Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A071606.26ON26826814030.0
Kpol_1037.306.26ON3672667062e-91
TPHA0J003806.26ON3562496852e-88
KNAG0I017506.26ON3242496682e-86
KLLA0D01287g6.26ON3452216651e-85
TDEL0G044306.26ON3472336651e-85
ZYRO0C07634g6.26ON3822346681e-85
SAKL0E01408g6.26ON3072346576e-85
CAGL0E02541g6.26ON3422366563e-84
Smik_15.1696.26ON2912606443e-83
Skud_15.1616.26ON2932466419e-83
Suva_15.1746.26ON2952476392e-82
Kwal_56.224436.26ON2802306364e-82
YOL001W (PHO80)6.26ON2932606365e-82
KLTH0C11110g6.26ON2802336347e-82
ACR001C6.26ON3462366363e-81
Ecym_30296.26ON3512236216e-79
NCAS0D021506.26ON3692325072e-61
NDAI0C026406.26ON4272154953e-59
Smik_9.1407.240ON2851962081e-18
Skud_9.1197.240ON2851832072e-18
Suva_9.1497.240ON2861761975e-17
YIL050W (PCL7)7.240ON2851751967e-17
ADL075W7.240ON2071231682e-13
KNAG0D016307.240ON4381441697e-13
Ecym_43367.240ON3851011671e-12
SAKL0F08602g7.240ON4741471618e-12
KAFR0I018407.240ON3251151572e-11
KAFR0L008807.240ON3131091535e-11
KLTH0A04268g7.240ON5801021556e-11
Kwal_23.58077.240ON4651021537e-11
NCAS0E032207.240ON3411801511e-10
TPHA0C010907.240ON3851941511e-10
NCAS0A134807.240ON4481711493e-10
CAGL0M12342g7.240ON4571111483e-10
KLLA0C08305g7.240ON4091741475e-10
NDAI0A025607.240ON5031111476e-10
KNAG0L014707.240ON3541371422e-09
ZYRO0C08118g7.240ON4051541333e-08
TDEL0H020207.240ON3631281324e-08
Kpol_1033.137.240ON250521252e-07
TBLA0D040707.240ON661521263e-07
YER059W (PCL6)7.240ON420591244e-07
Smik_5.1897.240ON415521227e-07
Suva_5.1677.240ON424521227e-07
Kpol_2000.147.289ON3101201201e-06
Skud_5.1737.240ON420561201e-06
TBLA0C048507.289ON3681041147e-06
NDAI0E047707.240ON303501111e-05
Suva_4.687.289ON3051071065e-05
Kpol_1020.87.289ON2961311066e-05
SAKL0F09856g7.289ON335991067e-05
Suva_14.503.70ON279961041e-04
YDL179W (PCL9)7.289ON3041261031e-04
AFR159C7.289ON3081211031e-04
TPHA0P008107.289ON2471201012e-04
NCAS0A137707.289ON3121091022e-04
KNAG0B029307.289ON3121051022e-04
TBLA0J006507.289ON3631131022e-04
KNAG0A014903.70ON2621491012e-04
Smik_4.607.289ON3051031013e-04
Kwal_23.60067.289ON3041201013e-04
Ecym_80387.289ON3141231013e-04
KLLA0E13223g3.70ON2821001003e-04
KLTH0A05346g7.289ON301931003e-04
Skud_4.797.289ON309981004e-04
CAGL0J09328g7.289ON297141994e-04
CAGL0E02233g3.70ON26698994e-04
ZYRO0C09284g7.289ON311106995e-04
Smik_4.1107.289ON308101995e-04
Skud_14.483.70ON27996985e-04
Smik_14.423.70ON27996977e-04
TPHA0A005803.70ON289125978e-04
YDL127W (PCL2)7.289ON308102978e-04
YNL289W (PCL1)3.70ON27996979e-04
NCAS0D040706.236ON473108960.001
ZYRO0C02068g3.70ON330129950.001
Kpol_1020.163.70ON28296940.002
Suva_4.1187.289ON30994940.002
NDAI0A022707.289ON330105930.003
TBLA0A078903.70ON361101930.003
YGL134W (PCL10)6.236ON433115920.004
Skud_4.1287.289ON308102910.004
TDEL0H015507.289ON309102910.005
SAKL0C12100g3.70ON31496900.007
KAFR0C015603.70ON26793880.010
NCAS0A098703.70ON29487880.011
Suva_7.1306.236ON442115860.020
TDEL0E007903.70ON25496840.027
KLLA0F05654g7.289ON311144840.035
Skud_7.1396.236ON434144840.037
Kwal_23.52313.70ON25688830.044
KAFR0A082803.70ON24196820.050
Skud_16.606.236ON500116830.054
KLTH0A01584g3.70ON28188820.061
NDAI0A060503.70ON28696820.062
Suva_16.876.236ON501116810.089
YPL219W (PCL8)6.236ON492116800.12
KNAG0F018706.236ON48394800.13
KAFR0L012007.289ON279107790.14
Smik_6.4246.236ON492116780.22
TPHA0A032507.289ON289103760.33
Skud_16.2808.86ON489137750.55
Ecym_12013.527ON44453740.72
AEL195W3.70ON237108701.5
KAFR0F030204.46ON824105693.0
Smik_16.985.125ON30977683.6
NDAI0H04040singletonON27162674.2
NDAI0C043005.347ON240107665.5
TPHA0C046402.333ON37998665.6
CAGL0H08998g6.236ON547112666.3
YNL139C (THO2)2.125ON159758668.6
TDEL0E028005.347ON19986648.8
TBLA0B084403.70ON268138649.2
CAGL0J06336g7.289ON314103649.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07160
         (268 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   545   0.0  
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   276   2e-91
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   268   2e-88
KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   261   2e-86
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   260   1e-85
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   260   1e-85
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   261   1e-85
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   257   6e-85
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   257   3e-84
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   252   3e-83
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   251   9e-83
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   250   2e-82
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   249   4e-82
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   249   5e-82
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   248   7e-82
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   249   3e-81
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   243   6e-79
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     199   2e-61
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   195   3e-59
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    85   1e-18
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    84   2e-18
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    80   5e-17
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    80   7e-17
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    69   2e-13
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    70   7e-13
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    69   1e-12
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    67   8e-12
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    65   2e-11
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    64   5e-11
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    64   6e-11
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    64   7e-11
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    63   1e-10
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    63   1e-10
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    62   3e-10
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    62   3e-10
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    61   5e-10
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    61   6e-10
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    59   2e-09
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    56   3e-08
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    55   4e-08
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    53   2e-07
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    53   3e-07
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    52   4e-07
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    52   7e-07
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    52   7e-07
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    51   1e-06
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    51   1e-06
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    49   7e-06
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    47   1e-05
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    45   5e-05
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    45   6e-05
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    45   7e-05
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    45   1e-04
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    44   1e-04
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    44   1e-04
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    44   2e-04
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    44   2e-04
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    44   2e-04
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    44   2e-04
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    44   2e-04
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    44   3e-04
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    44   3e-04
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    44   3e-04
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    43   3e-04
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    43   3e-04
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    43   4e-04
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    43   4e-04
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    43   4e-04
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    43   5e-04
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    43   5e-04
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    42   5e-04
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    42   7e-04
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    42   8e-04
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    42   8e-04
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    42   9e-04
NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236     42   0.001
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    41   0.001
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    41   0.002
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    41   0.002
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      40   0.003
TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3...    40   0.003
YGL134W Chr7 (255663..256964) [1302 bp, 433 aa] {ON}  PCL10Pho85...    40   0.004
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    40   0.004
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    40   0.005
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    39   0.007
KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON...    39   0.010
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    39   0.011
Suva_7.130 Chr7 (251870..253198) [1329 bp, 442 aa] {ON} YGL134W ...    38   0.020
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    37   0.027
KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly ...    37   0.035
Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W ...    37   0.037
Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {...    37   0.044
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    36   0.050
Skud_16.60 Chr16 (110205..111707) [1503 bp, 500 aa] {ON} YPL219W...    37   0.054
KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar...    36   0.061
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    36   0.062
Suva_16.87 Chr16 (146154..147659) [1506 bp, 501 aa] {ON} YPL219W...    36   0.089
YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cycli...    35   0.12 
KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.2...    35   0.13 
KAFR0L01200 Chr12 complement(225099..225938) [840 bp, 279 aa] {O...    35   0.14 
Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON...    35   0.22 
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    34   0.33 
Skud_16.280 Chr16 (516846..518315) [1470 bp, 489 aa] {ON} YPL003...    33   0.55 
Ecym_1201 Chr1 (406247..407581) [1335 bp, 444 aa] {ON} similar t...    33   0.72 
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    32   1.5  
KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.4...    31   3.0  
Smik_16.98 Chr16 complement(183740..184669) [930 bp, 309 aa] {ON...    31   3.6  
NDAI0H04040 Chr8 (997352..998167) [816 bp, 271 aa] {ON}                30   4.2  
NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON}                30   5.5  
TPHA0C04640 Chr3 complement(1004694..1005833) [1140 bp, 379 aa] ...    30   5.6  
CAGL0H08998g Chr8 (877952..879595) [1644 bp, 547 aa] {ON} weakly...    30   6.3  
YNL139C Chr14 complement(360924..365717) [4794 bp, 1597 aa] {ON}...    30   8.6  
TDEL0E02800 Chr5 complement(539086..539685) [600 bp, 199 aa] {ON...    29   8.8  
TBLA0B08440 Chr2 complement(2023101..2023907) [807 bp, 268 aa] {...    29   9.2  
CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {...    29   9.2  

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/268 (100%), Positives = 268/268 (100%)

Query: 1   MGPSSGEEAQLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFL 60
           MGPSSGEEAQLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFL
Sbjct: 1   MGPSSGEEAQLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFL 60

Query: 61  TRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLL 120
           TRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLL
Sbjct: 61  TRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLL 120

Query: 121 TATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEY 180
           TATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEY
Sbjct: 121 TATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEY 180

Query: 181 KYSPIEDINNDIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFSINQDE 240
           KYSPIEDINNDIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFSINQDE
Sbjct: 181 KYSPIEDINNDIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFSINQDE 240

Query: 241 IYNSMPELEKPNHIIPTQQANKNLILSH 268
           IYNSMPELEKPNHIIPTQQANKNLILSH
Sbjct: 241 IYNSMPELEKPNHIIPTQQANKNLILSH 268

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  276 bits (706), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 192/266 (72%), Gaps = 12/266 (4%)

Query: 7   EEAQLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTN---NRLSPLFLTRF 63
           E  + + L   F+ CS+ DL+ LI+RMLSF I++ND+   + N  N   N  S + LTRF
Sbjct: 41  ENIETITLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNEEPNNRSVMNLTRF 100

Query: 64  HSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTAT 123
           HS+VPPNIS+++YLIRLTKYSSLE  VL+++VYYIDLLS+VYPEF +NSLTVHR+LLTAT
Sbjct: 101 HSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTVHRFLLTAT 160

Query: 124 TIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYS 183
           TIASKGLCDSFCTNSHY+KVGG+ C+ELN+LETEFL RV YR+IPRD+ IKLCK+E++ +
Sbjct: 161 TIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKLCKIEHQQN 220

Query: 184 PIEDINNDIH-----IPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFSIN- 237
                 +D+      +    QNSG+N+L  YY+K+VQLVG+  +S +  R  NY   ++ 
Sbjct: 221 KFTMDFSDLSMVGMTVQSNHQNSGFNILDIYYHKIVQLVGSFSASSDKSRKANYTLLLSG 280

Query: 238 ---QDEIYNSMPELEKPNHIIPTQQA 260
              + E+ N++ E     +I  ++QA
Sbjct: 281 NNMEKEVSNNIKENSNGQNIGESEQA 306

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  268 bits (685), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 182/249 (73%), Gaps = 19/249 (7%)

Query: 10  QLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSP------------ 57
           + ++L  +F+KCS+ DL+ LISRML+F I IND + I     N+ + P            
Sbjct: 33  ETIMLPTSFLKCSRSDLVVLISRMLTFLIQINDRNEILTE-NNSAMIPTQTDVNNKNNNN 91

