Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A071501.52ON1391139165400.0
Kpol_2002.461.52ON112353218690.0
TDEL0C064901.52ON115354118690.0
NCAS0B086001.52ON111752518260.0
KAFR0D041001.52ON111751618060.0
TPHA0E036401.52ON113754417860.0
KLTH0F01672g1.52ON116452017750.0
Skud_4.7831.52ON113550217600.0
SAKL0C01716g1.52ON121554817530.0
Smik_4.7891.52ON113650217450.0
YDR507C (GIN4)1.52ON114250217420.0
KLLA0C01650g1.52ON111252517390.0
ZYRO0F17402g1.52ON118953217440.0
Suva_2.6871.52ON112850217380.0
KNAG0F002901.52ON112550917240.0
NDAI0A006601.52ON102252717000.0
AFR696C1.52ON114251516940.0
CAGL0K05709g1.52ON110350316500.0
Ecym_10581.52ON116451516350.0
Smik_3.541.52ON103249914421e-178
YCL024W (KCC4)1.52ON103735614071e-173
Skud_3.391.52ON101741813931e-171
Suva_3.1901.52ON102435913921e-171
KLTH0D05566g2.479ON112836010451e-121
Ecym_73922.479ON143435410541e-120
SAKL0E02860g2.479ON137735610431e-119
ABL034W2.479ON142535410441e-118
KLLA0F13552g2.479ON126736110301e-117
TBLA0I011502.479ON174539210451e-117
YKL101W (HSL1)2.479ON151840210341e-117
Suva_11.1232.479ON152640210321e-116
Kwal_26.77882.479ON126736010201e-116
Smik_11.1392.479ON153438910281e-116
Skud_11.1262.479ON151838910221e-115
TDEL0A025502.479ON136939210121e-114
KAFR0D032002.479ON144838310081e-113
KNAG0A065402.479ON14323779941e-112
ZYRO0G03366g2.479ON16164119971e-111
NCAS0A057702.479ON14613879831e-110
Kpol_431.92.479ON15524009711e-108
CAGL0K08514g2.479ON14893949601e-107
Kwal_33.132251.52ON9643259261e-106
NDAI0D027502.479ON15152988632e-94
TPHA0G032002.479ON15343148411e-91
Kwal_33.13222singletonOFF1481206304e-75
CAGL0M08910g5.611ON6123646586e-73
KLLA0A03806g5.611ON6022836452e-71
NCAS0A080805.611ON6232726463e-71
TPHA0C004705.611ON6312776463e-71
Kpol_495.145.611ON6242726463e-71
YDR477W (SNF1)5.611ON6332826437e-71
Suva_2.6515.611ON6332826438e-71
Smik_4.7545.611ON6322826438e-71
TBLA0E033605.611ON6542726412e-70
Skud_4.7515.611ON6342826402e-70
Kpol_1018.655.611ON6012726321e-69
TPHA0D028405.611ON6342716332e-69
KAFR0C058605.611ON6442726332e-69
NDAI0H009405.611ON6852726362e-69
TDEL0A047805.611ON6212726287e-69
AEL230W5.611ON6082726277e-69
Ecym_55885.611ON6132726261e-68
KNAG0B032305.611ON6412776271e-68
Kwal_47.182335.611ON5982696222e-68
SAKL0G06952g5.611ON5992696188e-68
ZYRO0A05544g5.611ON6312766208e-68
KLTH0G05698g5.611ON5972696162e-67
CAGL0M02519g8.654ON7562925365e-56
KNAG0J015908.654ON8053255332e-55
Kwal_26.87098.654ON8292965307e-55
KLTH0D10714g8.654ON8722965291e-54
NDAI0E023208.654ON9323015283e-54
TPHA0G017108.654ON8052835244e-54
ZYRO0F06842g8.654ON8432905237e-54
TDEL0A060008.654ON7902955217e-54
SAKL0H07084g8.654ON9192955241e-53
Suva_16.1698.654ON8582975221e-53
NDAI0J012508.279ON11763535253e-53
YPL141C (FRK1)8.654ON8652975174e-53
Kpol_1072.298.654ON8932945176e-53
KAFR0H025408.654ON8173235147e-53
Skud_16.1408.654ON8652885141e-52
NCAS0C015908.654ON8642985141e-52
TPHA0J008208.279ON12183035192e-52
Kpol_1012.68.654ON6282865003e-52
Smik_4.3678.279ON10662885144e-52
NCAS0B037408.279ON10492895134e-52
NDAI0E012908.654ON7292935044e-52
TBLA0B039708.654ON12083015146e-52
Smik_6.3398.654ON8652975087e-52
KAFR0A037308.654ON7882925057e-52
CAGL0J03872g8.654ON6612944971e-51
TPHA0D011408.654ON6222984951e-51
Suva_2.2838.279ON10892885092e-51
CAGL0M11396g8.279ON11922895102e-51
Skud_4.3838.279ON10652885054e-51
YDR122W (KIN1)8.279ON10642885055e-51
NDAI0B020708.279ON12583315066e-51
SAKL0H16632g8.279ON10622925046e-51
NCAS0B014708.654ON7272834947e-51
TBLA0C046008.279ON13152875041e-50
NCAS0B050908.279ON12102975031e-50
Smik_15.4178.654ON8062904924e-50
Kpol_1066.468.279ON12252934985e-50
KNAG0G021108.279ON11923074985e-50
Ecym_83398.654ON9202834937e-50
KAFR0B028008.279ON10952944958e-50
TDEL0F040608.279ON11262934941e-49
Ecym_42918.279ON11452924941e-49
TBLA0C017508.654ON9812904902e-49
KLTH0G13288g8.279ON11423444922e-49
KLLA0F19536g8.279ON11043044922e-49
AGR058W8.279ON10712924903e-49
Skud_15.3998.654ON8073334835e-49
Skud_12.1648.279ON11602924896e-49
Suva_8.2848.654ON8082924827e-49
ZYRO0D06776g8.279ON12042874887e-49
Suva_10.1808.279ON11592984888e-49
KNAG0A030408.654ON6442894749e-49
Smik_12.1558.279ON11623044871e-48
CAGL0M02299g8.668ON8932814821e-48
ACR119W8.654ON9312934821e-48
YOR233W (KIN4)8.654ON8002864791e-48
YLR096W (KIN2)8.279ON11472924842e-48
CAGL0B01925g8.279ON9442884742e-47
KNAG0H031408.279ON9362974671e-46
SAKL0H06754g8.668ON8842784615e-46
KLLA0D07348g8.654ON9092934599e-46
NDAI0E023908.668ON8833214552e-45
ZYRO0F07194g8.668ON9382914544e-45
TBLA0B038608.668ON9882814545e-45
NCAS0C016708.668ON8962914501e-44
Kwal_26.87518.668ON8482764453e-44
Kpol_1072.198.668ON8962784447e-44
KLLA0F11319g8.668ON8433374411e-43
TPHA0G016308.668ON8712784401e-43
KNAG0J016708.668ON10092764412e-43
KNAG0D010906.222ON3722904152e-43
TDEL0A061408.668ON8613524356e-43
Ecym_24058.668ON8552814331e-42
SAKL0D07656g1.374ON4323214141e-42
KLTH0D11044g8.668ON8492914302e-42
Suva_16.1608.668ON9182934313e-42
KNAG0I014801.374ON4402784123e-42
ACR133C8.668ON8512814284e-42
NDAI0G053001.374ON4373004088e-42
KLTH0H11396g1.374ON4372784088e-42
YPL150W8.668ON9012914269e-42
YFR014C (CMK1)1.374ON4462784062e-41
Kwal_56.224766.31ON6972294192e-41
Smik_6.3478.668ON9172934242e-41
Skud_16.1328.668ON9242984232e-41
NCAS0D021006.31ON7262074192e-41
KLTH0C10912g6.31ON6972294172e-41
KLLA0F23155g1.374ON4272834024e-41
NCAS0D006301.374ON4272924024e-41
KLLA0F11143g8.676ON8132784185e-41
Suva_6.781.374ON4452784026e-41
Smik_7.3191.374ON4462784027e-41
Smik_6.3508.676ON8222904178e-41
YPL153C (RAD53)8.676ON8213124161e-40
Kpol_1069.131.374ON4272783991e-40
Skud_16.1298.676ON8272884151e-40
SAKL0E01584g6.31ON6952524112e-40
Kwal_0.961.374ON4272943962e-40
NCAS0A088801.374ON4223003963e-40
Kwal_56.237178.279ON8581874133e-40
TPHA0O011201.374ON4292743963e-40
CAGL0M02233g8.676ON7672974104e-40
Suva_16.1578.676ON8322934114e-40
ACL006W6.31ON7082094084e-40
Skud_6.891.374ON4462783954e-40
Ecym_30356.31ON7402094095e-40
KNAG0J017008.676ON8202844105e-40
KLTH0D11242g8.676ON7952804105e-40
SAKL0H06534g8.676ON8042824105e-40
Kwal_26.87968.676ON7962804095e-40
NDAI0E021108.676ON9032884116e-40
Suva_13.1636.31ON7052424076e-40
NDAI0H035201.374ON4582883957e-40
TBLA0B004906.31ON7872374088e-40
TDEL0A062208.676ON7942824088e-40
CAGL0F04741g1.374ON4423203921e-39
Kpol_1037.206.31ON7042354041e-39
Skud_13.1546.31ON7052094041e-39
Kpol_1065.36.222ON3762843862e-39
Smik_13.1596.31ON7052094032e-39
AAR009W1.374ON4532923912e-39
YMR001C (CDC5)6.31ON7052094022e-39
TPHA0J004206.31ON7072934022e-39
KAFR0G026906.31ON7132264022e-39
KAFR0H024308.676ON7842824034e-39
Ecym_12751.374ON4512723884e-39
KNAG0E008506.31ON7112424005e-39
NDAI0F016006.222ON4122143838e-39
KAFR0C044801.374ON4353203841e-38
Kpol_1072.168.676ON7952823972e-38
CAGL0K10604g1.374ON4462783832e-38
TBLA0D050101.374ON4342943822e-38
TBLA0B038408.676ON8582813972e-38
TDEL0G043806.31ON7222293942e-38
ZYRO0C07480g6.31ON7742293953e-38
KAFR0K003306.214ON3732773763e-38
NDAI0C026806.31ON7502003943e-38
TPHA0E028206.222ON3842543765e-38
TDEL0B063201.374ON4442883795e-38
NCAS0C013708.676ON7992803936e-38
CAGL0J11638g6.31ON7462083926e-38
TPHA0G016008.676ON8452823946e-38
KLLA0C06138g6.31ON7082313906e-38
KLTH0H04180g6.214ON3532543719e-38
Skud_15.1441.374ON4492763771e-37
TBLA0A020306.214ON4033113741e-37
KAFR0H025108.668ON8793613912e-37
CAGL0L07326g2.352ON5063113782e-37
Suva_15.1551.374ON4522763743e-37
Skud_10.501.182ON3973063713e-37
YJL164C (TPK1)1.182ON3973063703e-37
Kwal_56.240916.222ON3812143694e-37
TBLA0A020506.222ON4342733715e-37
KNAG0D011406.214ON3952793686e-37
KLTH0F04840g1.182ON3813353676e-37
YOL016C (CMK2)1.374ON4472763716e-37
Smik_10.661.182ON3973063678e-37
KAFR0F018001.182ON4243113698e-37
ZYRO0E07018g6.222ON3672143659e-37
Kwal_56.240596.214ON3532543639e-37
Ecym_23978.676ON8722823841e-36
Skud_16.706.222ON3672573641e-36
SAKL0C05368g1.182ON4183063681e-36
Suva_6.2451.182ON3943083661e-36
ACR142W8.676ON8372873831e-36
ZYRO0F07370g8.676ON7622803821e-36
Smik_6.4146.222ON3672573631e-36
KLTH0H03982g6.222ON3982143651e-36
CAGL0G09020g6.214ON3612683631e-36
NCAS0B044906.222ON3492563621e-36
Smik_15.1531.374ON4422743672e-36
KAFR0K002806.222ON3602143612e-36
YPL203W (TPK2)6.214ON3802873632e-36
TDEL0C037101.182ON4113213652e-36
Skud_16.766.214ON3822873623e-36
Smik_6.4086.214ON3812873623e-36
YPL209C (IPL1)6.222ON3672573613e-36
NDAI0A009601.182ON4082593633e-36
NCAS0A011006.214ON3542773594e-36
NDAI0F016506.214ON3672853586e-36
YDL101C (DUN1)2.352ON5132943676e-36
AFL101C6.222ON3672833586e-36
KLLA0B07205g1.182ON4553113646e-36
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07150
         (1391 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...  2523   0.0  
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...   724   0.0  
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...   724   0.0  
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...   707   0.0  
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...   700   0.0  
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...   692   0.0  
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...   688   0.0  
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...   682   0.0  
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...   679   0.0  
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...   676   0.0  
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...   675   0.0  
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...   674   0.0  
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...   676   0.0  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...   674   0.0  
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...   668   0.0  
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52    659   0.0  
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...   657   0.0  
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   640   0.0  
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...   634   0.0  
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...   560   e-178
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...   546   e-173
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...   541   e-171
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...   540   e-171
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...   407   e-121
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...   410   e-120
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...   406   e-119
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...   406   e-118
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...   401   e-117
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...   407   e-117
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...   402   e-117
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...   402   e-116
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...   397   e-116
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...   400   e-116
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...   398   e-115
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....   394   e-114
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....   392   e-113
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...   387   e-112
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...   388   e-111
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...   383   e-110
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...   378   e-108
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...   374   e-107
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...   361   e-106
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....   337   2e-94
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....   328   1e-91
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...   247   4e-75
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...   258   6e-73
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...   253   2e-71
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...   253   3e-71
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...   253   3e-71
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...   253   3e-71
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...   252   7e-71
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...   252   8e-71
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...   252   8e-71
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...   251   2e-70
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...   251   2e-70
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...   248   1e-69
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}              248   2e-69
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...   248   2e-69
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...   249   2e-69
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...   246   7e-69
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...   246   7e-69
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...   245   1e-68
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...   246   1e-68
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...   244   2e-68
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...   242   8e-68
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...   243   8e-68
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...   241   2e-67
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...   211   5e-56
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....   209   2e-55
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...   208   7e-55
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...   208   1e-54
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}              207   3e-54
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...   206   4e-54
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...   206   7e-54
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...   205   7e-54
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...   206   1e-53
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...   205   1e-53
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...   206   3e-53
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...   203   4e-53
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...   203   6e-53
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...   202   7e-53
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...   202   1e-52
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654    202   1e-52
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...   204   2e-52
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....   197   3e-52
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...   202   4e-52
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...   202   4e-52
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...   198   4e-52
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...   202   6e-52
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...   200   7e-52
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...   199   7e-52
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...   196   1e-51
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...   195   1e-51
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...   200   2e-51
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...   201   2e-51
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...   199   4e-51
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...   199   5e-51
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}             199   6e-51
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...   198   6e-51
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654    194   7e-51
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...   198   1e-50
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}             198   1e-50
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...   194   4e-50
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...   196   5e-50
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....   196   5e-50
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...   194   7e-50
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....   195   8e-50
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....   194   1e-49
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...   194   1e-49
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...   193   2e-49
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...   194   2e-49
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...   194   2e-49
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...   193   3e-49
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...   190   5e-49
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...   192   6e-49
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...   190   7e-49
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...   192   7e-49
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...   192   8e-49
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...   187   9e-49
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...   192   1e-48
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...   190   1e-48
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...   190   1e-48
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...   189   1e-48
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...   191   2e-48
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...   187   2e-47
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...   184   1e-46
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...   182   5e-46
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...   181   9e-46
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...   179   2e-45
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...   179   4e-45
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...   179   5e-45
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...   177   1e-44
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...   176   3e-44
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....   175   7e-44
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...   174   1e-43
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...   174   1e-43
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...   174   2e-43
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...   164   2e-43
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...   172   6e-43
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...   171   1e-42
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...   164   1e-42
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...   170   2e-42
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...   170   3e-42
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...   163   3e-42
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...   169   4e-42
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...   161   8e-42
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...   161   8e-42
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...   168   9e-42
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...   160   2e-41
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   166   2e-41
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...   167   2e-41
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...   167   2e-41
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31     166   2e-41
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   165   2e-41
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...   159   4e-41
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...   159   4e-41
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...   165   5e-41
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...   159   6e-41
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...   159   7e-41
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...   165   8e-41
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...   164   1e-40
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...   158   1e-40
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...   164   1e-40
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...   162   2e-40
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...   157   2e-40
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...   157   3e-40
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...   163   3e-40
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...   157   3e-40
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...   162   4e-40
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...   162   4e-40
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...   161   4e-40
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...   156   4e-40
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...   162   5e-40
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}             162   5e-40
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...   162   5e-40
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...   162   5e-40
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...   162   5e-40
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...   162   6e-40
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...   161   6e-40
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}              156   7e-40
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...   161   8e-40
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...   161   8e-40
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...   155   1e-39
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   160   1e-39
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...   160   1e-39
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...   153   2e-39
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...   159   2e-39
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...   155   2e-39
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...   159   2e-39
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...   159   2e-39
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...   159   2e-39
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...   159   4e-39
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...   154   4e-39
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...   158   5e-39
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...   152   8e-39
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...   152   1e-38
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...   157   2e-38
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...   152   2e-38
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...   151   2e-38
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...   157   2e-38
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...   156   2e-38
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...   156   3e-38
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...   149   3e-38
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   156   3e-38
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...   149   5e-38
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...   150   5e-38
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...   155   6e-38
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...   155   6e-38
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...   156   6e-38
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...   154   6e-38
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...   147   9e-38
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...   149   1e-37
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...   148   1e-37
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...   155   2e-37
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...   150   2e-37
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...   148   3e-37
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...   147   3e-37
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...   147   3e-37
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...   146   4e-37
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}              147   5e-37
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}              146   6e-37
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...   145   6e-37
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...   147   6e-37
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...   145   8e-37
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...   146   8e-37
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...   145   9e-37
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...   144   9e-37
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...   152   1e-36
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...   144   1e-36
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...   146   1e-36
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...   145   1e-36
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...   152   1e-36
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...   151   1e-36
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...   144   1e-36
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...   145   1e-36
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...   144   1e-36
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141    144   1e-36
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...   145   2e-36
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...   143   2e-36
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...   144   2e-36
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...   145   2e-36
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...   144   3e-36
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...   144   3e-36
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...   143   3e-36
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...   144   3e-36
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}              142   4e-36
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214    142   6e-36
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...   145   6e-36
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...   142   6e-36
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...   144   6e-36
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...   145   7e-36
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...   142   7e-36
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....   148   8e-36
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182      143   8e-36
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...   142   9e-36
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...   142   9e-36
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...   142   9e-36
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...   142   9e-36
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...   145   9e-36
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...   142   1e-35
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...   145   1e-35
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...   143   1e-35
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...   147   3e-35
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...   143   3e-35
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...   148   3e-35
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...   143   4e-35
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...   141   4e-35
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...   140   4e-35
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...   142   6e-35
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...   139   7e-35
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...   140   7e-35
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...   140   8e-35
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...   139   8e-35
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...   142   9e-35
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...   138   1e-34
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...   138   1e-34
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...   139   1e-34
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...   138   1e-34
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...   140   1e-34
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...   138   1e-34
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...   139   1e-34
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...   141   1e-34
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...   139   1e-34
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...   139   2e-34
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...   141   2e-34
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...   142   2e-34
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...   139   2e-34
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...   140   3e-34
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...   140   4e-34
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...   144   4e-34
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...   137   5e-34
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...   144   5e-34
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...   143   6e-34
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...   140   6e-34
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...   144   6e-34
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...   135   9e-34
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...   138   9e-34
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...   143   1e-33
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...   138   1e-33
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...   142   1e-33
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...   142   2e-33
