLLFSNIMTSSPKISDYSKDKTTSFKSE 623
           S++ I  +   F  L     +     S +   SLLF   +   PK   Y+          
Sbjct: 540 SVSLIKTMDRHFKFLLDEVQSHAVEPSSVCEDSLLFKGFLFDKPKAVAYNSVGKRLVNDR 599

Query: 624 DMIARHIRLSEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPTLEPKSTQ--KKTTKEI 681
           +++ R   LS+    +           +E + S      +    +E  S +  K  + ++
Sbjct: 600 ELLDRKSDLSQKFSKVFKAAGIAIGSHIEKLSSNSELPADTTSNVESPSKEESKNNSDDL 659

Query: 682 NEDNEEIIVLKKVNRKYQKGKKDADKD-STVVVDYSKAKKIFQKKDETINGNSKKRKSFD 740
            ED  EIIVLK+  R Y    K   K      VDY+    I     +    NS +     
Sbjct: 660 KEDKHEIIVLKR-KRDYGSNTKSTSKQPKKEHVDYNNVNSILDNTSQQDKPNSGRHVDKR 718

Query: 741 PYNNDGDTDKVPRALKKRQTNTRGKNISYKR 771
            +++D        A+KK +  ++GK +SYK+
Sbjct: 719 KFHSDLQGSIGAAAIKKPR--SKGKTVSYKK 747

>Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) [3870
            nt, 1290 aa]
          Length = 1289

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 40/74 (54%), Gaps = 9/74 (12%)

Query: 60   DKKVSDSLNKTANDTLDIANSLLLSIDENCSPLEEGKDRIPD-FWNGFSNIMDNLIEKSD 118
            D  +  S+N TA +T D +N  L+        L  G D I +   +GF NIMD+ I+ S+
Sbjct: 1171 DFSILQSVNSTAANTNDDSNGELI--------LGGGLDAINNQLSSGFENIMDSNIQISN 1222

Query: 119  HFIDALSKPNNFNG 132
             F D L + +NFNG
Sbjct: 1223 QFEDFLLQNSNFNG 1236

>ZYRO0A04356g Chr1 (350421..357890) [7470 bp, 2489 aa] {ON} similar to
            uniprot|P35194 Saccharomyces cerevisiae YBL004W UTP20
            Possible snoRNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 2489

 Score = 32.3 bits (72), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 20/100 (20%), Positives = 47/100 (47%), Gaps = 11/100 (11%)

Query: 20   NTRPNFMSEDNCEELLENIVGVVRASTALAAQD---VDFYKSLDKKVSDSLNKTANDTLD 76
            N   +FMS+ +C +LL  +V ++  +  +   +   +  +  L++   D LN+   +  +
Sbjct: 2345 NPADSFMSKKSCIQLLALLVQILDENQLVEESEKIIMSLFNYLEQGAGDGLNEEQQELGN 2404

Query: 77   IANSLLLSIDENCSPLEEGKDRIPDFWNGFSNIMDNLIEK 116
            +A        + C  + E K  + DF   ++N+  N++ +
Sbjct: 2405 LA--------QECLQILESKISVSDFTQAYANVKHNVLTR 2436

>ADL067C Chr4 complement(560732..562651) [1920 bp, 639 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER064C and
           YIL056W
          Length = 639

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 42/95 (44%), Gaps = 10/95 (10%)

Query: 575 FNSLSKHYNTSKFLTSGIEVSSLLFSNIM--TSSPKISDYSKDKTTSFKSEDMIARHIRL 632
           FN L+   N S      I + S   S+++  +SSP IS+Y+   T S  + D I   I  
Sbjct: 532 FNGLTILSNVSTTAAPSISMPSSKPSSVIGRSSSPLISNYTHSNTASVAALDSIISRISS 591

Query: 633 SEGLKGLSANNSFIYQPPVEDIKSIEITTENPIPT 667
              +K  SAN   I  P         I T++P P+
Sbjct: 592 PVAVKAQSANGEVIAPP--------TIRTKSPQPS 618

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 87,209,131
Number of extensions: 4249980
Number of successful extensions: 17326
Number of sequences better than 10.0: 236
Number of HSP's gapped: 18194
Number of HSP's successfully gapped: 240
Length of query: 771
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 654
Effective length of database: 40,065,477
Effective search space: 26202821958
Effective search space used: 26202821958
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)