Query: 58  -LFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVH 116
            + LTRFHS+VPPNIS+ +YLIRLTKY+SLE SVL++S+YYIDLLS+VYPEF +NSLTVH
Sbjct: 92  MINLTRFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINSLTVH 151

Query: 117 RYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLC 176
           R+LL ATT+ASKGL DSFCTNSHYAKVGG+RC+ELN+LET+FL R+ YR+IPRD+ IKLC
Sbjct: 152 RFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDNIKLC 211

Query: 177 KLEYKYSPIEDINNDI---HIPDELQ--NSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVN 231
           KLE K S       D+   +I  EL   NSGYNVL+ YY KMVQ+VG  K+S +  + VN
Sbjct: 212 KLEKKSSQFTLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKSKKVN 271

Query: 232 YIFSINQDE 240
           YI   N ++
Sbjct: 272 YIIQTNYND 280

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  261 bits (668), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 175/249 (70%), Gaps = 18/249 (7%)

Query: 4   SSGEEAQLVVLDQNFMKCSKIDLITLISRMLSFFIDIND---------SHNIHGNVTN-- 52
           ++G E Q V L  NF  CS+ DLI LISRML F I IND         + +  G  T+  
Sbjct: 16  TTGCEIQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAA 75

Query: 53  --NRLSPLFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSL 110
             +  S   LTRFHS VPP IS+++YLIRLTKYS+LE SVL+TS+YYIDLLS+VYP F++
Sbjct: 76  DTDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTI 135

Query: 111 NSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRD 170
           NSLTVHR+LLTATT+ASKGLCDSFCTN+HYAKVGG++ +ELN+LE+EFL+++ YRV+PRD
Sbjct: 136 NSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRD 195

Query: 171 NTIKLCKLEYKYSPIEDINN----DIHIPDELQ-NSGYNVLSTYYNKMVQLVGNCKSSKN 225
           + I  CK E++       N     ++  P   Q NSGYNVL  YY+K++QLVG   SS +
Sbjct: 196 DNITWCKYEHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSSLD 255

Query: 226 SFRNVNYIF 234
             +  NY+F
Sbjct: 256 KSKKANYVF 264

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  260 bits (665), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 167/221 (75%), Gaps = 15/221 (6%)

Query: 3   PSSGEE-AQLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLT 61
           P  G    Q++ L + +++CS+  L+ +ISRMLSF I IND++N  GN T      + LT
Sbjct: 9   PQKGSNIGQIIPLPEEYLRCSRTHLVVIISRMLSFLIQINDANNA-GNQT------MELT 61

Query: 62  RFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLT 121
           RFHSK  P+I+++ YLIRLTKYSSLE SVL+++VYYIDLLS VYPEF+LNSLTVHR+LLT
Sbjct: 62  RFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVHRFLLT 121

Query: 122 ATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYK 181
           ATTIASKGLCDSFCTN+HY+KVGG++C+ELN+LE EFLERVRYR+IPRD+ I+ CK+E K
Sbjct: 122 ATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENCKIEQK 181

Query: 182 YSP---IEDINNDIHIPDELQNSGYNVLSTYYNKMVQLVGN 219
                 I   N     PD    +G+NVL  YY K+VQLVGN
Sbjct: 182 LGSNMLIPMKNASQRGPD----NGFNVLQNYYRKIVQLVGN 218

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  260 bits (665), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 169/233 (72%), Gaps = 10/233 (4%)

Query: 7   EEAQLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSK 66
           +E   + L + F KCS+ DL  LISRML+F I INDS  +     N R     LTRFHS+
Sbjct: 28  DEISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLAL-SKPENAR----GLTRFHSR 82

Query: 67  VPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIA 126
           VPP IS+++YLIRLTKYSSLE  VL+T+VYYIDLLS+VYP F+L+SLTVHR+LLTATT+A
Sbjct: 83  VPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLTVHRFLLTATTVA 142

Query: 127 SKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSPI- 185
           SKGLCDSFCTN+HYAKVGG+  +ELN+LE EFL+RV YR++PRD+ I  CKLE K     
Sbjct: 143 SKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNIDWCKLETKLQKFT 202

Query: 186 ----EDINNDIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIF 234
                ++  +    + L+NSGYNVL  Y+ K+VQLVG+  SS +  + VNY+ 
Sbjct: 203 LYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKVVNYVL 255

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  261 bits (668), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 133/234 (56%), Positives = 174/234 (74%), Gaps = 17/234 (7%)

Query: 12  VVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHG--NVTNNRLSPLFLTRFHSKVPP 69
           V+L + F +CS+ DL+ LISRML+F I +NDS +     +VTN       LT+FHSKVPP
Sbjct: 45  VILPKRFSECSRTDLVILISRMLTFLIQMNDSSSTSALDSVTN-------LTKFHSKVPP 97

Query: 70  NISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKG 129
            IS+++YL+RLTKYSSL+  VL+ +VYYIDL+S+VYP F+LNSLTVHR+LLTATT+ASKG
Sbjct: 98  GISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLTVHRFLLTATTVASKG 157

Query: 130 LCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLE--YKYSPIED 187
           LCDSFCTN+HYAKVGG+ C+ELNVLE E L R+ YR+IPRD+ I  C LE  +++  ++ 
Sbjct: 158 LCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIAWCNLESQHRHFVLDT 217

Query: 188 INNDIHIP------DELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFS 235
            + D   P          NSGYNVL TYYNK+VQLVG+ KS+++  + VNY F+
Sbjct: 218 QDGDDWTPILSNLSGNRNNSGYNVLDTYYNKIVQLVGSLKSTQDKSKLVNYTFA 271

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  257 bits (657), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 167/234 (71%), Gaps = 20/234 (8%)

Query: 12  VVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNI 71
           ++L   F+KCS+  L+ LISRMLS  I +NDS     N        L LTRFHS+VPP I
Sbjct: 47  IMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCKDKN--------LKLTRFHSRVPPGI 98

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKGLC 131
           S+++YLIRL KYSSLE +VLI +VYYIDLLS+VYP F+LNSLTVHR+LLTATT+ASKGL 
Sbjct: 99  SVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRFLLTATTVASKGLS 158

Query: 132 DSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYS-----PIE 186
           DSFCTN HYAKVGG++C+ELNVLETEFL+RV YR+IPRD+ I  CK EY+       P+ 
Sbjct: 159 DSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKEEYQQGVFITFPLA 218

Query: 187 DINNDIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFSINQDE 240
           D    I  P    N+G+NVL TYY KM+QLVG   SS +    V+Y+   ++ +
Sbjct: 219 D---KIKGP----NNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYVLEPSEQQ 265

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  257 bits (656), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 169/236 (71%), Gaps = 14/236 (5%)

Query: 5   SGEEAQLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFH 64
           + EE   + L ++F+KC K DL+ LI+RML F I INDS     N+  N      LTRFH
Sbjct: 10  TDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDS-----NIKENERK-YGLTRFH 63

Query: 65  SKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATT 124
           SK+ PNIS+F+Y  RLTKYS LE SVL+++VYYIDLLSNVYP F+LNSLT HR+LLTATT
Sbjct: 64  SKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLNSLTAHRFLLTATT 123

Query: 125 IASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSP 184
           IASKGLCDSFCTN+HY+KVGG++CNELNVLE EFL +V YR+IPRDN I  CK+E + + 
Sbjct: 124 IASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDNNITFCKMEVQKNF 183

Query: 185 I---EDINNDIHIP-----DELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNY 232
               E I +D+          + N+GYNVL+ YY K++++VG   SS +  + VNY
Sbjct: 184 FILPESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYSSSPDKTKKVNY 239

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  252 bits (644), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 179/260 (68%), Gaps = 12/260 (4%)

Query: 10  QLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPP 69
           Q V+L  +F KCS+ DL+ LISRML   I IN+  N    +  N+++   LTR+HSK+PP
Sbjct: 19  QKVILPTDFNKCSRTDLVVLISRMLVSLIAINE--NSVSKIPENQIT---LTRYHSKIPP 73

Query: 70  NISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKG 129
           NISIF+Y IRLTK+SSLE  VL+TS+YYIDLL   YP+F+LNSLT HR+LLTATTIA+KG
Sbjct: 74  NISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTIATKG 133

Query: 130 LCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKY------- 182
           LCDSF TN+HYAKVGG+RC+ELN+LE +FL+RV YR+IPRD+ I LC +E K        
Sbjct: 134 LCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNIMLCSIEQKQKKFVIDK 193

Query: 183 SPIEDINNDIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFSINQDEIY 242
           + +   + D +   +   SGYNVL  YY ++VQLVG+  +S +  + ++Y+   N D+  
Sbjct: 194 NALGSFDLDSYSYTDRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKIDYVLPSNIDKDN 253

Query: 243 NSMPELEKPNHIIPTQQANK 262
            S P++ +    +P   + K
Sbjct: 254 ESGPQINEQRGSLPNHYSQK 273

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  251 bits (641), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 130/246 (52%), Positives = 171/246 (69%), Gaps = 12/246 (4%)

Query: 12  VVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNI 71
           V+L   F KCS+ DL+ LISRML   I IN++     + T      + LTR+HSKVPPNI
Sbjct: 21  VILPAEFYKCSRTDLVVLISRMLVSLIAINEN-----STTKKPDDQITLTRYHSKVPPNI 75

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKGLC 131
           SIF+Y IRLTK+SSLE  VL+TS+YYIDLL   YP+F+LNSLT HR+LLTATT+A+KGLC
Sbjct: 76  SIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLC 135

Query: 132 DSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSP-IEDINN 190
           DSF TN+HYAKVGG+RC+ELN+LE +FL+RV YR+IPRD+ I LC +E K    + D N 
Sbjct: 136 DSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVADKNA 195

Query: 191 ------DIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFSINQDEIYNS 244
                 D +       SGYNVL  YY ++VQLVG+  +S +  + V+Y+   N D+   S
Sbjct: 196 PGSFDLDSYSYVSRPKSGYNVLDKYYRRIVQLVGSFNASPDKSKKVDYVLPSNIDKDTES 255

Query: 245 MPELEK 250
            P++++
Sbjct: 256 GPQIQQ 261

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  250 bits (639), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 129/247 (52%), Positives = 166/247 (67%), Gaps = 12/247 (4%)

Query: 12  VVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNI 71
           ++L   F KCS+ DL+ LISRML   I IN++ +     T      + LTR+HSK+PPNI
Sbjct: 21  IILPSEFKKCSRTDLVVLISRMLVSLIAINENSS-----TKRPDDQITLTRYHSKIPPNI 75

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKGLC 131
           SIF+Y IRLTK+SSLE  VLITS+YYIDLL   YP+F+LNSLT HR+LLTATT+A+KGLC
Sbjct: 76  SIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTAHRFLLTATTVAAKGLC 135

Query: 132 DSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSPIEDINND 191
           DSF TN+HY+KVGG+RC+ELN+LE +FL+RV YR++PRD+ I LC +E K        N 
Sbjct: 136 DSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITLCSIEQKQKTFVIDKNA 195

Query: 192 IHIPD-------ELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFSINQDEIYNS 244
           +   D           SGYNVL  YY ++VQLVG+  +S +  R VNY    N DE    
Sbjct: 196 LGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKSRRVNYALPSNFDEDNEG 255

Query: 245 MPELEKP 251
              L++P
Sbjct: 256 SARLQQP 262

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  249 bits (636), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 167/230 (72%), Gaps = 12/230 (5%)

Query: 7   EEAQL--VVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFH 64
           EEA +  V L ++F +CS+ DL+ LISRMLSF   INDS      V  +    L  TRFH
Sbjct: 25  EEAPVPEVALPEDFSQCSRTDLVILISRMLSFLTRINDS------VPKDDAKEL--TRFH 76

Query: 65  SKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATT 124
           S+VPP IS++DY++RLT+YSSLE +VL+ SVYYIDLLS +YP FSLNSLTVHR+LLTATT
Sbjct: 77  SRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYIDLLSAMYPSFSLNSLTVHRFLLTATT 136