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...   138   2e-33
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...   138   2e-33
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...   134   3e-33
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...   135   3e-33
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...   136   4e-33
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}              138   4e-33
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...   141   5e-33
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...   134   5e-33
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...   140   5e-33
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...   140   6e-33
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...   137   6e-33
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...   140   6e-33
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...   133   6e-33
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...   137   7e-33
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...   136   8e-33
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...   134   8e-33
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...   136   1e-32
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...   133   1e-32
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...   135   1e-32
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...   135   2e-32
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...   136   2e-32
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...   135   2e-32
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...   139   3e-32
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...   138   3e-32
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...   134   5e-32
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...   137   6e-32
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...   137   8e-32
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...   136   8e-32
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...   136   9e-32
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...   132   9e-32
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...   133   9e-32
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...   136   1e-31
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...   133   1e-31
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...   137   1e-31
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....   136   1e-31
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...   133   2e-31
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...   134   2e-31
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...   132   2e-31
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...   135   2e-31
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...   132   3e-31
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...   135   3e-31
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...   135   3e-31
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...   135   3e-31
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...   135   3e-31
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...   135   3e-31
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...   135   3e-31
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...   134   3e-31
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...   135   4e-31
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....   134   4e-31
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...   133   5e-31
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...   134   5e-31
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...   134   5e-31
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...   133   5e-31
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...   134   5e-31
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...   133   6e-31
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...   134   6e-31
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...   129   7e-31
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...   133   7e-31
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...   130   7e-31
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...   133   9e-31
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...   131   9e-31
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...   132   9e-31
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...   134   1e-30
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...   133   1e-30
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...   133   1e-30
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...   129   1e-30
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...   129   1e-30
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...   132   1e-30
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...   132   1e-30
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...   130   1e-30
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...   131   2e-30
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...   132   2e-30
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...   131   2e-30
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...   131   2e-30
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384    132   2e-30
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...   129   2e-30
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...   131   2e-30
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...   132   2e-30
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...   131   2e-30
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...   132   2e-30
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...   132   3e-30
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...   132   3e-30
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...   129   3e-30
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...   130   3e-30
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...   131   3e-30
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...   131   3e-30
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...   132   4e-30
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...   130   4e-30
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...   129   4e-30
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...   130   4e-30
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...   130   4e-30
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...   131   4e-30
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...   131   5e-30
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...   132   5e-30
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...   128   5e-30
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...   132   5e-30
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...   131   5e-30
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...   130   6e-30
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...   130   6e-30
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...   128   6e-30
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...   130   6e-30
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...   130   7e-30
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....   130   7e-30
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...   130   7e-30
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...   131   8e-30
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...   129   8e-30
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...   130   8e-30
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...   127   9e-30
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...   129   1e-29
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...   129   1e-29
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496    130   1e-29
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...   130   1e-29
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...   127   1e-29
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...   129   1e-29
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...   129   1e-29
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...   129   1e-29
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...   127   1e-29
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...   129   1e-29
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...   126   1e-29
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...   128   2e-29
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}             128   2e-29
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...   129   2e-29
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...   129   2e-29
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...   128   2e-29
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...   129   2e-29
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...   130   2e-29
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...   129   2e-29
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...   127   2e-29
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....   129   3e-29
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...   129   3e-29
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...   127   3e-29
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...   129   3e-29
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...   127   3e-29
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...   127   3e-29
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   128   3e-29
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...   127   4e-29
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...   129   4e-29
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...   126   4e-29
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...   127   4e-29
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...   128   4e-29
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...   127   4e-29
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...   127   4e-29
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...   128   4e-29
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...   128   4e-29
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...   126   5e-29
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...   127   5e-29
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...   128   5e-29
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...   127   5e-29
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...   127   5e-29
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)   126   6e-29
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...   124   6e-29
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...   126   6e-29
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...   128   6e-29
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...   125   6e-29
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}              127   7e-29
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...   127   7e-29
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...   128   7e-29
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...   126   7e-29
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...   125   7e-29
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...   124   8e-29
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446    126   9e-29
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...   127   9e-29
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...   126   9e-29
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...   125   1e-28
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....   123   1e-28
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...   127   1e-28
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...   127   1e-28
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...   124   1e-28
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...   126   1e-28
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...   125   1e-28
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...   127   1e-28
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...   125   1e-28
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...   127   1e-28
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...   127   1e-28
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...   126   2e-28
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...   125   2e-28
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...   125   2e-28
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...   126   2e-28
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...   126   2e-28
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...   125   2e-28
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...   126   2e-28
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...   125   2e-28
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...   125   2e-28
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141    125   2e-28
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...   124   2e-28
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....   126   2e-28
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....   124   2e-28
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...   120   3e-28
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...   125   3e-28
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...   121   3e-28
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...   125   3e-28
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...   126   3e-28
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...   125   3e-28
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...   125   4e-28
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...   125   4e-28
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...   125   4e-28
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...   124   4e-28
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...   125   4e-28
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...   124   4e-28
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...   124   5e-28
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...   122   5e-28
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...   121   5e-28
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...   122   5e-28
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...   122   6e-28
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...   121   6e-28
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...   125   6e-28
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...   124   7e-28
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...   121   7e-28
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...   123   7e-28
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...   124   8e-28
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...   124   8e-28
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...   124   9e-28
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...   124   9e-28
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...   124   1e-27
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...   123   1e-27
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...   124   1e-27
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}             122   1e-27
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...   124   1e-27
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...   124   1e-27
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...   123   1e-27
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...   123   1e-27
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...   123   1e-27
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...   123   1e-27
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...   123   1e-27
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...   123   1e-27
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...   121   1e-27
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...   123   1e-27
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...   123   2e-27
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...   122   2e-27
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...   121   2e-27
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...   123   2e-27
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....   123   2e-27
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...   123   2e-27
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...   123   2e-27
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...   119   2e-27
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...   119   2e-27
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...   123   2e-27
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...   122   2e-27
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   122   2e-27
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...   121   2e-27
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...   122   2e-27
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...   121   2e-27
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   122   2e-27
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...   122   2e-27
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...   122   3e-27
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...   119   3e-27
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...   122   3e-27
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...   122   3e-27
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...   121   3e-27
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...   122   3e-27
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...   119   3e-27
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...   118   3e-27
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....   121   3e-27
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...   122   3e-27
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...   121   3e-27
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...   122   4e-27
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...   122   4e-27
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...   117   4e-27
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...   120   4e-27
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341     122   5e-27
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192    116   5e-27
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...   117   5e-27
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...   121   5e-27
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...   122   5e-27
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...   118   5e-27
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...   120   5e-27
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...   120   5e-27
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...   117   5e-27
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...   121   5e-27
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...   114   6e-27
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...   117   6e-27
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...   117   6e-27
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...   122   6e-27
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...   120   6e-27
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...   119   6e-27
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...   121   6e-27
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...   114   6e-27
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...   120   6e-27
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...   120   6e-27
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...   121   6e-27
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...   121   6e-27
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...   121   7e-27
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...   118   7e-27
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...   119   7e-27
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...   119   7e-27
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...   120   7e-27
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....   120   7e-27
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...   120   8e-27
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...   120   8e-27
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...   121   8e-27
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...   120   9e-27
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...   120   9e-27
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...   120   1e-26
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...   117   1e-26
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...   120   1e-26
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...   120   1e-26
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...   120   1e-26
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   120   1e-26
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...   120   1e-26
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...   120   1e-26
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   120   1e-26
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...   120   1e-26
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141    120   1e-26
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....   120   1e-26
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...   120   1e-26
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...   118   1e-26
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   120   1e-26
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....   120   1e-26
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...   117   2e-26
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...   117   2e-26
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...   119   2e-26
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...   119   2e-26
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...   117   2e-26
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....   120   2e-26
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...   116   2e-26
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...   120   2e-26
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...   119   2e-26
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}             119   2e-26
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...   117   2e-26
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...   119   2e-26
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....   119   2e-26
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....   119   2e-26
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...   117   2e-26
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...   117   2e-26
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...   117   2e-26
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...   119   3e-26
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...   119   3e-26
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...   119   3e-26
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...   118   3e-26
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            118   3e-26
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...   115   3e-26
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...   119   3e-26
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...   119   3e-26
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...   119   3e-26
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...   118   3e-26
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...   115   3e-26
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...   119   3e-26
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...   119   3e-26
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...   119   3e-26
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...   118   3e-26
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...   118   3e-26
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...   119   3e-26
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   119   3e-26
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...   116   4e-26
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...   118   4e-26
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...   119   4e-26
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...   117   4e-26
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....   119   4e-26
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...   118   4e-26
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...   114   4e-26
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...   116   4e-26
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...   118   5e-26
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...   117   5e-26
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...   119   5e-26
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   118   5e-26
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...   114   5e-26
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...   114   6e-26
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....   118   6e-26
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...   118   6e-26
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...   118   6e-26
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...   111   6e-26
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...   118   6e-26
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...   111   6e-26
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...   115   6e-26
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...   115   7e-26
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...   116   7e-26
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....   116   7e-26
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....   118   7e-26
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...   117   7e-26
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...   118   7e-26
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...   116   8e-26
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....   117   8e-26
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...   115   8e-26
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...   114   8e-26
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...   111   9e-26
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...   116   9e-26
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...   117   1e-25
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...   115   1e-25
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...   117   1e-25
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...   116   1e-25
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....   117   1e-25
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...   114   1e-25
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...   114   1e-25
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...   116   1e-25
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...   113   1e-25
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...   114   1e-25
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...   117   1e-25
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...   117   1e-25
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...   114   1e-25
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...   117   1e-25
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...   116   1e-25
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....   117   1e-25
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...   115   1e-25
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...   117   1e-25
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...   114   2e-25
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}              115   2e-25
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...   116   2e-25
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...   110   2e-25
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...   116   2e-25
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...   116   2e-25
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...   116   2e-25
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...   115   2e-25
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...   116   2e-25
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...   115   2e-25
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...   113   2e-25
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...   114   3e-25
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...   109   3e-25
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...   109   3e-25
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...   113   3e-25
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...   109   3e-25
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...   113   3e-25
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...   114   3e-25
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...   109   3e-25
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...   114   3e-25
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...   115   3e-25
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...   115   3e-25
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...   115   4e-25
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...   115   4e-25
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....   115   4e-25
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...   112   4e-25
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....   115   4e-25