Query: 125 IASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSP 184
           +ASKGLCDSFCTNSHYAKVGG++C+EL+VLE+EFL++V YR++PRD+ I  CK E K   
Sbjct: 137 VASKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKKVNYRILPRDDNISNCKAEKKAGL 196

Query: 185 IEDINNDIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIF 234
              +           N+G+NVL TYY K++++VG+  SS +  +  +Y+ 
Sbjct: 197 F--VTPTYSKSCRGPNNGFNVLDTYYRKIIEIVGSFDSSPDKTKRAHYVM 244

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  249 bits (636), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 173/260 (66%), Gaps = 21/260 (8%)

Query: 1   MGPSSGEEAQ---------LVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVT 51
           M  +SGE ++          V+L  +F KCS+ DL+ LISRML   I IN++     + T
Sbjct: 1   MESTSGERSENIHEDQGIPKVILPADFNKCSRTDLVVLISRMLVSLIAINEN-----SAT 55

Query: 52  NNRLSPLFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN 111
                 + LTR+HSK+PPNISIF+Y IRLTK+SSLE  VL+TS+YYIDLL  VYP+F+LN
Sbjct: 56  KKSDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLN 115

Query: 112 SLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDN 171
           SLT HR+LLTATT+A+KGLCDSF TN+HYAKVGG+RC+ELN+LE +FL+RV YR+IPRD+
Sbjct: 116 SLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDH 175

Query: 172 TIKLCKLEYKYSPIEDINNDIHIPD-------ELQNSGYNVLSTYYNKMVQLVGNCKSSK 224
            I LC +E K        N +   D           SGYNVL  YY ++VQLVG+  +S 
Sbjct: 176 NITLCSIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASP 235

Query: 225 NSFRNVNYIFSINQDEIYNS 244
           +  R V+Y+   N D +  S
Sbjct: 236 DKSRKVDYVLPPNIDIVSES 255

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  248 bits (634), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 127/233 (54%), Positives = 168/233 (72%), Gaps = 11/233 (4%)

Query: 3   PSSGEEA-QLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLT 61
           P +GE+    V L  +F +C + DL+ LISRMLSF I INDS  I  + ++       LT
Sbjct: 22  PDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDS--IPKDNSSE------LT 73

Query: 62  RFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLT 121
           RFHS+VPP IS++DYL+RLT+YSSLE +VLI SVYYIDLLS +Y  FSLNSLTVHR+LLT
Sbjct: 74  RFHSRVPPQISVYDYLMRLTRYSSLEPAVLIASVYYIDLLSAMYTAFSLNSLTVHRFLLT 133

Query: 122 ATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYK 181
           ATT+ SKGLCDSFCTNSHYAKVGG++C+EL+VLE+EFL+RV YR++PRD+ I  CK E +
Sbjct: 134 ATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVLESEFLKRVNYRILPRDDNILNCKAERR 193

Query: 182 YSPIEDINNDIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIF 234
                 +       +   N+G+NVL TYY K++++VG+  SS +  +  +Y+ 
Sbjct: 194 EGLF--VTATYAKENRGPNNGFNVLDTYYQKIIEIVGSYDSSPDKTKRAHYVM 244

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  249 bits (636), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 125/236 (52%), Positives = 171/236 (72%), Gaps = 15/236 (6%)

Query: 5   SGEEAQLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFH 64
           + E    + L + F+ CS+  L+ LISRML+  I +ND+         ++  P+ LTRFH
Sbjct: 9   TSESVTEMELPRQFLSCSRTYLVVLISRMLTSLIGMNDAQG-------DKSKPIKLTRFH 61

Query: 65  SKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATT 124
           S+VPP IS+++YLIRLTKYSSLE  VL+ SVYYIDLL+NVYPEF L+SLTVHR+LLTATT
Sbjct: 62  SRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTVHRFLLTATT 121

Query: 125 IASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLE----- 179
           +ASKGLCDSFCTN+HYAKVGG++C+ELNVLE EFLERV YR++PRD+ I+ C LE     
Sbjct: 122 VASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRRCSLERQERI 181

Query: 180 YKYSPIEDINNDIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIFS 235
           + YS I  ++ D  + D  +N+G+ VL  YY++M+ L+G+   S +   N+++  +
Sbjct: 182 FSYSNIP-MDKDCALQD--RNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNLSFTLA 234

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  243 bits (621), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 121/223 (54%), Positives = 160/223 (71%), Gaps = 10/223 (4%)

Query: 14  LDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNISI 73
           L + F+ CS+  L+ LISRMLS  I +ND++             L LTRFHS+VPP+IS+
Sbjct: 25  LPRKFLDCSRTHLVVLISRMLSSLIRLNDAYTESNT--------LQLTRFHSRVPPSISV 76

Query: 74  FDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKGLCDS 133
           +DYLIRLTKYSSLE  VL+ SVYYIDLLS+V+PEF L+SLTVHR+LLTATT+ASKGLCDS
Sbjct: 77  YDYLIRLTKYSSLEHCVLLASVYYIDLLSSVFPEFRLDSLTVHRFLLTATTVASKGLCDS 136

Query: 134 FCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYS--PIEDINND 191
           FCTN+HYAKVGG++CNELNVLE EFL RV YR++PRD  IK C  E++       +I  D
Sbjct: 137 FCTNTHYAKVGGVQCNELNVLENEFLTRVNYRILPRDENIKRCSREHQEGTFSFANIPAD 196

Query: 192 IHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIF 234
                + + + ++VL  YY++M+ L+GN  +S +   ++N+  
Sbjct: 197 AEQDQKSEENRFDVLENYYHRMIHLIGNLDASPDKSYDLNFTL 239

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  199 bits (507), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 108/232 (46%), Positives = 149/232 (64%), Gaps = 11/232 (4%)

Query: 10  QLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPP 69
           Q++ +   ++KCS+ DL+ L+SRML   I  ND  +      ++  S + LTRFHS++PP
Sbjct: 27  QVIEVPYEYIKCSRSDLVVLVSRMLVLLIQSNDMTSNT--SNSSSDSNMHLTRFHSRIPP 84

Query: 70  NISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKG 129
           NISIF+YL RLTKY  +E  VL++ +YYIDL +  YP F+ NSLT HR+LLTA T+A KG
Sbjct: 85  NISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTFTFNSLTAHRFLLTAITVAGKG 144

Query: 130 LCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSPIEDIN 189
           LCDSFCT + YAK+GG++  ELN+LET FL  V YR+IPR + + L KLE         +
Sbjct: 145 LCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIPRSSNVTLIKLERGNQVFTLDH 204

Query: 190 NDIHIP-------DELQNSGYNVLSTYYNKMVQLVGNCKSSKNSFRNVNYIF 234
            D+  P       D L ++GY+VL+ YY  +V++ G   SS   F+ V Y F
Sbjct: 205 LDMKDPKLSFLSYDYLPDNGYSVLNIYYQNIVRITG--ASSDLLFKRVIYTF 254

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  195 bits (495), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 103/215 (47%), Positives = 141/215 (65%), Gaps = 15/215 (6%)

Query: 12  VVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNI 71
           + L   FM+C + DL+ LISRML   I IND+     N+ +N     + TRFHS+V P I
Sbjct: 57  ITLPIKFMECPRRDLVVLISRMLVTLIKINDTKANDNNLPSN-----YATRFHSRVIPGI 111

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKGLC 131
           SI +YL+RLTK+  L+ SVL+T+VYYIDLLS V+P FS NSLT HR++LTA  +ASK LC
Sbjct: 112 SIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRFILTAVIVASKSLC 171

Query: 132 DSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSPIEDINND 191
           DS  + +HYAK GG++ NEL +LE  FL+ ++YRV+PRD    LC +EY +       ND
Sbjct: 172 DSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSMEYHFDTFAL--ND 229

Query: 192 IHIPD--------ELQNSGYNVLSTYYNKMVQLVG 218
             I +        +L +SGYNVL  YY +++ ++G
Sbjct: 230 GQIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIG 264

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 84.7 bits (208), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 62/196 (31%), Positives = 100/196 (51%), Gaps = 22/196 (11%)

Query: 4   SSGEEAQLVVLDQNFMKCSKIDLITLISRMLSFFIDIND-----SHNIHGNVTNNRLSPL 58
           ++GE ++ V+   N +     +LI ++S +L+  I +ND     S  + G+     L+P+
Sbjct: 91  TNGESSENVL---NIVDFPTDELIIMVSALLNKIITVNDATTDISQQVPGDTEEKFLTPI 147

Query: 59  FLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVY---PE-------- 107
               F+ K  P I +  YL R+ KY    + + ++ + Y D +S  Y   PE        
Sbjct: 148 L--AFYGKNVPEIDVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSPEENGHSKQL 205

Query: 108 FSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYR-V 166
           F ++S  +HR L+T  TI +K L D F +NS YAKVGGI   ELN LE +FL    ++ +
Sbjct: 206 FVMDSGNIHRLLITGITICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

Query: 167 IPRDNTIKLCKLEYKY 182
           +  +   K   L YK+
Sbjct: 266 VSVEEMQKYANLLYKF 281

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 84.3 bits (207), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 91/183 (49%), Gaps = 19/183 (10%)

Query: 17  NFMKCSKIDLITLISRMLSFFIDIND-----SHNIHGNVTNNRLSPLFLTRFHSKVPPNI 71
           N    S  +LI +IS +L+  +  ND     S  +  +  +  L+P+    F+ K  P I
Sbjct: 101 NIADFSTDELIQMISALLNRIVTANDEYAEISQQVSKDNQDELLAPIL--AFYGKSVPEI 158

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFS-----------LNSLTVHRYLL 120
           S+  YL R+ KY    + + ++ + Y D +S  Y  FS           ++S  +HR L+
Sbjct: 159 SVVQYLERIQKYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRLLI 218

Query: 121 TATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYR-VIPRDNTIKLCKLE 179
           T  TI +K L D F +NS YAKVGGI   ELN LE +FL    ++ ++  +   K   L 
Sbjct: 219 TGITICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLLVSVEEMQKYANLL 278

Query: 180 YKY 182
           YK+
Sbjct: 279 YKF 281

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 80.5 bits (197), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 91/176 (51%), Gaps = 19/176 (10%)

Query: 25  DLITLISRMLSFFIDIND-----SHNIHGNVTNNRLSPLFLTRFHSKVPPNISIFDYLIR 79
           +LI ++S +L+  +  ND     S  +  +  +  L+P+    F+ K  P I++  YL R
Sbjct: 110 ELILMVSALLNKIVKANDETTDPSQQVVEDGEDELLAPVLA--FYGKNVPEIAVVQYLER 167

Query: 80  LTKYSSLESSVLITSVYYIDLLSNVY---PE--------FSLNSLTVHRYLLTATTIASK 128
           + KY    + + ++ + Y D +S  Y   P+        F ++S  +HR L+T  TI +K
Sbjct: 168 IQKYCPTTNDIFLSLLVYFDRISKNYGSSPDRNGHVRQIFVMDSGNIHRLLITGITICTK 227

Query: 129 GLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYR-VIPRDNTIKLCKLEYKYS 183
            + D F +NS YAKVGGI   ELN LE +FL    ++ ++ R+   K   L YK+ 
Sbjct: 228 FMSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLLVSREEMQKYADLLYKFG 283

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 80.1 bits (196), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 87/175 (49%), Gaps = 19/175 (10%)

Query: 25  DLITLISRMLSFFIDIND-----SHNIHGNVTNNRLSPLFLTRFHSKVPPNISIFDYLIR 79
           +LI +IS +L+  I  ND     S  +     +  L+P+    F+ K  P I++  YL R
Sbjct: 109 ELILMISALLNRIITANDETTDVSQQVSDETEDELLTPIL--AFYGKNVPEIAVVQYLER 166

Query: 80  LTKYSSLESSVLITSVYYIDLLSNVYPE-----------FSLNSLTVHRYLLTATTIASK 128
           + KY    + + ++ + Y D +S  Y             F ++S  +HR L+T  TI +K
Sbjct: 167 IQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLITGVTICTK 226

Query: 129 GLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYR-VIPRDNTIKLCKLEYKY 182
            L D F +NS YAKVGGI   ELN LE +FL    ++ ++  +   K   L YK+
Sbjct: 227 FLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLLVSVEEMQKYANLLYKF 281

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 69.3 bits (168), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 67/123 (54%), Gaps = 11/123 (8%)

Query: 41  NDSHNIHGNVTNNRLSPLFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDL 100
            + H+I+     + LS      F  K  P I++ DY  R+ KY  + + V ++ + Y D 
Sbjct: 49  QEKHDINNKYVAHVLS------FRGKHIPTITLGDYFARIQKYCPITNDVFLSLLVYFDR 102

Query: 101 LSN----VYPE-FSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLE 155
           ++     + P+ F ++S  +HR ++ A T+++K   D F +NS YA+VGGI   ELN LE
Sbjct: 103 IAKRCNALDPQLFVMDSYNIHRLIIAAVTVSTKFFSDFFYSNSRYARVGGISLEELNRLE 162

Query: 156 TEF 158
            +F
Sbjct: 163 LQF 165

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 69.7 bits (169), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 75/144 (52%), Gaps = 21/144 (14%)

Query: 60  LTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLS---NVYPE--------- 107
           +T F+ K  P I+I  YL+R+ KY    + + ++ + + D +S   N++ +         
Sbjct: 283 ITSFYGKHVPQITIEQYLLRIQKYCPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVSDS 342

Query: 108 --------FSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
                   F ++S  +HR L+   T+++K   D F +N+ YA+VGGI   E+N LE +FL
Sbjct: 343 DEQAPHQTFVMDSYNIHRLLIAGVTVSTKFFSDFFYSNARYARVGGISLQEMNHLELQFL 402

Query: 160 ERVRYR-VIPRDNTIKLCKLEYKY 182
               ++ +IP D   +  +L Y++
Sbjct: 403 ILCDFKLLIPIDELQRYAELLYRF 426

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 68.9 bits (167), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 60/101 (59%), Gaps = 5/101 (4%)

Query: 63  FHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSN----VYPE-FSLNSLTVHR 117
           F  K  P I++ DY  R+ KY  + + V ++ + Y D ++     + P+ F ++S  +HR
Sbjct: 234 FRGKHIPAITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNAMDPQLFVMDSYNIHR 293

Query: 118 YLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEF 158
            ++ A T+++K   D F +NS YA+VGGI  +ELN LE +F
Sbjct: 294 LIIAAVTVSTKFFSDFFYSNSRYARVGGISLHELNRLELQF 334

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 66.6 bits (161), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 76/147 (51%), Gaps = 15/147 (10%)

Query: 26  LITLISRMLSFFIDINDS---HNIHGNVTNNRLSPLFLTRFHSKVPPNISIFDYLIRLTK 82
           L+ +++ +L+  +  ND     N+  +  N+  S +    F  K  P IS+  Y  R+ K
Sbjct: 299 LLNMLTSLLNKIVKSNDQLRNTNVQESAFNDYTSQVL--SFRGKHVPAISLDQYFQRIQK 356

Query: 83  YSSLESSVLITSVYYIDLLS---NVYPE-------FSLNSLTVHRYLLTATTIASKGLCD 132
           Y    + V ++ + Y D ++   N+  E       F ++S  +HR ++ A T+++K   D
Sbjct: 357 YCPTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQLFVMDSYNIHRLIIAAVTVSTKFFSD 416

Query: 133 SFCTNSHYAKVGGIRCNELNVLETEFL 159
            F +NS YA+VGGI   ELN LE +FL
Sbjct: 417 FFYSNSRYARVGGISLQELNRLELQFL 443

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 60/115 (52%), Gaps = 10/115 (8%)

Query: 63  FHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSN----------VYPEFSLNS 112
           FH K  P+I+I  Y  R+ KY    + V +  +   D ++               F ++S
Sbjct: 181 FHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQLFVMDS 240

Query: 113 LTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVI 167
             +HR+++   T+ +K L D F +NS YAKVGGI  +E+N LE +FL    +++I
Sbjct: 241 YNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKLI 295

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 63.5 bits (153), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 57/109 (52%), Gaps = 12/109 (11%)

Query: 63  FHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNV-----------YPE-FSL 110
           F  K  P I++  Y  R+ KY    + V ++ + Y D + N             P+ F +
Sbjct: 175 FKGKHIPQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYGHDNPQIFVM 234

Query: 111 NSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
           +S  +HR ++   T+++K L D F +NS YAKVGGI   ELN LE +FL
Sbjct: 235 DSYNIHRLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFL 283

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 64.3 bits (155), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 58/102 (56%), Gaps = 5/102 (4%)

Query: 63  FHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLS---NVYPE--FSLNSLTVHR 117
           F  K  P I++  Y  R+ KY    + V ++ + Y D ++   N   E  F ++S  +HR
Sbjct: 435 FRGKHVPAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFVMDSYNIHR 494

Query: 118 YLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
            +++A T+++K   D F +NS YA+VGGI   ELN LE +FL
Sbjct: 495 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFL 536

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 63.5 bits (153), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (54%), Gaps = 5/102 (4%)

Query: 63  FHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE-----FSLNSLTVHR 117
           F  K  P I++  Y  R+ KY    + V ++ + Y D ++          F ++S  +HR
Sbjct: 324 FRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVMDSYNIHR 383

Query: 118 YLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
            +++A T+++K   D F +NS YA+VGGI   ELN LE +FL
Sbjct: 384 LIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFL 425

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 79/180 (43%), Gaps = 37/180 (20%)

Query: 17  NFMKCSKIDLITLISRMLSFFIDIND--------SHNIHGNVTNNRLSPLF--LTRFHSK 66
           +  K S   LI +IS +L   I  ND        S N   +  N+  S L   +  F  K
Sbjct: 128 DITKLSTKKLIKMISTILEKLIKSNDELRERNETSLNDRTDDDNSDESKLVRSIKSFRGK 187

Query: 67  VPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVY--------------------- 105
             P I +  Y  R+ KY    + VL+  + Y D +S V                      
Sbjct: 188 HIPPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRN 247

Query: 106 ------PEFSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
                  +F L+S  +HR +++A T+++K   D F +NS YAKVGGI  +E+N LE +FL
Sbjct: 248 YDCKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFL 307

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 62.8 bits (151), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/194 (25%), Positives = 82/194 (42%), Gaps = 45/194 (23%)

Query: 9   AQLVVLDQNFMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLF-------LT 61
           A      +N  +     L+ ++S +L   +  ND   +H N  +N +           ++
Sbjct: 149 ADFAATPENIAEFQTDKLLDMLSTLLDKIVLSNDR--LHINTMDNTIDEHIDSTIIKPVS 206

Query: 62  RFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSN------------------ 103
            F  K  P IS+  Y  R+ KY  + + V ++ + Y D +S                   
Sbjct: 207 CFRGKHVPQISLEQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVISNDAD 266

Query: 104 -----------------VYPE-FSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGG 145
                            V P+ F ++S  +HR ++TA T+++K   D F +NS YA+VGG
Sbjct: 267 ESQNNVKQMKDENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGG 326

Query: 146 IRCNELNVLETEFL 159
           I   ELN LE +FL
Sbjct: 327 ISLQELNHLELQFL 340

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 62.0 bits (149), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 77/171 (45%), Gaps = 27/171 (15%)

Query: 63  FHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLS---------------NVYPE 107
           F  K  P IS+  Y  R+ KY    + V ++ + Y D +S               N    
Sbjct: 283 FRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNNSVTSQGDSPTNKSQL 342

Query: 108 FSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYR-V 166
           F ++S  +HR ++   T+ +K   D F +NS YA+VGG+   ELN LE +FL    +  +
Sbjct: 343 FVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGGVSLQELNHLELQFLVLCDFELM 402

Query: 167 IPRDNTIKLCKLEYKYSPIEDINNDIHIPDE-----LQNSGYNVLSTYYNK 212
           IP +   +   L  ++   +       +P+E     LQ+SG N  +   NK
Sbjct: 403 IPTEELQRYADLLSRFWSTQ------PLPEEEDTKVLQDSGSNDTTINNNK 447

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 57/111 (51%), Gaps = 14/111 (12%)

Query: 63  FHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLS-----------NVYPE---F 108
           F  K  P I+++ Y  R+ KY    + V ++ + Y D +S           +  P    F
Sbjct: 305 FKGKHVPQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLF 364

Query: 109 SLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
            ++S  +HR ++   T+ +K   D F +NS YA+VGGI  +ELN LE +FL
Sbjct: 365 VMDSYNIHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFL 415

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 80/174 (45%), Gaps = 32/174 (18%)

Query: 26  LITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTR----FHSKVPPNISIFDYLIRLT 81
           L+ +++ +L+  I  NDS     N   ++   + L R    F  K  P I++  Y  R+ 
Sbjct: 199 LLDMLTGLLTKIIKSNDSLGSTPNFETSQGKNIPLMREILSFRGKQVPGITLKQYFQRIQ 258

Query: 82  KYSSLESSVLITSVYYID---------------------------LLSNVYPE-FSLNSL 113
           KY    + VL++ + + D                           L     P+ F ++S 
Sbjct: 259 KYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQSSPQLFVMDSH 318

Query: 114 TVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVI 167
            +HR ++ A T+++K + D F +NS YA+VGGI   ELN LE +FL    +R+I
Sbjct: 319 NIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILCDFRLI 372

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 61.2 bits (147), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 55/111 (49%), Gaps = 14/111 (12%)

Query: 63  FHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLS---NVYPE-----------F 108
           F  K  P I++  Y  R+ KY    + V ++ + Y D +S   N  P            F
Sbjct: 352 FKGKHVPQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSTPTTNSINDNNSQMF 411

Query: 109 SLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
            ++S  +HR ++   T+ +K   D F +NS YA+VGGI   ELN LE +FL
Sbjct: 412 VMDSYNIHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQELNHLELQFL 462

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 63/137 (45%), Gaps = 22/137 (16%)

Query: 39  DINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYI 98
           D  D+   + +  N  LS      F  K  P I++  Y  R+ KY    + V ++ + Y 
Sbjct: 193 DARDTDGYYESAVNAILS------FKGKHIPQITLEQYFHRIQKYCPTTNDVFLSLLIYF 246

Query: 99  DLLS---NVYPE-------------FSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAK 142
           D +S   N  P              F +NS  +HR ++    +++K   D F +N+ YAK
Sbjct: 247 DRISEKCNSIPRGGDDDKVQDDTLLFVMNSYNIHRLIIAGVAVSTKFSSDFFYSNARYAK 306

Query: 143 VGGIRCNELNVLETEFL 159
           VGGI   E+N LE +FL
Sbjct: 307 VGGISLREMNYLELQFL 323

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 65/154 (42%), Gaps = 42/154 (27%)

Query: 47  HGNVTNNRLSPLFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLS---- 102
           H  +TN+      L+ F  K  P IS+  Y  R+ KY    + V ++ + Y D +S    
Sbjct: 219 HDGITNDSCLRSVLS-FRGKHIPQISLEHYFQRIQKYCPTSNDVFLSLLVYFDRISRKCN 277

Query: 103 -----------------------NVYPE--------------FSLNSLTVHRYLLTATTI 125
                                  NV  +              F ++S  +HR ++  TT+
Sbjct: 278 SSSRLHHENTSANDAGNNNNGHDNVKQQVHNNQQPIPAPQQQFVMDSHNIHRLIIAGTTV 337

Query: 126 ASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
           ++K   D F +NS YA+VGGI   ELN LE +FL
Sbjct: 338 STKFFSDFFYSNSRYARVGGISLQELNYLELQFL 371

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 54/128 (42%), Gaps = 31/128 (24%)

Query: 63  FHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSN------------------- 103
           F  K  P IS+  Y  R+ KY    + V ++ + Y D +S                    
Sbjct: 196 FRGKHIPQISLEHYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDM 255

Query: 104 ------------VYPEFSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNEL 151
                           F ++S  +HR L+   T+++K   D F +NS YA+VGGI   EL
Sbjct: 256 PAKQQQQTQQTQQQQAFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQEL 315

Query: 152 NVLETEFL 159
           N LE +FL
Sbjct: 316 NHLELQFL 323

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 34/52 (65%)