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...   113   4e-25
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...   111   4e-25
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...   115   5e-25
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...   115   5e-25
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...   114   5e-25
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...   113   5e-25
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...   114   6e-25
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...   113   6e-25
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...   114   6e-25
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...   114   7e-25
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                111   7e-25
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....   114   7e-25
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...   112   8e-25
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...   113   8e-25
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...   112   9e-25
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...   108   9e-25
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...   112   9e-25
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...   114   9e-25
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...   112   1e-24
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...   113   1e-24
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...   114   1e-24
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...   107   1e-24
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...   112   1e-24
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...   113   1e-24
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...   113   1e-24
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...   113   1e-24
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...   113   1e-24
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...   107   1e-24
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...   113   1e-24
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...   112   1e-24
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...   113   2e-24
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...   113   2e-24
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...   107   2e-24
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...   113   2e-24
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...   110   2e-24
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...   112   2e-24
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...   112   2e-24
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...   113   2e-24
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...   110   2e-24
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...   112   2e-24
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...   110   2e-24
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}              111   3e-24
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...   106   3e-24
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...   111   3e-24
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...   109   3e-24
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...   111   3e-24
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...   110   3e-24
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...   112   3e-24
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...   112   4e-24
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...   111   4e-24
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...   108   4e-24
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...   106   4e-24
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...   109   5e-24
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...   111   5e-24
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...   109   5e-24
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...   108   5e-24
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....   111   6e-24
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...   111   6e-24
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...   108   6e-24
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...   110   6e-24
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...   106   7e-24
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...   111   7e-24
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...   105   7e-24
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...   111   7e-24
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...   105   7e-24
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...   111   8e-24
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...   105   8e-24
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...   111   8e-24
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...   110   8e-24
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...   109   8e-24
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...   108   9e-24
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...   110   9e-24
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...   108   9e-24
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...   108   1e-23
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...   111   1e-23
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...   105   1e-23
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...   108   1e-23
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86      110   1e-23
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...   109   1e-23
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...   108   2e-23
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...   108   2e-23
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...   109   2e-23
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...   103   2e-23
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...   109   2e-23
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...   103   2e-23
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...   107   3e-23
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...   107   3e-23
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    108   3e-23
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...   107   3e-23
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...   107   3e-23
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...   103   3e-23
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...   103   3e-23
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...   105   3e-23
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...   109   3e-23
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...   108   3e-23
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...   103   3e-23
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...   107   4e-23
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...   107   4e-23
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...   107   4e-23
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...   107   4e-23
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...   108   4e-23
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...   108   4e-23
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...   107   4e-23
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...   107   4e-23
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...   108   5e-23
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...   108   5e-23
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...   108   5e-23
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...   108   5e-23
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...   106   5e-23
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...   108   5e-23
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...   106   5e-23
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...   108   5e-23
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   108   5e-23
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...   106   5e-23
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   108   5e-23
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...   108   6e-23
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...   102   6e-23
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...   107   6e-23
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...   106   6e-23
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...   107   7e-23
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...   104   7e-23
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...   107   8e-23
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...   105   8e-23
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...   106   8e-23
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...   102   8e-23
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...   104   8e-23
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...   102   9e-23
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...   100   9e-23
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...   102   9e-23
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...   106   9e-23
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...   103   1e-22
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...   107   1e-22
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...   107   1e-22
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...   102   1e-22
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...   107   1e-22
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...   102   1e-22
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...   106   1e-22
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...   107   1e-22
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...   105   1e-22
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}             101   1e-22
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...   106   1e-22
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...   106   1e-22
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...   104   1e-22
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}              105   2e-22
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...   104   2e-22
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   106   2e-22
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...   104   2e-22
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...   104   2e-22
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....   106   2e-22
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...   106   2e-22
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...   106   2e-22
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...   104   2e-22
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...   104   2e-22
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...   100   3e-22
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...   104   3e-22
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...   105   3e-22
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...   102   3e-22
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...   105   3e-22
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...   105   3e-22
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...   105   3e-22
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...   103   3e-22
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...   104   3e-22
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...   104   3e-22
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    99   3e-22
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...   100   3e-22
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...   104   4e-22
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...   103   4e-22
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...   103   4e-22
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...   100   4e-22
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...   105   4e-22
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...   105   4e-22
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192    101   4e-22
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...   101   4e-22
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...   105   4e-22
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...   105   4e-22
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...   103   4e-22
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...   105   4e-22
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...   103   4e-22
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...   100   5e-22
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...   105   5e-22
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....   105   5e-22
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...   102   5e-22
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...   102   5e-22
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...   105   5e-22
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180    105   5e-22
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...   105   5e-22
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...   103   6e-22
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...   103   6e-22
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...   103   6e-22
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...   103   6e-22
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...   103   6e-22
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652    103   6e-22
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   105   6e-22
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   105   6e-22
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...   100   7e-22
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...   100   7e-22
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...   102   7e-22
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...   105   7e-22
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    99   7e-22
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...   105   7e-22
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...   103   8e-22
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...   104   8e-22
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....   102   8e-22
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...   103   8e-22
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...   104   9e-22
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...   103   9e-22
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...   104   9e-22
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...   100   1e-21
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...   103   1e-21
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...   103   1e-21
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...   103   1e-21
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...   102   1e-21
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...   103   1e-21
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...   102   1e-21
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...   101   1e-21
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    97   1e-21
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...   102   1e-21
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...   102   1e-21
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    99   1e-21
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    99   1e-21
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    99   2e-21
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    99   2e-21
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...   101   2e-21
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...   101   2e-21
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...   103   2e-21
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...   103   2e-21
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...   100   2e-21
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...   100   2e-21
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...   103   2e-21
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...   103   2e-21
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...   102   2e-21
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...   102   2e-21
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...   103   2e-21
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...   101   2e-21
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...   102   2e-21
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    98   3e-21
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    98   3e-21
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    99   3e-21
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...   101   3e-21
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...   102   3e-21
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...   100   3e-21
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...   101   3e-21
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...   100   4e-21
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...   100   4e-21
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   102   4e-21
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...   101   4e-21
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...   100   4e-21
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...   100   4e-21
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...   100   4e-21
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...   101   5e-21
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...   100   5e-21
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    96   5e-21
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    99   5e-21
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...   101   5e-21
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...   101   5e-21
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    97   5e-21
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    97   5e-21
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    98   6e-21
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...   101   6e-21
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...   100   6e-21
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...   101   6e-21
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...   100   7e-21
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    97   7e-21
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    98   7e-21
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...   101   7e-21
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     99   8e-21
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...   100   8e-21
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180      101   8e-21
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...   101   8e-21
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...   100   8e-21
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    97   9e-21
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...   100   9e-21
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...   100   9e-21
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    96   9e-21
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...   100   9e-21
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    99   9e-21
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...   100   9e-21
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...   100   1e-20
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...   101   1e-20
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    99   1e-20
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...   100   1e-20
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    99   1e-20
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    99   1e-20
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...   100   1e-20
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    99   1e-20
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...   100   1e-20
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    99   1e-20
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...   100   1e-20
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    99   1e-20
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...   100   1e-20
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...   100   1e-20
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    97   1e-20
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...   100   1e-20
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...   100   2e-20
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    99   2e-20
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    97   2e-20
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...   100   2e-20
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    99   2e-20
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...   100   2e-20
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...   100   2e-20
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...   100   2e-20
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    97   2e-20
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    98   2e-20
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    96   2e-20
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...   100   2e-20
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    99   3e-20
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...   100   3e-20
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    98   3e-20
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    98   3e-20
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    98   3e-20
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    97   3e-20
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    99   3e-20
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...   100   3e-20
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    95   3e-20
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    99   3e-20
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    99   4e-20
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...   100   4e-20
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    98   4e-20
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    97   4e-20
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    97   4e-20
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    99   5e-20
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    98   5e-20
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    99   5e-20
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    97   5e-20
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    99   5e-20
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    99   5e-20
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    95   6e-20
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    97   6e-20
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    98   6e-20
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    97   7e-20
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    97   7e-20
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    97   7e-20
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    97   8e-20
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    94   8e-20
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    94   9e-20
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    97   9e-20
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    98   9e-20
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    99   9e-20
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    97   9e-20
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    97   1e-19
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    94   1e-19
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    96   1e-19
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    94   1e-19
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    94   1e-19
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    98   1e-19
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    93   1e-19
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    97   1e-19
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    96   1e-19
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    97   1e-19
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    98   1e-19
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    98   1e-19
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    97   1e-19
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    96   1e-19
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    96   1e-19
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    97   2e-19
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    94   2e-19
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    96   2e-19
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    96   2e-19
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    97   2e-19
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    97   2e-19
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    97   2e-19
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    94   2e-19
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    96   2e-19
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    96   2e-19
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    97   2e-19
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      96   2e-19
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    97   2e-19
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    95   2e-19
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    95   2e-19
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    93   2e-19
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    96   2e-19
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    97   3e-19
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    93   3e-19
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    94   3e-19
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    96   3e-19
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    96   3e-19
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    96   3e-19
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    94   3e-19
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    94   3e-19
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    94   3e-19
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        95   3e-19
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    93   3e-19
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    96   3e-19
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    95   3e-19
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    95   4e-19
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    96   4e-19
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    96   4e-19
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    95   4e-19
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    95   5e-19
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    96   5e-19
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    91   5e-19
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    91   5e-19
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    95   5e-19
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    95   5e-19
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    95   5e-19
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    96   5e-19
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    95   5e-19
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    94   5e-19
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    94   6e-19
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    92   6e-19
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    94   6e-19
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    94   6e-19
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     94   6e-19
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    94   6e-19
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    94   6e-19
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    94   6e-19
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    96   7e-19
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    95   7e-19
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    92   7e-19
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    93   7e-19
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    94   7e-19
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    94   7e-19
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    93   7e-19
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             95   8e-19
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    94   8e-19
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    92   8e-19
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    94   8e-19
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    95   9e-19
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    92   9e-19
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    94   9e-19
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    94   9e-19
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    93   9e-19
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    94   9e-19
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    91   9e-19
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    94   9e-19
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    92   1e-18
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    95   1e-18