Query: 108 FSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
           F ++S  +HR ++   T+++K   D F +NS YA+VGGI   ELN LE +FL
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFL 214

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 34/52 (65%)

Query: 108 FSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
           F ++S  +HR ++   T+A+K   D F +N+ YAKVGGI   ELN LE +FL
Sbjct: 578 FVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFL 629

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 50  VTNNRLSPLFLTR---FHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLS 102
            TNN   P +L+    F  K  P I++F Y  R+ KY  + + V ++ + Y D +S
Sbjct: 428 TTNNGEVPNYLSSILSFRGKHIPQITLFQYFQRIQKYCPISNDVFLSLLVYFDRIS 483

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 1/59 (1%)

Query: 102 SNVYPE-FSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
           S  +P+ F ++S  +HR ++   T+++K L D F +NS Y++VGGI   ELN LE +FL
Sbjct: 323 SRAHPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFL 381

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 35/52 (67%)

Query: 108 FSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
           F ++S  +HR ++   T+++K L D F +NS Y++VGGI   ELN LE +FL
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFL 376

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 35/52 (67%)

Query: 108 FSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
           F ++S  +HR ++   T+++K L D F +NS Y++VGGI   ELN LE +FL
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFL 385

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 62/120 (51%), Gaps = 6/120 (5%)

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE--FSLNSLTVHRYLLTATTIASKG 129
           SIF+++  L K+S++++S L+ S  Y+  L ++ P   + + S T HR  L    +A+K 
Sbjct: 44  SIFEFIKGLIKHSNVQTSTLMASTVYLTKLRSILPANVYGIES-TKHRIFLGCLILAAKS 102

Query: 130 LCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSPIED 187
           L DS   N H+ K   G +   ++N +E E L  + +  I +   +  C L     PI+D
Sbjct: 103 LNDSSPLNKHWTKYTNGLLNLADVNTIERELLAYLNWDTIIKQEDLIGC-LSSFLKPIQD 161

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 38/56 (67%), Gaps = 1/56 (1%)

Query: 105 YPE-FSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
           +P+ F ++S  +HR ++   T+++K L D F +NS Y++VGGI   ELN LE +FL
Sbjct: 326 HPQMFVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFL 381

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 56/104 (53%), Gaps = 8/104 (7%)

Query: 65  SKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE--FSLNSLTVHRYLLTA 122
           S +PP   ++ ++  L  +S++++  L+T+V Y+  L  + P   + + + T HR  L  
Sbjct: 48  SNIPP---LYTFIKNLVAHSNVQTPTLMTTVVYLKKLKAIIPSNVYGIET-TRHRMFLGC 103

Query: 123 TTIASKGLCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRY 164
             IA+K L DS   N H+AK   G ++  E+N +E E L   ++
Sbjct: 104 LIIAAKTLNDSSPLNKHWAKYTNGLLQLREVNTIEREILTYFKW 147

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 31/50 (62%)

Query: 110 LNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
           +NS TVHR +L   T++SK L D   +N  YA+  G+   ELN LE +FL
Sbjct: 227 VNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFL 276

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 56/107 (52%), Gaps = 7/107 (6%)

Query: 64  HSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE--FSLNSLTVHRYLLT 121
           H   PP +SIF  + ++   S++++  L+ +  Y++ L ++ P+  + + + T HR  L 
Sbjct: 41  HGCPPPELSIF--IKKVVVQSNVQTPTLMATTVYLNKLKSIIPKNVYGIET-TRHRIFLG 97

Query: 122 ATTIASKGLCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRV 166
              +A+K L DS   N H+     G ++  E+N +E E LE   + V
Sbjct: 98  CLILAAKTLNDSSPWNKHWTTYTEGLLKVREVNTIERELLEYFNWDV 144

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 64/131 (48%), Gaps = 9/131 (6%)

Query: 69  PNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE--FSLNSLTVHRYLLTATTIA 126
           P   +  ++  L   S++++  L+ +  Y+  L N+ P   + + S T HR  L    +A
Sbjct: 45  PPPPLVKFITNLCLKSNVQTPTLMATTVYLKKLKNIIPPNVYGIES-TRHRIFLGCLILA 103

Query: 127 SKGLCDSFCTNSHYAK--VGGIRCNELNVLETEFLERVRYRV-IPRDNTIKLCKLEYKYS 183
           SK L DS   N H+A+   G ++  E+N +E E LE   + + I  D+ +    LE+   
Sbjct: 104 SKTLNDSSPLNKHWARYTSGILQLREVNTIERELLEYFDWNIQITTDDLV--SSLEHFIQ 161

Query: 184 PI-EDINNDIH 193
           PI E I  D H
Sbjct: 162 PIKEKILKDRH 172

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 53/99 (53%), Gaps = 3/99 (3%)

Query: 71  ISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTATTIASKG 129
           +S+ D++  L  +S++++  L+++V Y+  L ++ P        T HR  L    +A+K 
Sbjct: 42  VSLVDFIKGLITHSNVQTPTLMSTVVYLTRLRSIIPATVYGIETTRHRIFLGCLILAAKN 101

Query: 130 LCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRV 166
           L DS   N H+++   G +   E+N +E E LE   +++
Sbjct: 102 LNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKL 140

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 53/96 (55%), Gaps = 3/96 (3%)

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTATTIASKGL 130
           S+  ++ RL +Y+++ +  L+T+V Y++ L  + P+ +     T+HR  L    +++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 131 CDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRY 164
            DS   N H+AK   G     ++N++E + L+ + +
Sbjct: 114 NDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNW 149

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 68/126 (53%), Gaps = 12/126 (9%)

Query: 68  PPNISIFDYLIRLTKYSSLESSVLI-TSVYYIDLLSNVYPE--FSLNSLTVHRYLLTATT 124
           PP++SIF  +  +   S++++  L+ TSV Y++ L +V P+  + +N+ T HR  L    
Sbjct: 46  PPDLSIF--IKNVVIQSNVQTPTLMATSV-YLNKLKSVIPKNVYGINT-TRHRIFLGCLI 101

Query: 125 IASKGLCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRVIPRDNTIKLC-KLEYK 181
           +A+K L DS   N H+     G +R  E+N +E E LE + + V  R  T  L   L Y 
Sbjct: 102 LAAKTLNDSSPWNKHWTTYTEGLLRIREVNTIERELLEYLNWDV--RITTPDLIDSLSYF 159

Query: 182 YSPIED 187
             PI++
Sbjct: 160 LGPIKE 165

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 63/121 (52%), Gaps = 6/121 (4%)

Query: 71  ISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE--FSLNSLTVHRYLLTATTIASK 128
           +S+ D++  L K S++++  L+++V Y+  L ++ P   + + + + HR  L    +A+K
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIET-SRHRMFLGCLILAAK 101

Query: 129 GLCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSPIE 186
            L DS   N H+ +   G +   E+N +E E LE   + +   +  +  C L +  +PI 
Sbjct: 102 NLNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISC-LSHFLNPIR 160

Query: 187 D 187
           D
Sbjct: 161 D 161

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 55/120 (45%), Gaps = 12/120 (10%)

Query: 59  FLTRFHSKVPPNI---------SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFS 109
           FL      + PNI         S+  ++  + KYS +++  L+ S  +++ L  + P + 
Sbjct: 22  FLVSSTEAIIPNIQQSGSLAIPSLTSFICDVVKYSKVKTPTLMASTVFLNRLRCIIPGYV 81

Query: 110 LNSLTV-HRYLLTATTIASKGLCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRV 166
               T  HR  L    +ASK L DS   N H+ K   G +   E+N +E E LE + + V
Sbjct: 82  EGIATATHRLFLGCLILASKTLNDSSPFNKHWEKYCRGLLSLMEINTIERELLEYMSWNV 141

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 58/109 (53%), Gaps = 5/109 (4%)

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYP--EFSLNSLTVHRYLLTATTIASKG 129
           ++ +++  L K+S++++  L+ +  Y+  L ++ P   + + + T HR  L    +A+K 
Sbjct: 49  TLSNFIKALIKHSNVQTPTLMATTVYLSKLKSIIPCNVYGIET-TRHRIFLGCLILAAKT 107

Query: 130 LCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRVIPRDNTIKLC 176
           L DS   N H+A+   G ++  E+N +E E LE   + V  +   + +C
Sbjct: 108 LNDSSPMNKHWAQYTDGLLQIREVNTIERELLEYFDWDVTIKTKDLIIC 156

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 52/105 (49%), Gaps = 3/105 (2%)

Query: 65  SKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTAT 123
           S  PP  ++ +++  L   S + +  L+ S  Y+  L ++ P   +    T HR  L   
Sbjct: 41  SDKPPIPTLVEFIAGLVTNSKVGTPTLMASTVYLVRLKDILPPNIIGIETTRHRLFLGCL 100

Query: 124 TIASKGLCDSFCTNSHYAKVGG--IRCNELNVLETEFLERVRYRV 166
            IA+K L D+   N H++K     +   E+N++E E L  +R+RV
Sbjct: 101 IIAAKTLNDNSPLNKHWSKHTNNLLPNREINIIERELLSYLRWRV 145

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 58/113 (51%), Gaps = 10/113 (8%)

Query: 69  PNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTATTIAS 127
           P++++F  + RL  +S++++  L++++ Y+  L  + P   +    T HR  +    +A+
Sbjct: 45  PSLALF--IKRLIVHSNVQTPTLMSTLVYLTKLREIIPSDVVGIETTRHRIFIGCLILAA 102

Query: 128 KGLCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKL 178
           K L DS   N H+ +   G  +  E+N +E E LE   +     D TIKL  L
Sbjct: 103 KSLNDSSPLNRHWTQYTNGLFKIQEINTIERELLEYFNW-----DVTIKLPDL 150

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 69/149 (46%), Gaps = 10/149 (6%)

Query: 61  TRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYL 119
           T    K P   S+  ++ +L +Y+++ +  L+T+V Y++ L  + P+ +     T+HR  
Sbjct: 48  TELSGKEPRLPSLRTFITKLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPSTIHRLF 107

Query: 120 LTATTIASKGLCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRY--RVIPRDNTIKL 175
           L    +++K   DS   N H+AK   G     ++N++E + L  + +  RV   D  + L
Sbjct: 108 LACLILSAKYHNDSSPLNKHWAKYTDGLFSLEDINLMERQLLNLLNWDLRVEQEDLILDL 167

Query: 176 CKLEYKYSPIED--INNDIHIPDELQNSG 202
             L     PI D  +   I I    Q S 
Sbjct: 168 QTL---LEPIRDHVVATQIQIKKRQQRSS 193

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 53/103 (51%), Gaps = 7/103 (6%)

Query: 68  PPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE--FSLNSLTVHRYLLTATTI 125
           PP++S F  +  +   S++++  L+ +  Y++ L N+ P   + + + T HR  L    +
Sbjct: 47  PPDLSTF--IKNVVIQSNVQTPTLMATSVYLNKLRNIIPRNVYGIET-TRHRIFLGCLIL 103

Query: 126 ASKGLCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRV 166
           A+K L DS   N H+     G +R  E+N +E E LE   + V
Sbjct: 104 AAKTLNDSSPWNKHWTTYTEGLLRVREVNTIERELLEYFNWDV 146

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 59/120 (49%), Gaps = 4/120 (3%)

Query: 71  ISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTATTIASKG 129
           +S+ +++  L   S++++  L+++  Y+  L ++ P   L    T HR  L    IA+K 
Sbjct: 45  VSLENFIKGLVVQSNVQTPTLMSTAVYLAKLRSIIPANVLGIETTRHRMFLGCLIIAAKN 104

Query: 130 LCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSPIED 187
           L DS   N H+A    G +   E+N +E E LE   + +      + +C   +  +PI+D
Sbjct: 105 LNDSSPMNKHWASYTNGLLDTREVNTIERELLEYFDWNLQFSTQELAICLAPF-LAPIKD 163

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 69  PNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTATTIAS 127
           P +S+ D++  L   S++++  L+++V Y+  L ++ P        T HR  L    +AS
Sbjct: 41  PILSLVDFIKGLINKSNVQTPTLMSTVVYLTRLRSIIPPNVHGIETTRHRIFLGCLILAS 100

Query: 128 KGLCDSFCTNSHYAKVGG--IRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSPI 185
           K L DS   N H+ +     +   E+N +E E LE   + ++  +  +  C L Y   PI
Sbjct: 101 KNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNKDLITC-LSYFLKPI 159

Query: 186 EDI 188
           +++
Sbjct: 160 KEL 162

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 53/100 (53%), Gaps = 6/100 (6%)

Query: 64  HSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTA 122
           H+ VP   S+  ++ RL +Y+++ +S L+T+V Y++ L  + P  +     T HR  L  
Sbjct: 53  HNGVP---SLMTFISRLVRYTNVYTSTLLTTVVYLNRLRELLPSDAAGLPTTCHRIFLAC 109

Query: 123 TTIASKGLCDSFCTNSHYAKV--GGIRCNELNVLETEFLE 160
             +++K   DS   N H+ K   G     ++N++E + L+
Sbjct: 110 LILSAKYHNDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQ 149

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 47/93 (50%), Gaps = 3/93 (3%)

Query: 71  ISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE-FSLNSLTVHRYLLTATTIASKG 129
           +S+ D++  L   S++++  L+++  Y+  L ++ P        T HR  L    IA+K 
Sbjct: 43  VSLVDFIKGLVVQSNVQTPTLMSTAVYLSKLRSIIPANVHGMETTRHRVFLGCLIIAAKN 102

Query: 130 LCDSFCTNSHYAKV--GGIRCNELNVLETEFLE 160
           L DS   N H+A    G +   E+N +E E LE
Sbjct: 103 LNDSSPMNKHWASYTNGLLNTREVNTIERELLE 135

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 52/98 (53%), Gaps = 5/98 (5%)

Query: 73  IFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE--FSLNSLTVHRYLLTATTIASKGL 130
           +F ++ ++   S++++  L+ +  Y++ L N+ P   + + + T HR  L    +A+K L
Sbjct: 48  LFTFIKKVVIQSNVQTPTLMATTVYLNKLKNIIPTNVYGIET-TRHRIFLGCLILAAKTL 106

Query: 131 CDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRV 166
            DS   N H++    G ++  E+N +E E LE   + V
Sbjct: 107 NDSSPWNKHWSTYTEGLLKVREVNTIERELLEYFNWDV 144

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 68/141 (48%), Gaps = 24/141 (17%)

Query: 25  DLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVP-PNISIFDYLIRLTKY 83
           ++IT ++R     I + ++H++                    +P P + +F  + +L KY
Sbjct: 18  EMITYLARSTESIIQVRETHSM----------------IDVAIPAPKLELF--IKKLVKY 59

Query: 84  SSLESSVLITSVYYIDLLSNVYPE--FSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYA 141
           S++++  L+ +  ++  L ++ P   + + + T HR  L    +++K L DS   N H+A
Sbjct: 60  SNVQTPTLMATTVFLTKLRSIIPANVYGIET-TRHRIFLGCLILSAKTLNDSSPLNKHWA 118

Query: 142 KV--GGIRCNELNVLETEFLE 160
           +   G +   E+N +E E LE
Sbjct: 119 QYTDGLLHLKEVNTIERELLE 139

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 53/98 (54%), Gaps = 3/98 (3%)

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTATTIASKGL 130
           S+  ++ RL +Y+++ +  L+ +V Y++ L  + P+ +     T+HR  L    ++SK  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPSTIHRLFLACLILSSKCH 113

Query: 131 CDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRV 166
            DS   N H+A+   G     ++N++E + L+ + + +
Sbjct: 114 NDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDI 151

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 8/106 (7%)

Query: 65  SKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE--FSLNSLTVHRYLLTA 122
           S  PP   +  ++  L  YS++++  L+ +  Y+  L ++ P   F + + T HR  L  
Sbjct: 42  SPAPP---LMRFIKTLISYSNVQTPTLMATTVYLTKLRSIIPANVFGIET-TRHRIFLGC 97

Query: 123 TTIASKGLCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRV 166
             +A+K L DS   N H+A    G +   E+N +E E LE   + V
Sbjct: 98  LILAAKTLNDSSPLNKHWASYTDGLLHIREVNTIERELLEYFDWNV 143

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 52/101 (51%), Gaps = 3/101 (2%)

Query: 69  PNISIFDYLIRLTKYSSLESSVLI-TSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIAS 127
           P   + +++ RL K+S++++  L+ TSVY   L S +  +      T HR  L    +A+
Sbjct: 45  PAPPLTEFINRLIKHSNVQTPTLMATSVYLAKLRSLIPSKVYGIETTRHRIFLGCLILAA 104

Query: 128 KGLCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRV 166
           K L DS   N H+A+   G +   E+N +E E LE   + V
Sbjct: 105 KTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFDWDV 145

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 52/96 (54%), Gaps = 3/96 (3%)

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTATTIASKGL 130
           S+  ++ RL +Y+++ +  L+T+  Y++ L  + P+ +     T+HR  L    +++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 131 CDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRY 164
            DS   N H+A+   G     ++N++E + L+ + +
Sbjct: 114 NDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 52/96 (54%), Gaps = 3/96 (3%)

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTATTIASKGL 130
           S+  ++ RL +Y+++ +  L+T+  Y++ L  + P+ +     T+HR  L    +++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 131 CDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRY 164
            DS   N H+A+   G     ++N++E + L+ + +
Sbjct: 114 NDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 65/125 (52%), Gaps = 9/125 (7%)

Query: 65  SKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSL--TVHRYLLTA 122
           SK+P   S+  ++ +L +Y+++ +S L+T+  Y+  L  + P+ + N L  T+HR  L  
Sbjct: 53  SKLP---SLKTFITKLVRYTNVYTSTLLTTACYLKKLQRILPKDA-NGLPSTIHRIFLAC 108

Query: 123 TTIASKGLCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEY 180
             +++K   DS   N H+A+   G     ++N++E + L  + + +  ++  +    L Y
Sbjct: 109 LILSAKFHNDSSPLNKHWAEYTDGLFSLEDVNLMEVQLLALLNWDIRIKEEDL-FIDLRY 167

Query: 181 KYSPI 185
              PI
Sbjct: 168 LLEPI 172

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 53/102 (51%), Gaps = 5/102 (4%)

Query: 69  PNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE--FSLNSLTVHRYLLTATTIA 126
           P   +  ++ RL K+S++++  L+ +  Y+  L ++ P   + + + T HR  L    +A
Sbjct: 45  PAPPLTKFINRLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIET-TRHRIFLGCLILA 103

Query: 127 SKGLCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRV 166
           +K L DS   N H+A+   G +   E+N +E E LE   + V
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDV 145

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 51/96 (53%), Gaps = 3/96 (3%)

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTATTIASKGL 130
           S+  ++ RL +Y+++ +  L+T+  Y++ L  + P  +     T+HR  L    +++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPSTIHRIFLACLILSAKFH 113

Query: 131 CDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRY 164
            DS   N H+A+   G     ++N++E + L+ + +
Sbjct: 114 NDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>NCAS0D04070 Chr4 (764711..766132) [1422 bp, 473 aa] {ON} Anc_6.236
          Length = 473

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 47/108 (43%), Gaps = 8/108 (7%)

Query: 60  LTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE--------FSLN 111
            + F  K PP++S  D++ R+      +  V + + Y +  L  +  E        F   
Sbjct: 337 FSNFKMKSPPSLSYADFIQRIQNKCEYDPHVYLIATYLLQTLLLIREEHSRKLKLRFKFE 396

Query: 112 SLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
              VHR ++    IA+K L D   ++ ++ KV GI    L+ LE   L
Sbjct: 397 KSDVHRLIIATVRIATKLLEDHVHSHEYFCKVSGISKKLLSKLEVSLL 444

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 68/129 (52%), Gaps = 10/129 (7%)

Query: 65  SKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYP-EFSLNSLTVHRYLLTAT 123
           SK+P   S+  ++ RL +++++ +S L+ +  Y++ L  + P + S    T+HR  L   
Sbjct: 83  SKLP---SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPKDASGLPSTIHRMFLACL 139

Query: 124 TIASKGLCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRV-IPRDNTIKLCKLEY 180
            +++K   DS   N H+AK   G     ++N++E + ++ + + + +  D+ I    L Y
Sbjct: 140 ILSAKFHNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNWDLRVTNDDLI--LDLRY 197

Query: 181 KYSPI-EDI 188
              PI EDI
Sbjct: 198 LLEPIVEDI 206

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 51/96 (53%), Gaps = 3/96 (3%)

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTATTIASKGL 130
           S+  ++ +L +Y+++ +S L+T+  Y+  L  + P+ +     T+HR  L    I++K  
Sbjct: 54  SLMTFITKLVRYTNVYTSTLLTTTCYLKKLQRILPKDATGLPSTIHRMFLACLIISAKYH 113

Query: 131 CDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRY 164
            DS   N H+A+   G     ++N++E + L  + +
Sbjct: 114 NDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNW 149

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 69  PNISIFDYLIRLTKYSSLESSVLI-TSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIAS 127
           P   +  ++ RL K+S++++  L+ TSVY + L S +         T HR  L    +A+
Sbjct: 45  PAPPLVKFINRLIKHSNVQTPTLMATSVYLVKLRSIIPSNVYGIETTRHRIFLGCLILAA 104

Query: 128 KGLCDSFCTNSHYAKV--GGIRCNELNVLETEFL 159
           K L DS   N H+A+   G +   E+N +E E L
Sbjct: 105 KTLNDSSPLNKHWAEYTDGLLLLREVNTIERELL 138

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 54/105 (51%), Gaps = 8/105 (7%)

Query: 66  KVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE--FSLNSLTVHRYLLTAT 123
           ++PP   + +++  L  +S++++  L+ +  Y+  L  + P+  + + + T HR  L   
Sbjct: 49  EIPP---LSNFIKNLVMHSNVQTPTLMATSVYLSKLRLIIPKNVYGMET-TRHRIFLGCL 104

Query: 124 TIASKGLCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRV 166
            +A+K L DS   N H+ K   G +   E+N +E E LE   + V
Sbjct: 105 ILAAKTLNDSSPLNKHWTKYTDGLLHIREVNTIERELLEYFEWNV 149

>TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3.70
           YNL289W
          Length = 361

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 53/101 (52%), Gaps = 3/101 (2%)

Query: 67  VPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTATTI 125
           +P   S+  ++ R+ +Y++++ S L+ +V Y++ L  + P  ++    T+HR  L    +
Sbjct: 55  IPKLPSLMTFITRIVRYTNVQVSTLLMTVCYLNKLKKLLPADAVGIPSTIHRLFLACLIL 114

Query: 126 ASKGLCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRY 164
           ++K   DS   N H+A    G     ++N++E + L  + +
Sbjct: 115 SAKFHNDSSPLNVHWANYTNGLFSVKDVNLMERQLLSLLDW 155

>YGL134W Chr7 (255663..256964) [1302 bp, 433 aa] {ON}  PCL10Pho85p
           cyclin; recruits, activates, and targets Pho85p
           cyclin-dependent protein kinase to its substrate
          Length = 433

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 55/115 (47%), Gaps = 7/115 (6%)

Query: 52  NNRLSPLFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLL------SNVY 105
           N R+     + F+ K  P +S  D+L R+      + +V + + + ID L      +N+ 
Sbjct: 289 NTRVEKKEYSNFYMKSKPTLSSADFLKRIQDKCEYQPTVYLVATFLIDTLFLTRDGNNIL 348

Query: 106 P-EFSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
             + +L    VHR ++ A  +++K L D   ++ +++KV GI    L  LE   L
Sbjct: 349 QLKLNLQEKEVHRMIIAAVRLSTKLLEDFVHSHEYFSKVCGISKRLLTKLEVSLL 403

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 52/102 (50%), Gaps = 5/102 (4%)

Query: 69  PNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE--FSLNSLTVHRYLLTATTIA 126
           P   +  ++  L K+S++++  L+ +  Y+  L ++ P   + + + T HR  L    +A
Sbjct: 45  PAPPLTKFINGLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIET-TRHRIFLGCLILA 103