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    93   1e-18
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    94   1e-18
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    95   1e-18
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    91   1e-18
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    93   1e-18
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    94   1e-18
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    94   1e-18
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    95   1e-18
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    93   1e-18
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    93   1e-18
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    92   1e-18
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    94   1e-18
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     94   1e-18
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    91   1e-18
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    94   1e-18
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    95   1e-18
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    92   1e-18
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    91   2e-18
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    91   2e-18
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    94   2e-18
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              94   2e-18
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    92   2e-18
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    91   2e-18
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    94   2e-18
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    92   2e-18
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    92   2e-18
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    93   2e-18
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    92   2e-18
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    94   2e-18
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    93   2e-18
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    93   3e-18
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    92   3e-18
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    93   3e-18
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    94   3e-18
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    92   3e-18
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    92   3e-18
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    92   3e-18
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    93   3e-18
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    93   3e-18
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    89   3e-18
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    90   3e-18
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    92   4e-18
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    92   4e-18
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    92   4e-18
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    92   4e-18
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    91   4e-18
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    91   4e-18
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    92   5e-18
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    92   5e-18
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    92   6e-18
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    92   6e-18
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    91   6e-18
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    92   6e-18
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    92   6e-18
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    92   6e-18
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    91   6e-18
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    92   7e-18
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    89   7e-18
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    91   7e-18
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    92   7e-18
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    89   7e-18
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    91   7e-18
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    90   7e-18
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    89   7e-18
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    89   7e-18
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    91   8e-18
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    91   8e-18
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    89   8e-18
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    91   8e-18
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    90   8e-18
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    91   8e-18
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    91   8e-18
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    91   8e-18
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               91   9e-18
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    91   9e-18
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    89   9e-18
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    90   9e-18
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    92   9e-18
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    91   9e-18
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    91   9e-18
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    91   1e-17
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    89   1e-17
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    91   1e-17
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               91   1e-17
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    90   1e-17
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    90   1e-17
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    91   1e-17
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    90   1e-17
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    89   1e-17
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    91   1e-17
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    90   1e-17
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    91   1e-17
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    90   1e-17
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    91   1e-17
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    89   1e-17
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    89   1e-17
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    90   1e-17
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    91   1e-17
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    89   1e-17
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    89   2e-17
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    91   2e-17
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    90   2e-17
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    89   2e-17
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    90   2e-17
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    90   2e-17
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    90   2e-17
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    89   2e-17
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    89   2e-17
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    90   2e-17
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    91   2e-17
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    91   2e-17
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    89   2e-17
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    90   2e-17
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     88   2e-17
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    90   2e-17
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    87   2e-17
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    89   2e-17
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    90   2e-17
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    91   2e-17
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    90   2e-17
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    89   2e-17
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    89   2e-17
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    90   2e-17
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    89   2e-17
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    91   2e-17
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    89   2e-17
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    89   2e-17
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    89   3e-17
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    90   3e-17
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    90   3e-17
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    89   3e-17
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    87   3e-17
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    89   3e-17
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    87   3e-17
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    88   3e-17
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    89   3e-17
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    87   3e-17
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    90   3e-17
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    89   3e-17
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    88   3e-17
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    88   3e-17
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    89   4e-17
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    89   4e-17
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    87   4e-17
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    87   4e-17
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    90   4e-17
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    87   4e-17
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    88   4e-17
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    87   4e-17
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    87   4e-17
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    86   4e-17
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    88   4e-17
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    89   5e-17
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    88   5e-17
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    86   5e-17
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    89   5e-17
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    84   5e-17
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    86   5e-17
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    89   5e-17
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    88   5e-17
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     88   5e-17
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    88   5e-17
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    88   5e-17
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              87   6e-17
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    87   6e-17
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    86   7e-17
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    88   7e-17
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    88   7e-17
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    87   7e-17
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    87   8e-17
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    88   8e-17
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    87   8e-17
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    86   8e-17
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    88   9e-17
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    88   9e-17
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    86   9e-17
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    88   9e-17
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    88   9e-17
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    87   9e-17
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    88   9e-17
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    86   1e-16
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    87   1e-16
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    87   1e-16
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    87   1e-16
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    86   1e-16
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    88   1e-16
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    87   1e-16
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    86   1e-16
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    87   1e-16
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    87   1e-16
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    87   1e-16
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    87   1e-16
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    87   1e-16
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    88   1e-16
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    86   1e-16
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     85   1e-16
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     85   1e-16
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    86   1e-16
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    87   1e-16
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      87   2e-16
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    86   2e-16
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    85   2e-16
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    87   2e-16
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     87   2e-16
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    86   2e-16
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    87   2e-16
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    87   2e-16
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    87   2e-16
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    86   2e-16
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    86   2e-16
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    84   2e-16
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    86   3e-16
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    86   3e-16
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    85   3e-16
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    84   3e-16
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    83   3e-16
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    85   3e-16
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    86   3e-16
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    84   3e-16
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    86   3e-16
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    85   3e-16
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    87   3e-16
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    85   3e-16
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    86   3e-16
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    85   3e-16
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    86   3e-16
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    85   3e-16
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    84   4e-16
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    85   4e-16
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    84   4e-16
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    84   4e-16
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    84   4e-16
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    86   4e-16
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    86   5e-16
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     86   5e-16
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    85   5e-16
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    86   5e-16
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    84   5e-16
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    84   5e-16
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    86   6e-16
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    84   6e-16
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    85   6e-16
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    85   6e-16
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     85   6e-16
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    85   6e-16
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    84   6e-16
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    84   6e-16
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    84   6e-16
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    86   6e-16
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    86   7e-16
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    85   8e-16
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    83   8e-16
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    83   8e-16
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      85   8e-16
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    85   8e-16
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    85   8e-16
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    85   9e-16
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    83   9e-16
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              85   1e-15
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    85   1e-15
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    82   1e-15
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    84   1e-15
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    82   1e-15
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      84   1e-15
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    85   1e-15
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    84   1e-15
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    84   1e-15
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    82   1e-15
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    84   1e-15
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    82   1e-15
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    83   1e-15
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    85   1e-15
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    82   1e-15
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    84   1e-15
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    82   1e-15
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    82   1e-15
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    84   1e-15
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    84   1e-15
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    82   1e-15
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    83   1e-15
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    82   1e-15
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    84   2e-15
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    84   2e-15
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    84   2e-15
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    82   2e-15
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    82   2e-15
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    82   2e-15
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    83   2e-15
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    81   2e-15
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    82   2e-15
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    82   2e-15
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    82   2e-15
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    82   2e-15
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    84   2e-15
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    84   2e-15
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    84   2e-15
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    83   3e-15
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    83   3e-15
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    81   3e-15
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    82   3e-15
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    82   3e-15
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    82   3e-15
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    81   3e-15
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    82   3e-15
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    81   3e-15
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    82   3e-15
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    83   4e-15
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    83   4e-15
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    81   4e-15
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    81   4e-15
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    82   4e-15
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    81   4e-15
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    80   4e-15
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    82   4e-15
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    82   4e-15
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    80   4e-15
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     82   5e-15
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    81   6e-15
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    81   6e-15
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    82   6e-15
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    80   6e-15
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    82   6e-15
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    81   8e-15
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    82   8e-15
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    82   9e-15
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    82   9e-15
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    80   9e-15
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    81   9e-15
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    80   9e-15
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    79   1e-14
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    81   1e-14
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    79   1e-14
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    80   1e-14
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    80   1e-14
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    80   1e-14
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    79   1e-14
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    80   1e-14
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    79   1e-14
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    81   1e-14
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              80   1e-14
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    80   1e-14
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    80   1e-14
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    80   1e-14
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    80   2e-14
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    80   2e-14
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    79   2e-14
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    78   2e-14
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    80   2e-14
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    80   2e-14
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    80   2e-14
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    78   2e-14
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    77   2e-14
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    80   2e-14
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    80   2e-14
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    80   3e-14
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    80   3e-14
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    80   3e-14
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    78   3e-14
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    79   3e-14
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    80   3e-14
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    79   3e-14
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    78   3e-14
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    80   3e-14
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    80   4e-14
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    79   4e-14
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    79   4e-14
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    80   4e-14
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    79   4e-14
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    79   4e-14
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    79   5e-14
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    77   5e-14
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    79   5e-14
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    79   5e-14
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     79   5e-14
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    79   5e-14
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    79   6e-14
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    78   6e-14
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    79   6e-14
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    79   6e-14
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               79   6e-14
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    79   6e-14
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    77   6e-14
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    79   6e-14
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    79   6e-14
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    79   6e-14
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    79   7e-14
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    79   7e-14
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    77   7e-14
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    77   7e-14
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    79   7e-14
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      79   7e-14
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    76   7e-14
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    79   7e-14
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    76   8e-14
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    78   8e-14
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    77   8e-14
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    78   8e-14
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    78   8e-14
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    78   9e-14
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    78   9e-14
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    78   9e-14
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    79   1e-13
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    78   1e-13
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    77   1e-13
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    76   1e-13
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    76   1e-13
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    77   1e-13
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    78   1e-13
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    76   1e-13
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    78   1e-13
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    78   1e-13
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    76   1e-13
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    75   1e-13
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    77   2e-13
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    76   2e-13
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    77   2e-13
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    77   2e-13
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    75   2e-13
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    77   2e-13
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    77   2e-13
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    77   2e-13
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    77   2e-13
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    77   2e-13
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    77   2e-13
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    75   2e-13
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    77   2e-13
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    77   2e-13
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    77   3e-13
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    76   3e-13
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    77   3e-13
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    76   3e-13
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    76   3e-13
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    74   3e-13
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    76   3e-13
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    76   3e-13
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    75   3e-13
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    75   3e-13
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               75   3e-13
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    77   3e-13