Query: 127 SKGLCDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRYRV 166
           +K L DS   N H+A+   G +   E+N +E E LE   + V
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFDWDV 145

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 53/102 (51%), Gaps = 5/102 (4%)

Query: 69  PNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE--FSLNSLTVHRYLLTATTIA 126
           P  S+ +++  L  +S++++  L+ +  Y+  L ++ P   + + + T HR  L    +A
Sbjct: 45  PAPSLTNFIKGLVLHSNVQTPTLMATAVYLAKLRSIIPGNVYGIET-TRHRIFLGCLILA 103

Query: 127 SKGLCDSFCTNSHYA--KVGGIRCNELNVLETEFLERVRYRV 166
           +K L DS   N H+A    G +  +E+N +E E LE   + V
Sbjct: 104 AKTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFDWNV 145

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 52/96 (54%), Gaps = 3/96 (3%)

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTATTIASKGL 130
           S+  ++ +L +Y+++ +S L+T+V Y+  L  + P  +     T HR  L    +++K  
Sbjct: 55  SLMTFITKLVRYTNVYTSTLLTTVCYLSKLKTILPRDATGLPSTTHRIFLACLILSAKFH 114

Query: 131 CDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRY 164
            DS   N+H+++   G     ++N++E + L+ + +
Sbjct: 115 NDSSPLNAHWSRYTDGLFSLEDVNLMERQLLQLLHW 150

>KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON}
           Anc_3.70 YNL289W
          Length = 267

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 49/93 (52%), Gaps = 3/93 (3%)

Query: 66  KVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTATT 124
           K P   S+  ++ RL +Y+++ +  L+T+V Y++ L  + P+ +     T+HR  L    
Sbjct: 53  KQPRLPSLRTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPSTIHRLFLACLI 112

Query: 125 IASKGLCDSFCTNSHYAKV--GGIRCNELNVLE 155
           I++K   DS   N H+ +   G     ++N++E
Sbjct: 113 ISAKFHNDSSPLNKHWTRYTDGLFSLEDINLME 145

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 47/87 (54%), Gaps = 3/87 (3%)

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTATTIASKGL 130
           S+  ++ RL +Y+++ +  L+T+V Y++ L  + P+ +     T+HR  L    +++K  
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDATGLPSTIHRIFLACLILSAKFH 113

Query: 131 CDSFCTNSHYAKV--GGIRCNELNVLE 155
            DS   N H+ K   G     ++N++E
Sbjct: 114 NDSSPLNKHWVKYTDGLFTLEDVNLME 140

>Suva_7.130 Chr7 (251870..253198) [1329 bp, 442 aa] {ON} YGL134W
           (REAL)
          Length = 442

 Score = 37.7 bits (86), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 54/115 (46%), Gaps = 7/115 (6%)

Query: 52  NNRLSPLFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLL-------SNV 104
           NN+ +      F+ K  P++S  D+L R+      ES+V + + + +D +         +
Sbjct: 298 NNKETEKEYANFYMKSKPSLSSVDFLKRIQDKCEYESTVYLVATFLMDTIYLTRNDNDVL 357

Query: 105 YPEFSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
             +  L    +HR ++    +++K L D   ++ +++KV G+    L+ LE   L
Sbjct: 358 QLKLKLQEKEIHRMIIATVRLSTKLLEDFVHSHEYFSKVCGVSKRLLSKLEVSLL 412

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 52/96 (54%), Gaps = 3/96 (3%)

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYP-EFSLNSLTVHRYLLTATTIASKGL 130
           S+  ++ RL +++++ +S L+T+  Y++ L  + P + S    TVHR  L    +++K  
Sbjct: 51  SLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPKDASGLPSTVHRIFLACLILSAKFH 110

Query: 131 CDSFCTNSHYAKVGG--IRCNELNVLETEFLERVRY 164
            DS   N H+AK         ++N++E + ++ + +
Sbjct: 111 NDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNW 146

>KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 37.0 bits (84), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 29/144 (20%), Positives = 61/144 (42%), Gaps = 23/144 (15%)

Query: 24  IDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNISIFDYLIRLTKY 83
           ++++  ++   +  I IND+   HG+                     +S+ D++  L ++
Sbjct: 17  LEMVHFLAATTASVISINDTDVRHGST--------------------VSLVDFIKSLIRH 56

Query: 84  SSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTATTIASKGLCDSFCTNSHYAK 142
           S++++  L+ +  Y+  L ++ P        T HR  +    +A+K L DS   N H+  
Sbjct: 57  SNVQTPTLMATTVYLTKLRSILPHDVCGIETTRHRIFIGCLILAAKNLNDSSPLNKHWTN 116

Query: 143 V--GGIRCNELNVLETEFLERVRY 164
              G     ++N +E E L    +
Sbjct: 117 YTDGLFTLEDVNTIERELLSLFSW 140

>Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W
           (REAL)
          Length = 434

 Score = 37.0 bits (84), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 31/144 (21%), Positives = 64/144 (44%), Gaps = 11/144 (7%)

Query: 25  DLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNISIFDYLIRLTKYS 84
           D +   S  +   + ++D       ++ N +       F+ K  P++S  D+L R+    
Sbjct: 264 DALANFSETIELLLKLSDDEKC--TISKNDVEKKEYANFYMKSKPSLSSVDFLRRIQDKC 321

Query: 85  SLESSVLITSVYYIDLLSNVYPEFSLNSLT---------VHRYLLTATTIASKGLCDSFC 135
             E +V + + + +D L     E + N+L          VHR ++ +  +++K L D   
Sbjct: 322 EYEPAVYLVATFLMDTLFLTRNERNNNALQLKLKLQEKEVHRVIIASVRLSTKLLEDFVH 381

Query: 136 TNSHYAKVGGIRCNELNVLETEFL 159
           ++ +++KV G+    L+ LE   L
Sbjct: 382 SHEYFSKVCGVSKRLLSKLEISLL 405

>Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {ON}
           YNL289W (PCL1) - G(sub)1 cyclin that associates with
           PHO85 [contig 8] FULL
          Length = 256

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 48/88 (54%), Gaps = 5/88 (5%)

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE--FSLNSLTVHRYLLTATTIASKG 129
           S+  ++ RL +Y+++ +S L+T+  Y++ L  + P     L S T HR  L    +++K 
Sbjct: 59  SLMTFVTRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPS-TSHRIFLACLILSAKF 117

Query: 130 LCDSFCTNSHYAK-VGGIRCNE-LNVLE 155
             DS   N H+A    G+ C E +N++E
Sbjct: 118 HNDSSPQNKHWAAYTDGLFCLEDVNLME 145

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 36.2 bits (82), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 50/96 (52%), Gaps = 3/96 (3%)

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLTATTIASKGL 130
           ++ +++ +L +Y+ + +  L+ ++ Y++ L  + P+ +     T+HR  L    I++K  
Sbjct: 55  TLREFICKLVEYTHVYTPTLLMTISYLNRLRRILPKGAAGIPSTLHRIFLACLIISAKNH 114

Query: 131 CDSFCTNSHYAKV--GGIRCNELNVLETEFLERVRY 164
            DS   N H+ K   G     ++N++E   L+ + +
Sbjct: 115 NDSSPLNRHWTKYTDGLFTLEDVNLMERHLLDLLNW 150

>Skud_16.60 Chr16 (110205..111707) [1503 bp, 500 aa] {ON} YPL219W
           (REAL)
          Length = 500

 Score = 36.6 bits (83), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 49/116 (42%), Gaps = 8/116 (6%)

Query: 57  PLFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLL--------SNVYPEF 108
           P     F  K PP++S  D++ R+       S V + + Y + L+          V  + 
Sbjct: 358 PQKFVNFIMKNPPSLSFKDFIDRIQNKCMFGSVVYLGATYLLQLVFLTRDEMNGPVKLKA 417

Query: 109 SLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRY 164
            L     HR +++A  I +K L D   + ++  KV GI    L  LE  F+  V +
Sbjct: 418 KLQEDQAHRVIISAIRITTKLLEDFVHSQNYICKVFGISKRLLTKLEISFMASVNF 473

>KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 281

 Score = 36.2 bits (82), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 5/88 (5%)

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE--FSLNSLTVHRYLLTATTIASKG 129
           S+  ++ RL +Y+++ +S L+T+  Y++ L  + P     L S T HR  L    +++K 
Sbjct: 87  SLMTFITRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPS-TGHRIFLACLILSAKY 145

Query: 130 LCDSFCTNSHYAK-VGGIRC-NELNVLE 155
             DS   N H+A    G+ C +++N++E
Sbjct: 146 HNDSSPQNKHWAAYTDGLFCLDDVNLME 173

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 36.2 bits (82), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 50/96 (52%), Gaps = 6/96 (6%)

Query: 63  FHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRYLLT 121
           +  ++P   S+  ++  L +Y+++ +  L+T+V Y++ L  + P+ +     T+HR  L 
Sbjct: 48  YQPRLP---SLMTFITNLVRYTNVYTPTLLTTVCYLNKLKRLLPKDATGLPSTIHRIFLA 104

Query: 122 ATTIASKGLCDSFCTNSHYAKV--GGIRCNELNVLE 155
              +++K   DS   N H+ K   G     ++N++E
Sbjct: 105 CLILSAKFHNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>Suva_16.87 Chr16 (146154..147659) [1506 bp, 501 aa] {ON} YPL219W
           (REAL)
          Length = 501

 Score = 35.8 bits (81), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 48/116 (41%), Gaps = 8/116 (6%)

Query: 57  PLFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFS------- 109
           P     F  K PP++S  D++ R+       + V + + Y + L+     E         
Sbjct: 359 PQKFVNFTMKNPPSLSFKDFIDRIQNKCMFGAIVYLGATYLLQLVFLTRDELDGPIKLKA 418

Query: 110 -LNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRY 164
            L     HR +++   IA+K L D   + ++  KV GI    L  LE  FL  V +
Sbjct: 419 KLQEDQTHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFLASVNF 474

>YPL219W Chr16 (136750..138228) [1479 bp, 492 aa] {ON}  PCL8Cyclin,
           interacts with Pho85p cyclin-dependent kinase (Cdk) to
           phosphorylate and regulate glycogen synthase, also
           activates Pho85p for Glc8p phosphorylation
          Length = 492

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 48/116 (41%), Gaps = 8/116 (6%)

Query: 57  PLFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFS------- 109
           P     F  K PP++S  D++ R+       + V + + Y + L+     E         
Sbjct: 350 PQKFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTRDEMDGPIKLKA 409

Query: 110 -LNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRY 164
            L     HR +++   IA+K L D   + ++  KV GI    L  LE  F+  V +
Sbjct: 410 KLQEDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMASVNF 465

>KNAG0F01870 Chr6 (356849..358300) [1452 bp, 483 aa] {ON} Anc_6.236
           YGL134W
          Length = 483

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 49/94 (52%), Gaps = 8/94 (8%)

Query: 61  TRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLL--------SNVYPEFSLNS 112
           +RF  K  P++S  D++ R+      ++ V +++ Y + +L        +++  +F L  
Sbjct: 349 SRFIMKNIPSLSFVDFIKRIHDKCHFDTPVYLSATYLLQILFLERSAESNSLELKFKLQR 408

Query: 113 LTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGI 146
             +HR ++    I++K L D   ++ +++KV G+
Sbjct: 409 DGLHRLIIALVRISTKLLEDQIHSHDYFSKVCGV 442

>KAFR0L01200 Chr12 complement(225099..225938) [840 bp, 279 aa] {ON}
           Anc_7.289 YDL179W
          Length = 279

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 53/107 (49%), Gaps = 8/107 (7%)

Query: 75  DYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE-FSLNSLTVHRYLLTATTIASKGLCDS 133
           D++  L   S + +S L+++  +++ L  + P   S    T HR  L    +++K L D 
Sbjct: 49  DFICNLVIRSRVNTSTLMSTTVFLNKLKEILPRNVSGMETTRHRIFLGCLILSAKTLNDC 108

Query: 134 FCTNSHYAK--VGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKL 178
             TN ++++   G I   E+N +E E L+   +     D TIK+ +L
Sbjct: 109 SPTNKYWSQHCDGLISVREINKIERELLKYFNW-----DVTIKVEEL 150

>Smik_6.424 Chr6 complement(686097..687575) [1479 bp, 492 aa] {ON}
           YPL219W (REAL)
          Length = 492

 Score = 34.7 bits (78), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 49/116 (42%), Gaps = 8/116 (6%)

Query: 57  PLFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFS------- 109
           P     F  K PP++S  D++ R+       + V + + Y + L+     E +       
Sbjct: 350 PQKFVNFVMKNPPSLSFRDFIDRIQNKCMFGAVVYLGATYLLQLVFLTRDEMNGPIKLKT 409

Query: 110 -LNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRY 164
            L     HR +++   IA+K L D   + ++  KV GI    L  LE  F+  V +
Sbjct: 410 KLQEDQAHRIIISTIRIATKLLEDFVHSQNYICKVFGISKRLLTKLEISFMACVNF 465

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 49/103 (47%), Gaps = 7/103 (6%)

Query: 68  PPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPE--FSLNSLTVHRYLLTATTI 125
           PP ++ F  +  +   S++++  L+ +   ++ L  + P   + + S T HR  L    +
Sbjct: 46  PPPLAKF--IKNICVKSNVQTPTLMATTVLLEKLKKIIPSNVYGIES-TRHRIFLGCLIL 102

Query: 126 ASKGLCDSFCTNSHYAKVGG--IRCNELNVLETEFLERVRYRV 166
           ++K L DS   N H+AK     I   E+N +E E L    + V
Sbjct: 103 SAKSLNDSSPLNKHWAKYTESYIHLREVNTIERELLNYFDWNV 145

>Skud_16.280 Chr16 (516846..518315) [1470 bp, 489 aa] {ON} YPL003W
           (REAL)
          Length = 489

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 61/137 (44%), Gaps = 9/137 (6%)

Query: 18  FMKCSKIDLITLISRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNISIFDYL 77
           ++ CS+ D    +  +L      +D H+ H ++ N  +  L L           S F  L
Sbjct: 279 YLACSRDDCYQELDDLLRNLEISDDEHDWH-DICNYEIVTLVLALKRMAQESEESTFQPL 337

Query: 78  IRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKGLCDSFCTN 137
                   +ES    T+V Y +L S    +   +   V + L+++    SKG+ ++FC  
Sbjct: 338 A--GALPDMES----TTVNYTELKSIYEVKAEFDRSCVKKSLVSSGKKVSKGVLNTFC-- 389

Query: 138 SHYAKVGGIRCNELNVL 154
           SHY +V GI  +E ++L
Sbjct: 390 SHYGEVRGILPSESDLL 406

>Ecym_1201 Chr1 (406247..407581) [1335 bp, 444 aa] {ON} similar to
           Ashbya gossypii AER440C
          Length = 444

 Score = 33.1 bits (74), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 30/53 (56%)

Query: 115 VHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVI 167
           +++ L+ A  +A+K   D   TN  +++  G++C+ +N  E E+L    +R+ 
Sbjct: 225 IYQNLMVAFVLANKFNDDKTFTNKSWSQATGMKCSVINTYEREWLAVFEWRLF 277

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 53/108 (49%), Gaps = 9/108 (8%)

Query: 72  SIFDYLIRLTKYSSL-ESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKGL 130
           SI  ++ RL +Y+++  +++L T+VY   L   +  + +    T HR  L    +++K  
Sbjct: 53  SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPSTAHRIFLACLILSAKFH 112

Query: 131 CDSFCTNSHYAKV--GGIRCNELNVLETEFLE------RVRYRVIPRD 170
            DS   N H+ K   G     ++N++E + L       RV +R + RD
Sbjct: 113 NDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNVRVGHRDLCRD 160

>KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.46
           YLR309C
          Length = 824

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 46/105 (43%), Gaps = 15/105 (14%)

Query: 39  DINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYI 98
           D NDSHN+   + N + S   L+R  SK+    S  D L+ L           I   +  
Sbjct: 673 DFNDSHNLQKTINNLKDS---LSRSESKITELQSANDELMSLNND--------INKKF-- 719

Query: 99  DLLSNVYPEFSL--NSLTVHRYLLTATTIASKGLCDSFCTNSHYA 141
           D +S  Y   SL  N+L  +   L A+ I S    DSF  +S+ A
Sbjct: 720 DRISKNYKSLSLQFNTLKGNVSKLKASPITSSDSSDSFKASSNSA 764

>Smik_16.98 Chr16 complement(183740..184669) [930 bp, 309 aa] {ON}
           YGR208W (REAL)
          Length = 309

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 37/77 (48%), Gaps = 12/77 (15%)

Query: 173 IKLCKLEYKYSPIE------DINNDIHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNS 226
           ++LCK +YK  P+E      D  ND+     +  +G+ +      K VQ    CK +  S
Sbjct: 237 LQLCK-DYKV-PVESSCMVGDGGNDLPA---MATAGFGIAWNAKPK-VQKAAPCKLNTKS 290

Query: 227 FRNVNYIFSINQDEIYN 243
            +++ YI     DEIYN
Sbjct: 291 MKDILYILGYTDDEIYN 307

>NDAI0H04040 Chr8 (997352..998167) [816 bp, 271 aa] {ON} 
          Length = 271

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 28/62 (45%), Gaps = 2/62 (3%)

Query: 170 DNTIKLCKLEYKYSPIEDINND--IHIPDELQNSGYNVLSTYYNKMVQLVGNCKSSKNSF 227
           +N  + C L +KY+P+    +D    +   LQNS    +  Y  K++  + N   S   +
Sbjct: 90  ENACRSCMLNHKYAPVGSCKDDTTATVKSILQNSLIGFIGWYLPKLIAFIPNLNRSDKKY 149

Query: 228 RN 229
            N
Sbjct: 150 PN 151

>NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON} 
          Length = 240

 Score = 30.0 bits (66), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 47/107 (43%), Gaps = 11/107 (10%)

Query: 72  SIFDYLIRLTKYSSLESSVLITSVYYIDLL--------SNVYPEFSLNSLTVHRYLLTAT 123
           S+  ++  +TK S  + ++L+ + YY   L         +  PEF   +    R  LT  
Sbjct: 94  SLKSFINEITKRSKSKRNILLLATYYFQKLYTSLSTCPVSTIPEF---AFCAKRSFLTCI 150

Query: 124 TIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRD 170
            IA K L DS  +   ++ + G+    L+ +E   L ++ Y +   D
Sbjct: 151 IIAHKYLNDSTFSMESWSLISGLNKKALSTIERWCLGKLDYNLFVDD 197

>TPHA0C04640 Chr3 complement(1004694..1005833) [1140 bp, 379 aa]
           {ON} Anc_2.333 YDL107W
          Length = 379

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 44/98 (44%), Gaps = 16/98 (16%)

Query: 37  FIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVY 96
           FI + D+  + G V        +L R H + P      +Y  +  KYS LE++V   S Y
Sbjct: 183 FIKMQDNTALAGEVYG------YLGRIHLRKPDIHKAEEYFRKSIKYSRLENAVF--SYY 234

Query: 97  YIDLLSNVYPEFSLNSLTVHRYLLTATTIASKGLCDSF 134
           Y   LS +Y     N L    YL  +   A++G  ++F
Sbjct: 235 Y---LSQIY--IDTNPLRARSYLEVS---ATQGFKEAF 264

>CAGL0H08998g Chr8 (877952..879595) [1644 bp, 547 aa] {ON} weakly
           similar to uniprot|Q08966 Saccharomyces cerevisiae
           YPL219w PCL8
          Length = 547

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 24/112 (21%), Positives = 50/112 (44%), Gaps = 9/112 (8%)

Query: 56  SPLFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLL--------SNVYPE 107
           SP  L  F  K  P++S   +L R+         + + + Y + +L        SN+   
Sbjct: 408 SPAALN-FTMKSKPSVSAEIFLGRIQNKCEFGPIIYLAAAYLLQILFLTRDNPDSNIRVR 466

Query: 108 FSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFL 159
             L    +HR +++   +++K + D   ++ +++KV G+    L+ LE   +
Sbjct: 467 LKLRENEIHRLIISTVRVSAKLVEDFVHSHEYFSKVCGVSKKLLSKLEVSLI 518

>YNL139C Chr14 complement(360924..365717) [4794 bp, 1597 aa] {ON}
           THO2Subunit of the THO complex, which is required for
           efficient transcription elongation and involved in
           transcriptional elongation-associated recombination;
           required for LacZ RNA expression from certain plasmids
          Length = 1597

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 8/58 (13%)

Query: 137 NSHYAKVGGIRCNELNVLETEFLERVRYRVIPRDNTIKLCKLEYKYSPIEDINNDIHI 194
           NSHY K+   RC+E+N L   F+E +++        +K    E    P  ++NN  H+
Sbjct: 849 NSHY-KILSTRCDEMNTLLWSFIELIKH-------CLKGKAFEENVLPFVELNNRFHL 898

>TDEL0E02800 Chr5 complement(539086..539685) [600 bp, 199 aa] {ON}
           Anc_5.347 YHR071W
          Length = 199

 Score = 29.3 bits (64), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 42/86 (48%), Gaps = 3/86 (3%)

Query: 82  KYSSLESSVLITSVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYA 141
           + ++L +      +Y   L +   P+F+  S    R  L+   +A K L D+  T   + 
Sbjct: 80  RKTALVALAYFNKIYDGQLWNGKLPDFARCS---KRIFLSCLILAHKYLNDNSFTMKTWN 136

Query: 142 KVGGIRCNELNVLETEFLERVRYRVI 167
            + G+  N+L ++E   LE++ YR++
Sbjct: 137 MISGLSQNDLCLMERWGLEKLDYRLL 162

>TBLA0B08440 Chr2 complement(2023101..2023907) [807 bp, 268 aa] {ON}
           Anc_3.70 YNL289W
          Length = 268

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 67/138 (48%), Gaps = 4/138 (2%)

Query: 31  SRMLSFFIDINDSHNIHGNVTNNRLSPLFLTRFHSKVPPNI-SIFDYLIRLTKYSSLESS 89
           S+ L   ++   S  +  ++TN  L  L ++   S+   NI S+  ++ RL  Y+++ S 
Sbjct: 4   SKALRILMNSPVSKGMITHLTNITLKVLPISNCSSESGLNIPSLQTFITRLVNYTNVPSG 63

Query: 90  VLIT-SVYYIDLLSNVYPEFSLNSLTVHRYLLTATTIASKGLCDSFCTNSHYAK-VGGIR 147
            L+T +VY   L   +  E S    T HR  L    +++K   DS   N H+      + 
Sbjct: 64  TLLTTAVYLNRLKQLLPAEASGIQSTRHRIFLACLILSAKYNNDSSPLNIHWMNHTNDLF 123

Query: 148 C-NELNVLETEFLERVRY 164
           C N++N++E + L+ + +
Sbjct: 124 CLNDINLMERQLLKLLNW 141

>CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9 or uniprot|P25693 Saccharomyces cerevisiae
           YDL127w
          Length = 314

 Score = 29.3 bits (64), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 50/103 (48%), Gaps = 5/103 (4%)

Query: 60  LTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSLN-SLTVHRY 118
           + + +S  P  +S+F  +  L   S +++S L+ +  Y+D LS + P        T HR 
Sbjct: 44  IKKTNSPKPVELSLF--VEELVASSKVQASTLMATAVYLDRLSRIIPSNVCGIETTKHRM 101

Query: 119 LLTATTIASKGLCDSFCTNSHYAKV--GGIRCNELNVLETEFL 159
            L    ++SK L DS   N H+ K   G +   E+N +E E L
Sbjct: 102 FLGCLILSSKSLDDSSLFNKHWTKYCNGLLTLKEVNSIERELL 144

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,655,253
Number of extensions: 1407105
Number of successful extensions: 5130
Number of sequences better than 10.0: 144
Number of HSP's gapped: 5255
Number of HSP's successfully gapped: 149
Length of query: 268
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 160
Effective length of database: 41,097,471
Effective search space: 6575595360
Effective search space used: 6575595360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)