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    77   3e-13
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    75   4e-13
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    75   4e-13
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    75   4e-13
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    75   5e-13
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    76   5e-13
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    76   5e-13
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    75   5e-13
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    75   5e-13
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    74   6e-13
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    74   6e-13
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    74   6e-13
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    75   6e-13
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    75   7e-13
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    75   7e-13
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    75   8e-13
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    75   8e-13
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    75   9e-13
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    75   9e-13
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    75   9e-13
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    75   1e-12
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    75   1e-12
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    75   1e-12
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    73   1e-12
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    73   1e-12
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    74   1e-12
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    75   1e-12
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    75   1e-12
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    74   1e-12
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    75   1e-12
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    74   2e-12
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    74   2e-12
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    74   2e-12
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    74   2e-12
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    74   2e-12
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    73   2e-12
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    74   2e-12
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    74   2e-12
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    72   2e-12
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    74   3e-12
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    74   3e-12
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    74   3e-12
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    73   3e-12
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    73   3e-12
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    73   3e-12
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    73   4e-12
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             72   4e-12
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    72   4e-12
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    73   4e-12
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    73   4e-12
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    72   5e-12
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    73   5e-12
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    71   5e-12
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    72   6e-12
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    73   6e-12
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    71   8e-12
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     72   8e-12
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    72   9e-12
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    71   9e-12
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    70   9e-12
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    72   9e-12
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    72   1e-11
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    72   1e-11
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    72   1e-11
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    71   1e-11
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    70   1e-11
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    71   1e-11
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    71   1e-11
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    71   2e-11
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    71   2e-11
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    69   2e-11
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    71   2e-11
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     70   2e-11
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    70   2e-11
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    70   2e-11
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    70   2e-11
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    70   2e-11
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    70   3e-11
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    70   3e-11
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    70   3e-11
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    69   3e-11
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    70   3e-11
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    70   3e-11
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    70   3e-11
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    70   3e-11
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    70   3e-11
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       70   4e-11
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    70   4e-11
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    69   6e-11
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    69   6e-11
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               69   7e-11
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     69   7e-11
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    69   7e-11
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    68   7e-11
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    69   9e-11
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    69   9e-11
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    69   1e-10
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    68   1e-10
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    69   1e-10
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    68   1e-10
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    68   1e-10
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    68   1e-10
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    68   1e-10
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               67   1e-10
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    67   1e-10
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    68   1e-10
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    68   1e-10
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    68   1e-10
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    68   2e-10
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    66   2e-10
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    67   2e-10
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    67   2e-10
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    67   2e-10
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    67   2e-10
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    67   2e-10
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    67   2e-10
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    67   2e-10
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    67   3e-10
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    67   3e-10
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    66   3e-10
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    67   3e-10
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    66   3e-10
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    67   3e-10
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    67   3e-10
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    67   3e-10
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    67   3e-10
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    67   4e-10
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    66   4e-10
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    66   4e-10
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    66   4e-10
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    67   4e-10
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    66   4e-10
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    66   4e-10
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    66   5e-10
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    65   5e-10
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    65   5e-10
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    65   5e-10
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    65   5e-10
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    66   6e-10
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    65   6e-10
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    65   6e-10
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    66   6e-10
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    66   7e-10
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    65   8e-10
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    65   9e-10
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    65   1e-09
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    64   1e-09
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    64   1e-09
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    64   1e-09
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    65   1e-09
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    65   1e-09
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    64   1e-09
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    64   1e-09
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    64   1e-09
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    64   2e-09
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    64   2e-09
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    64   2e-09
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               64   2e-09
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    64   2e-09
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    64   2e-09
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    64   2e-09
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    63   2e-09
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    64   3e-09
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    64   3e-09
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    64   3e-09
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    63   3e-09
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    63   3e-09
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    63   4e-09
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    63   4e-09
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    62   4e-09
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    63   4e-09
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    63   4e-09
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    62   5e-09
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    63   5e-09
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    63   5e-09
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    62   7e-09
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    62   7e-09
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    62   7e-09
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    62   7e-09
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    62   8e-09
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    62   8e-09
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    62   8e-09
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    62   8e-09
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    61   9e-09
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    62   1e-08
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    61   1e-08
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    62   1e-08
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    60   1e-08
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    61   1e-08
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    60   1e-08
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    61   1e-08
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    61   1e-08
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    61   2e-08
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    61   2e-08
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    61   2e-08
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    60   2e-08
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    60   2e-08
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    60   2e-08
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    60   2e-08
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    61   3e-08
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    60   3e-08
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    60   3e-08
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    60   3e-08
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    60   3e-08
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    60   3e-08
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    60   3e-08
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    60   3e-08
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    60   3e-08
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    59   3e-08
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    60   4e-08
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    60   4e-08
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    59   4e-08
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    60   4e-08
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    59   5e-08
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    59   5e-08
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    59   5e-08
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    59   5e-08
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    59   6e-08
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    59   6e-08
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    59   6e-08
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    58   6e-08
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    58   7e-08
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    59   7e-08
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    59   7e-08
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    58   8e-08
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    59   8e-08
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    59   1e-07
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    59   1e-07
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    59   1e-07
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    58   1e-07
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    58   1e-07
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    58   1e-07
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    58   1e-07
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    58   1e-07
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    58   2e-07
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    58   2e-07
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    57   2e-07
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    57   2e-07
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    57   3e-07
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    56   3e-07
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    56   3e-07
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    56   4e-07
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               57   4e-07
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...    57   4e-07
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    56   4e-07
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    55   4e-07
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    57   4e-07
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    56   5e-07
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    55   5e-07
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    56   7e-07
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    55   7e-07
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    55   8e-07
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    55   8e-07
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    55   9e-07
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    55   1e-06
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    55   1e-06
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    55   1e-06
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    54   1e-06
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    55   1e-06
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    54   2e-06
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    54   2e-06
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    54   2e-06
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    54   2e-06
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    53   3e-06
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    54   3e-06
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    54   3e-06
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    53   5e-06
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    53   6e-06
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    53   7e-06
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    52   9e-06
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    52   9e-06
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    52   1e-05
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    51   1e-05
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    52   1e-05
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    50   2e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    50   2e-05
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    51   2e-05
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    51   3e-05
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    51   3e-05
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     50   3e-05
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    50   3e-05
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    50   4e-05
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    50   5e-05
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    49   6e-05
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    49   8e-05
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    49   8e-05
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    49   9e-05
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    48   1e-04
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    48   1e-04
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    48   1e-04
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    49   1e-04
KNAG0A07560 Chr1 (1186540..1187550) [1011 bp, 336 aa] {ON} Anc_3...    48   1e-04
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    49   1e-04
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    47   2e-04
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    46   2e-04
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    48   2e-04
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    47   2e-04
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    47   3e-04
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    47   3e-04
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    47   3e-04
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    47   4e-04
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    46   5e-04
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    46   5e-04
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    47   6e-04
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    47   6e-04
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    46   6e-04
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    46   7e-04
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    46   9e-04
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    45   0.001
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    45   0.002
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    45   0.002
Kwal_26.6921 s26 (123345..123875) [531 bp, 176 aa] {OFF} YOR351C...    42   0.002
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    45   0.002
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    45   0.002
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    44   0.003
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    44   0.003
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    44   0.004
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    43   0.004
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    43   0.004
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    43   0.007
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     42   0.008
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    42   0.010
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    42   0.010
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    42   0.011
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.012
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     42   0.012
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    42   0.014
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    42   0.015
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    41   0.016
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    41   0.016
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    41   0.019
CAGL0H03245g Chr8 (303335..305686) [2352 bp, 783 aa] {ON} simila...    41   0.019
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    41   0.021
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    41   0.022
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    41   0.027
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    41   0.027
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    40   0.029
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    41   0.029
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    41   0.032
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    40   0.033
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.036
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    40   0.036
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    40   0.037
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    40   0.039
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    40   0.045
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    40   0.050
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    40   0.051
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    40   0.053
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    40   0.054
Smik_7.269 Chr7 (446854..449094) [2241 bp, 746 aa] {ON} YGL021W ...    40   0.063
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    39   0.063
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    39   0.065
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    39   0.068
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    39   0.073
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    39   0.073
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    39   0.075
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    39   0.078
Suva_7.258 Chr7 (445704..447911) [2208 bp, 735 aa] {ON} YGL021W ...    39   0.079
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    39   0.083
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    39   0.091
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    39   0.10 
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    39   0.11 
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    39   0.11 
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    39   0.11 
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    39   0.13 
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    39   0.14 
Kwal_56.23723 s56 complement(676986..677432) [447 bp, 149 aa] {O...    37   0.14 
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    39   0.14 
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    38   0.15 
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    38   0.15 
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    39   0.15 
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    38   0.16 
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    38   0.16 
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    38   0.16 
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    38   0.17 
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    39   0.17 
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    38   0.17 
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    38   0.17 
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    38   0.18 
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    38   0.19 
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    38   0.19 
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    38   0.20 
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    38   0.21 
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    38   0.22 
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    38   0.23 
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    37   0.25 
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    37   0.26 
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    37   0.26 
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    37   0.27 
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    37   0.27 
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    37   0.30 
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    37   0.30 
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    37   0.31 
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    37   0.32 
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    37   0.35 
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    37   0.35 
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    37   0.36 
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    37   0.37 
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    37   0.42 
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    37   0.43 
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    37   0.43 
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    37   0.46 
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    37   0.49 
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     37   0.49 
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    37   0.54 
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    37   0.56 
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    36   0.59 
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    37   0.60 
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    36   0.60 
Skud_7.199 Chr7 (356300..358714) [2415 bp, 804 aa] {ON} YGL083W ...    37   0.63 
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    36   0.63 
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     36   0.69 
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    36   0.73 
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    36   0.75 
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    36   0.76 
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    36   0.87 
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    36   0.99 
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    35   1.1  
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    35   1.2  
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    35   1.2  
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    35   1.3  
KNAG0F02100 Chr6 complement(399443..401944) [2502 bp, 833 aa] {O...    35   1.4  
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    35   1.4  
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    35   1.5  
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    35   1.7  
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    35   1.8  
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    35   2.2  
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    34   2.7  
SAKL0B09350g Chr2 (793524..794798) [1275 bp, 424 aa] {ON} weakly...    34   2.8  
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    34   3.5  
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    33   4.6  
CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some si...    33   4.7  
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    33   4.8  
KLLA0E19207g Chr5 (1709335..1711638) [2304 bp, 767 aa] {ON} simi...    33   4.8  
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    33   4.9  
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    33   6.3  
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    33   8.6  

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_1.52
            YDR507C
          Length = 1391

 Score = 2523 bits (6540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1254/1391 (90%), Positives = 1254/1391 (90%)

Query: 1    MVKLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXX 60
            MVKLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVF    
Sbjct: 1    MVKLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFNNDN 60

Query: 61   XXXXXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFN 120
                   LLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFN
Sbjct: 61   ANASDSALLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFN 120

Query: 121  LLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
            LLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL
Sbjct: 121  LLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 181  ETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRN 240
            ETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRN
Sbjct: 181  ETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRN 240

Query: 241  LLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKT 300
            LLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKT
Sbjct: 241  LLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKT 300

Query: 301  IRNLPREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLY 360
            IRNLPREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLY
Sbjct: 301  IRNLPREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLY 360

Query: 361  ALLDRFKNDTEKEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGALVNTPTKRKNRA 420
            ALLDRFKNDTEKEI               THSHSNSNTSAYSHVSRGALVNTPTKRKNRA
Sbjct: 361  ALLDRFKNDTEKEIKRQSQLKKRQSQVQQTHSHSNSNTSAYSHVSRGALVNTPTKRKNRA 420

Query: 421  SMVSVSSAHKRPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSIN 480
            SMVSVSSAHKRPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSIN
Sbjct: 421  SMVSVSSAHKRPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSIN 480

Query: 481  LSSNKRISQLLANDLNTSPTPSNCTKRMSIINGTPPVPMDIMKNYNDANMAXXXXXXXXX 540
            LSSNKRISQLLANDLNTSPTPSNCTKRMSIINGTPPVPMDIMKNYNDANMA         
Sbjct: 481  LSSNKRISQLLANDLNTSPTPSNCTKRMSIINGTPPVPMDIMKNYNDANMATTVSSSTTV 540

Query: 541  XXXNPISTLNNMPHXXXXXXXXXXXXXXXXXXXXSVINTKYTNPANSTQISTNGQTSDSA 600
               NPISTLNNMPH                    SVINTKYTNPANSTQISTNGQTSDSA
Sbjct: 541  TTSNPISTLNNMPHTRYTNDTNTNLTDINNNKRNSVINTKYTNPANSTQISTNGQTSDSA 600

Query: 601  AQNVNRASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLI 660
            AQNVNRASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLI
Sbjct: 601  AQNVNRASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLI 660

Query: 661  DNIFEHEKYEQIRKEKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 720
            DNIFEHEKYEQIRKEKD                                           
Sbjct: 661  DNIFEHEKYEQIRKEKDELERKVRENKKREEEERLVREAIEKEKQIELEKERLQLQKEME 720

Query: 721  GDIDNAKETVQTTEGKREAHNDKIKTETDDEERDIIVDIQPRSVSAPLEKTEKSRDSPFD 780
            GDIDNAKETVQTTEGKREAHNDKIKTETDDEERDIIVDIQPRSVSAPLEKTEKSRDSPFD
Sbjct: 721  GDIDNAKETVQTTEGKREAHNDKIKTETDDEERDIIVDIQPRSVSAPLEKTEKSRDSPFD 780

Query: 781  YSKQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHSTEDLHSTSSLNRIDTQKVILETI 840
            YSKQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHSTEDLHSTSSLNRIDTQKVILETI
Sbjct: 781  YSKQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHSTEDLHSTSSLNRIDTQKVILETI 840

Query: 841  RRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAFQDSHLEEMNDVTEDLSQHNVDTSNDRIV 900
            RRSKFLGSSFD            SNRIKQQAFQDSHLEEMNDVTEDLSQHNVDTSNDRIV
Sbjct: 841  RRSKFLGSSFDLKKELEMVEELESNRIKQQAFQDSHLEEMNDVTEDLSQHNVDTSNDRIV 900

Query: 901  STTNDRYETEILPKSHAGKTQTIGLNDSSVQPRTLSEIKVPQFTRKSKFFSESNKRLSVL 960
            STTNDRYETEILPKSHAGKTQTIGLNDSSVQPRTLSEIKVPQFTRKSKFFSESNKRLSVL
Sbjct: 901  STTNDRYETEILPKSHAGKTQTIGLNDSSVQPRTLSEIKVPQFTRKSKFFSESNKRLSVL 960

Query: 961  SLYSSRESFTNLVDMLKEDGINVEPTERSPTTKSQEPEFLFESPSVDTYSRDSSTEDKPI 1020
            SLYSSRESFTNLVDMLKEDGINVEPTERSPTTKSQEPEFLFESPSVDTYSRDSSTEDKPI
Sbjct: 961  SLYSSRESFTNLVDMLKEDGINVEPTERSPTTKSQEPEFLFESPSVDTYSRDSSTEDKPI 1020

Query: 1021 NEKENSEPIQSNNLRLSFHDRFNRQLSTEDTEKTKNSPSGHIKDEPKKDDDNGVDLSTPK 1080
            NEKENSEPIQSNNLRLSFHDRFNRQLSTEDTEKTKNSPSGHIKDEPKKDDDNGVDLSTPK
Sbjct: 1021 NEKENSEPIQSNNLRLSFHDRFNRQLSTEDTEKTKNSPSGHIKDEPKKDDDNGVDLSTPK 1080

Query: 1081 AKDESNLVKLPALPPLTTKKTDGLGIYQKSKQRTSSNASNPITPSSTNAQLTSAAVNVTP 1140
            AKDESNLVKLPALPPLTTKKTDGLGIYQKSKQRTSSNASNPITPSSTNAQLTSAAVNVTP
Sbjct: 1081 AKDESNLVKLPALPPLTTKKTDGLGIYQKSKQRTSSNASNPITPSSTNAQLTSAAVNVTP 1140

Query: 1141 PTTTMINESIQKLQESREKVNNSSKLIPPKNSEIISQQNESVQIRDDYKTKPERSNKADQ 1200
            PTTTMINESIQKLQESREKVNNSSKLIPPKNSEIISQQNESVQIRDDYKTKPERSNKADQ
Sbjct: 1141 PTTTMINESIQKLQESREKVNNSSKLIPPKNSEIISQQNESVQIRDDYKTKPERSNKADQ 1200

Query: 1201 SERAPPAETTLNDVMTKRNQSKSRDNPQPSEEGKKGVXXXXXXXXXXXXXXXXXXXXXXX 1260
            SERAPPAETTLNDVMTKRNQSKSRDNPQPSEEGKKGV                       
Sbjct: 1201 SERAPPAETTLNDVMTKRNQSKSRDNPQPSEEGKKGVNSFFRKFSKGSSRQSSNSSNKNK 1260

Query: 1261 XLADDKNIPSVPKPVAHPASPVSTSNDYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNI 1320
             LADDKNIPSVPKPVAHPASPVSTSNDYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNI
Sbjct: 1261 SLADDKNIPSVPKPVAHPASPVSTSNDYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNI 1320

Query: 1321 KSSPESLRFTGKVSSENILSFKSTVFELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVE 1380
            KSSPESLRFTGKVSSENILSFKSTVFELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVE
Sbjct: 1321 KSSPESLRFTGKVSSENILSFKSTVFELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVE 1380

Query: 1381 NVLRKEGVLLK 1391
            NVLRKEGVLLK
Sbjct: 1381 NVLRKEGVLLK 1391

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/532 (68%), Positives = 414/532 (77%), Gaps = 37/532 (6%)

Query: 5   TNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXX 64
           +NK ++ VKG+T+GPWKLGETLGLGSTGKVQLAYN ST QQAAIKVISK+VF        
Sbjct: 4   SNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVISKSVFSSMGNNSS 63

Query: 65  XXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVE 124
                TPDSL YGIEREIIIMKLLNHPNVLRLYDVWET++NLYMVLEYAEKGELFNLLVE
Sbjct: 64  MVSS-TPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVE 122

Query: 125 RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETED 184
           +GPLPENEAIRFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAALETED
Sbjct: 123 KGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETED 182

Query: 185 KLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK 244
           KLLETSCGSPHYAAPEI+SGLPYHGLETDVWSCG+ILFALLTGRLPFDEEDGNIRNLLLK
Sbjct: 183 KLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 242

Query: 245 VQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNL 304
           VQ G+FEMPG+DEIS+EAQDL+ KIL VDP+KRIK+REILKHPL+QKYPSIKDSKTIRNL
Sbjct: 243 VQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNL 302

Query: 305 PREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLD 364
           PREDTYLNPL  ++G    ID  ILQNLVVLWHGR+  +I KKL+EPGANAEKTLYALL 
Sbjct: 303 PREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLY 362

Query: 365 RFKNDTEKEIXXXXXXXXXXXXXXXTHSHS-NSNTSAYSHVSRGALVNTPTKRKNRASMV 423
           RFK D+E+E                 +  S N NT+            TP K+KNR S++
Sbjct: 363 RFKVDSEQEALKNSQIKKRQSIISNNNLKSGNINTT------------TPQKKKNRNSVI 410

Query: 424 SVSSAHKRPVSFNRLSRADLSNHVIN--TGINGTPQRHSQIESSGTLQRNSSSKRMSINL 481
           SVSS+HKRPVS NRLS       VI+  +  N TP                SSKR+S++L
Sbjct: 411 SVSSSHKRPVSLNRLSTIQNGKDVISVPSSSNTTP---------------GSSKRISMSL 455

Query: 482 SSNKRISQLLANDLNTSPTPSNCTKRMSIIN-----GTPPVPMDIMKNYNDA 528
           SSNK  S++L    + SPTP+   KRMS+ N       PP+P+D++K+Y ++
Sbjct: 456 SSNKG-SKILPQSNSGSPTPAPRNKRMSVQNLETSSNPPPIPVDMLKDYGNS 506

 Score =  189 bits (480), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 147/384 (38%), Positives = 211/384 (54%), Gaps = 73/384 (19%)

Query: 743  KIKTETDDEERDIIVDIQPRSVSAPLEKTEKSRDSPFDYSKQRNFSLRTRPVSRLDPGLM 802
            +++ +T + + D +V    RS+S+P+E   +++ S  D S QR+FSL+TRPVS+LDPG+ 
Sbjct: 634  ELQQDTKNFQEDEVVHKNVRSISSPVENGNEAK-SEEDASGQRSFSLQTRPVSKLDPGIK 692

Query: 803  YSSGTGSSAYNPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDXXXXXXXXXXX 862
              S       N     E++        ID+QKVILETIRRSKFLGSSF+           
Sbjct: 693  CGS-------NKPVQMEEIVEDELDKTIDSQKVILETIRRSKFLGSSFNI---------- 735

Query: 863  XSNRIKQQAFQDSHLEEMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQT 922
              ++  +Q  +D+ ++ M       SQ      + RIVS TN++YET++LPK+    T  
Sbjct: 736  --DKELKQVKKDAEVKRMRK-----SQKEDRDVSGRIVSETNEQYETQVLPKNA---TAF 785

Query: 923  IGLNDSS--VQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDG 980
              L D S  V+PR +S+I+VPQFTRKSK F++SNKRLSVLS+YSS +S+TNL ++LKE G
Sbjct: 786  GALKDDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLANVLKEGG 845

Query: 981  INVEPTERSPTTK-SQEPEFLFESPSVDTYSRDSSTEDKPINEKENSEPIQSNNLRLSFH 1039
            +++   E S   + S+EPEF FE+   +  +     E +  NE   S   Q  N++L++ 
Sbjct: 846  VDIGVNEGSNNVEVSEEPEFQFETVGTEIENNKYEEEKEIENENNLS---QGANIKLNYA 902

Query: 1040 DRFNRQLSTEDTEKTKNSPSGHIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPLTTK 1099
            DRF       DT       +G++                       N VKLP LPPL   
Sbjct: 903  DRF-------DT-------AGNV-----------------------NEVKLPTLPPLGDD 925

Query: 1100 K-TDGLGIYQKSKQRTSSNASNPI 1122
            K +DGLGIY  SK  +  N S P+
Sbjct: 926  KVSDGLGIYS-SKSGSEGNESKPV 948

 Score =  129 bits (325), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/81 (77%), Positives = 70/81 (86%)

Query: 597 SDSAAQNVNRASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNF 656
           S S+  N  RASR  KR SV PN +RGSITTK+ISTYA+L+EDDDWEFIEKETKRVSS+F
Sbjct: 506 STSSHANAKRASRISKRLSVLPNAKRGSITTKIISTYAKLSEDDDWEFIEKETKRVSSDF 565

Query: 657 ATLIDNIFEHEKYEQIRKEKD 677
           ATLID IFEHEKYEQIRKEK+
Sbjct: 566 ATLIDEIFEHEKYEQIRKEKE 586

 Score =  102 bits (253), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 73/104 (70%), Gaps = 1/104 (0%)

Query: 1288 YDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFE 1347
            YD +L +NV+  Q++ GL  L +GW  YGLK IKS+ E+   + ++SS+NILS +ST  +
Sbjct: 1021 YDVKLFSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVD 1080

Query: 1348 LEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLLK 1391
            + + S   K  ++ F+K SGSSK+++RL +EVE VLRKEGVL K
Sbjct: 1081 MVVFSEG-KHSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVLAK 1123

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/541 (66%), Positives = 419/541 (77%), Gaps = 52/541 (9%)

Query: 1   MVKLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXX 60
           M  ++N+    VKGN +GPWKLGETLGLGSTGKVQLAY+ ST QQAAIKVISKA+F    
Sbjct: 1   MAAMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKG 60

Query: 61  XXXXXXXLL-TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119
                     TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWET+SNLYMVLEYA+KGELF
Sbjct: 61  SVKDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELF 120

Query: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           NLLVERGPLPE EAIRFFRQI+IGISYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAA
Sbjct: 121 NLLVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAA 180

Query: 180 LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIR 239
           LETEDKLLETSCGSPHYAAPEI+SG+PYHG  +DVWSCG+ILFALLTGRLPFD+EDGNIR
Sbjct: 181 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIR 240

Query: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSK 299
           NLLL+VQSG++EMPG+DEIS +AQDLI++ILTVDP++RIK R+ILKHPL+QKYPSI DSK
Sbjct: 241 NLLLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSK 300

Query: 300 TIRNLPREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTL 359
           +IRNLPREDTYL+PLS+  G+  EID  ILQNLVVLWHGR+  EI  KL+EPGANAEKTL
Sbjct: 301 SIRNLPREDTYLHPLSE--GESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTL 358

Query: 360 YALLDRFKNDTEKEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGALVNTPT----- 414
           YALLDRFK+DTE +                 H  S    S  + V +      P+     
Sbjct: 359 YALLDRFKSDTEND--------------SVKHPQSKKRVSQINPVRQPTTKKAPSKPQTN 404

Query: 415 ---KRKNRASMVSVSSAHKRPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRN 471
              KR+NR SM+SVSS+HKRPVSFN+LS      +V++ G    P  +S          N
Sbjct: 405 ASPKRRNRTSMISVSSSHKRPVSFNKLS------NVVSPG--SVPSSNS----------N 446

Query: 472 SSSKRMSINLSSNKRISQLLANDLNTSPTPSNCTKRMSII-------NGTPPVPMDIMKN 524
           + SKR+S+NLSSNKR+S +  N  + SPTP++  KR+SI+       N TPPVP++++K+
Sbjct: 447 TPSKRVSVNLSSNKRLSAVYTN--SGSPTPASRHKRVSIVDLERERENDTPPVPIEMLKD 504

Query: 525 Y 525
           Y
Sbjct: 505 Y 505

 Score =  280 bits (716), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 197/520 (37%), Positives = 262/520 (50%), Gaps = 90/520 (17%)

Query: 606  RASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFE 665
            R SR+  R S +P+ +RGSITTKLISTYA+L+EDDDWE+IEKETKR SS+FATL D IFE
Sbjct: 513  RLSRNNMRLSFKPSNKRGSITTKLISTYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFE 572

Query: 666  HEKYEQIRKEKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDIDN 725
            HEK+EQIR+EK+                                            D++ 
Sbjct: 573  HEKFEQIRREKEELERKVRETKEREERERREKEIEEKRKIQEKQ------------DLER 620

Query: 726  AKETVQTTEGKREAHNDK-----IKTETDDEERDIIVDIQPRSVSAPLEKTEKSRDSPFD 780
             +  +Q    +  A+  K     +  + D +E D    +  RSVS PL+K  KS D   D
Sbjct: 621  RQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEHGAVNGRSVSEPLQK--KSADPMAD 678

Query: 781  YS-------KQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHSTEDLHSTSSLNRIDTQ 833
                     +QR FSL+TRPVSRLDPG+  S  +    Y  S             +++  
Sbjct: 679  LQANIDDLLRQRTFSLQTRPVSRLDPGVFSSDSSEKDQYTGSEDRA---------KLNND 729

Query: 834  KVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAFQDSHLEEMNDVTEDLSQHNVD 893
            K+ILETIRRSKFLGSSFD                      +  L+   D  E   Q    
Sbjct: 730  KIILETIRRSKFLGSSFDI---------------------NKELKRAAD-NEAKKQRQSK 767

Query: 894  TSNDRIVSTTNDRYETEILPKSHAGKTQTIGLNDSSVQPRTLSEIKVPQFTRKSKFFSES 953
             ++DRI+STTND YET+ILPK +A  +  +  ++   +PR +S+IKVPQFTRKS+ F +S
Sbjct: 768  ATSDRIISTTNDEYETQILPK-NATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGDS 826

Query: 954  NKRLSVLSLYSSRESFTNLVDMLKEDGINVEPTERSPTTKS-QEPEFLFESPSVDTYSRD 1012
            NKRLSVLS+YSS++S+TNL D+L E+  N +    SP  +S  EPEFLFE+   D     
Sbjct: 827  NKRLSVLSMYSSKQSYTNLADLLNEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTG 886

Query: 1013 SSTEDKPINEKENSEPIQSNNLRLSFHDRFNRQLSTEDTEKTKNSPSGHIKDEPKKDDDN 1072
             S+ D  + E      +    L+L+F DRF      + T + KN                
Sbjct: 887  DSSHDGRLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDKN---------------- 930

Query: 1073 GVDLSTPKAKDESNLVKLPALPPLTTKKTDGLGIYQKSKQ 1112
                           V+LP LPPL  K+  GLGIYQ S +
Sbjct: 931  ---------------VRLPTLPPLDGKEAKGLGIYQSSSE 955

 Score =  117 bits (293), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 57/108 (52%), Positives = 80/108 (74%), Gaps = 1/108 (0%)

Query: 1284 TSNDYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKS 1343
            T+ ++D +L A+VAA Q+F GL  L +GW KYGLK +KS P+ L  TGK+SSENILS +S
Sbjct: 1044 TNGEFDAELYASVAAKQLFNGLQNLLQGWKKYGLKGVKSMPDKLTLTGKLSSENILSLRS 1103

Query: 1344 TVFELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLLK 1391
            T+FE+ + S   K  ++ F+K SGS+K+++RLV+E+E VL KE VL K
Sbjct: 1104 TLFEMVVWSRG-KGSIVGFRKKSGSTKTLKRLVSEIEKVLLKERVLTK 1150

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/525 (67%), Positives = 411/525 (78%), Gaps = 41/525 (7%)

Query: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLL-T 70
           +KG+T+GPWKLGETLGLGSTGKVQLA+N +T QQAAIK+ISK++F           +  T
Sbjct: 14  IKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANT 73

Query: 71  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPE 130
           PDSLPYGIEREIIIMKLL H NVL LYDVWET+SNLYM+LEYAEKGELFNLLVE+GPLPE
Sbjct: 74  PDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPE 133

Query: 131 NEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETS 190
            EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALETEDKLLETS
Sbjct: 134 KEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETS 193

Query: 191 CGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQF 250
           CGSPHYAAPEI+SG+PYHG E+DVWSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQSGQF
Sbjct: 194 CGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQF 253

Query: 251 EMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTY 310
           EMP +DE+SR+AQDLIS+ILTVDP KRIKTREILKHPL+QKYPSIKDSK+I+NLPREDTY
Sbjct: 254 EMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPREDTY 313

Query: 311 LNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDT 370
           L PLSD+N     IDP ILQNLVVLWHGRD ++I  KLKE GANAEKT+YALL RFK   
Sbjct: 314 LFPLSDNN---SVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFK--I 368

Query: 371 EKEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSAHK 430
           E E                  S +N              V+TP ++KNR S +SVSS+ K
Sbjct: 369 EAENLSAKQEQVKRKQSIIKKSTAN--------------VSTPPRKKNRISTMSVSSSRK 414

Query: 431 RPVSFNRLSRAD--LSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSSNKRIS 488
           RPVSFNRL       +N++I  G NG        +S+ T  +  S+KR+SINLSSNKR+S
Sbjct: 415 RPVSFNRLPTISNGKTNNIIPNGRNG--------DSNNTTPK--SNKRLSINLSSNKRLS 464

Query: 489 QLL----ANDLNTSPTPSNCTKRMSIIN----GTPPVPMDIMKNY 525
            LL    +N  + SPTPS  +KR+S+IN      PP+P++++K+Y
Sbjct: 465 NLLVQGHSNGNSNSPTPSR-SKRISLINLDNSTAPPIPVNVLKDY 508

 Score =  313 bits (803), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 266/781 (34%), Positives = 371/781 (47%), Gaps = 204/781 (26%)

Query: 619  NMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFEHEKYEQIRKEKDX 678
            N +RGSITTKL+STYA+L+EDD+WE+IEKETKR SS+FATLID IFEHEKYEQIRKEK+ 
Sbjct: 529  NGKRGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEE 588

Query: 679  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDIDNAKETVQTTEGKRE 738
                                                            +E ++  + + +
Sbjct: 589  LARKVREAKEGEARERREQESEKQRK-------------------QREREELERQQLELQ 629

Query: 739  AHNDK----IKTETDDEERDIIVDIQPRSVSAPLEKT--EKSRDSPFDYSKQRNFSLRTR 792
             H D+    +K +  +E +       PRSVSAPLE+   E       D   +RN SL+TR
Sbjct: 630  NHIDQEISNLKADLANETKGAEPYENPRSVSAPLERENPEAIERDINDLFARRNVSLQTR 689

Query: 793  PVSRLDPGLMYSSGTGSSAYNPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDX 852
            P SRLDPG++YS+    +  NP  S  D         ID +K ILETIRRS+FLGSS++ 
Sbjct: 690  PKSRLDPGILYSA-PAETVSNPLLSDID-------QEIDREKKILETIRRSRFLGSSYNI 741

Query: 853  XXXXXXXXXXXSNRIKQQAFQDSHLEEMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEIL 912
                           K    + S  E+ + VT   SQ+        IV+   D+    ++
Sbjct: 742  NKELEFAK-------KTALAETSKKEKRSKVT---SQN--------IVA---DKAAIGVI 780

Query: 913  PKSHAGKTQTIGLNDSSVQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNL 972
            P           LND+    R +SEIKVPQFTRKS+ FS SN+RLSVLS+YS+++S+TNL
Sbjct: 781  P-----------LNDTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNL 829

Query: 973  VDMLKEDGINVEPTERSPTT--KSQEPEFLFESPSVDTYSRDSSTEDKPINEKENSEPIQ 1030
             D+LKE G+N+     + TT   S EPEF FES                +NE        
Sbjct: 830  GDILKEGGVNLASEANNTTTSKASTEPEFQFES----------------VNEG------T 867

Query: 1031 SNNLRLSFHDRFNRQLSTEDTEKTKNSPSGHIKDEPKKDDDNGVDLSTPKAKDESNLVKL 1090
            +N L                           +++EP+  D N  D   PK       VKL
Sbjct: 868  ANKLY-------------------------ELQEEPEYTDVNKED-GKPKKN-----VKL 896

Query: 1091 PALPPL--TTKKTDGLGIYQKSKQRTSSNASNPITPSSTNAQLTSAAVNVTPPTTTMINE 1148
            P LPPL   T + +GL IY    Q +S +   P  P               P + +MI  
Sbjct: 897  PTLPPLHEKTNQANGLAIY----QSSSDDDKKPTEPQ--------------PKSQSMI-- 936

Query: 1149 SIQKLQESREKVNNSSKLIPPKNSEIISQQNESVQIRDDYKTKPERSNKADQSERAPPAE 1208
                  E ++ +NNS+ +   K + ++  ++++ +  +    KP++     + ER P  E
Sbjct: 937  -----PERQDSINNSASV---KKTPVVEPESQATKKIN----KPKQRQPKKEEERKPLNE 984

Query: 1209 TTLNDVMTKRNQSKSRDNPQPSEEGKKGVXXXXXXXXXXXXXXXXXXXXXXXXLADDKNI 1268
               N V  KRN S  R   + S                                      
Sbjct: 985  MPPN-VEKKRNVSFFRKFSKSS-------------------------------------- 1005

Query: 1269 PSVPKPVAHPASPVSTSNDYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLR 1328
                      A    T N +D+++  NV+APQ++KGL  L +GWSKYGLK++KS    ++
Sbjct: 1006 ----------AVSTLTKNGFDYEVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMK 1055

Query: 1329 FTGKVSSENILSFKSTVFELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGV 1388
             TGK+S++NILS +STVFE+ I+ +  K  ++ F K SGSSK+VRRL  E+E VLR+EGV
Sbjct: 1056 LTGKLSNDNILSLRSTVFEM-IVESKGKQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGV 1114

Query: 1389 L 1389
            L
Sbjct: 1115 L 1115

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/516 (68%), Positives = 399/516 (77%), Gaps = 45/516 (8%)

Query: 1   MVKLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXX 60
           M    N PS  +KG+ +GPWKLGETLGLGSTGKVQLA+N +TG+QAAIKVISK+VF    
Sbjct: 1   MTASNNLPS--IKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNS 58

Query: 61  XXXXXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFN 120
                  L TPD+LPYGIEREIIIMKLLNHPNVLRLYDVWET+SNLYMVLEYAEKGELFN
Sbjct: 59  AQSSS--LTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFN 116

Query: 121 LLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
           LLVE+GPL E EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL
Sbjct: 117 LLVEKGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 176

Query: 181 ETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRN 240
           ETEDKLLETSCGSPHYAAPEI+SG+PYHG  +DVWSCG+ILFALLTGRLPFDEEDGNIRN
Sbjct: 177 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRN 236

Query: 241 LLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKT 300
           LLLKVQSG+FEMP +DEIS EAQDL++KILTVDP+KRI+ R+ILKHPL+QKYPSIKDSK+
Sbjct: 237 LLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKS 296

Query: 301 IRNLPREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLY 360
           IRNLPREDTYLNPLSD+N     ID  ILQNLVVLWHGRD  EI  KLKEPGANAEKTLY
Sbjct: 297 IRNLPREDTYLNPLSDNN---STIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLY 353

Query: 361 ALLDRFKNDTEKEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSR--GALVNTPTKRKN 418
           ALLDRFK D+EKE                 +       S  S VSR      +TP +RKN
Sbjct: 354 ALLDRFKIDSEKE--------------NFKNEQIRKRQSITSSVSRSPAKKASTPQRRKN 399

Query: 419 RASMVSVSSAHKRPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMS 478
           R SM+SVSS+HK+P SFNRLS                   H+ + +S +     +SK+ S
Sbjct: 400 RISMISVSSSHKKPASFNRLSSV----------------VHNNLSASSSTTTTPASKKFS 443

Query: 479 INLSSNKRISQLL--ANDLNTSPTPSNCTKRMSIIN 512
           +    NK++S +   +N  N+SPTP++  KR S+IN
Sbjct: 444 M----NKKLSMIADKSNSNNSSPTPAHRNKRTSMIN 475

 Score =  169 bits (429), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 140/394 (35%), Positives = 201/394 (51%), Gaps = 93/394 (23%)

Query: 734  EGKREAHNDKIKTETDDE----ERDIIVDIQP---------RSVSAPLEKTEKSRDSPFD 780
            E K EA   +++ + D+E      D+  D++P         RSVS PL K E   D+   
Sbjct: 589  EKKFEAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPLSK-ETVNDNLL- 646

Query: 781  YSKQRNFSLRTRPVSRLDPGLMYS--SGTGSSAYNPSHSTEDLHSTSSLNRIDTQKVILE 838
              +QRNFSL+TRP+SRLDPGL +S  S T     +P     +        ++DT+K+ILE
Sbjct: 647  --RQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPN-------KKLDTEKMILE 697

Query: 839  TIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAFQDSHLEEMNDVTEDLSQHNVDTSNDR 898
            TIRRSKFLGSSFD                +++  Q   ++++                  
Sbjct: 698  TIRRSKFLGSSFDINRELKAA--------EKRVMQPPTVQKL------------------ 731

Query: 899  IVSTTNDRYETEILPKSHAGKTQTIGLNDSSVQPRTLSEIKVPQFTRKSKFFSESNKRLS 958
               TT ++   E LPK   G   T  LN S+ +   +S+I+VPQFTRKS+ F+ SN+RLS
Sbjct: 732  ---TTENKSSDE-LPKHAVG---TAALNSSTAEVSKISDIRVPQFTRKSRHFTTSNRRLS 784

Query: 959  VLSLYSSRESFTNLVDMLKEDGINVEPTERSPTTKSQ-EPEFLFESPSVDT-YSRDSSTE 1016
            VLS+YS+R+SF+NLVD+LK      E  +R+PT  S  + EF+FE+ + +  Y+ +SS +
Sbjct: 785  VLSMYSTRQSFSNLVDILKNTEAGTELGQRTPTPHSAGDSEFIFETVNEEAEYTGNSSND 844

Query: 1017 DKPINEKENSEPIQSNNLRLSFHDRFNRQLSTEDTEKTKNSPSGHIKDEPKKDDDNGVDL 1076
            DK     +     + + ++L+F DRFN++   ED+             EP +D  N    
Sbjct: 845  DKLYEVADLDAAEKPSGMKLNFADRFNKK--EEDS------------TEPSRDIQN---- 886

Query: 1077 STPKAKDESNLVKLPALPPLTTKKTDGLGIYQKS 1110
                        KLP LPPL  K   GLGIYQ S
Sbjct: 887  ------------KLPVLPPLDGKA--GLGIYQTS 906

 Score =  125 bits (313), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 59/72 (81%), Positives = 66/72 (91%)

Query: 606 RASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFE 665
           RASRS KR SV  NM+RGSITTKLI+TYA+L+EDDDWE+IEKETKR SS+FATLID IFE
Sbjct: 487 RASRSSKRLSVMANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTSSDFATLIDEIFE 546

Query: 666 HEKYEQIRKEKD 677
           HEKYEQIRKEK+
Sbjct: 547 HEKYEQIRKEKE 558

 Score =  105 bits (262), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 52/99 (52%), Positives = 71/99 (71%), Gaps = 1/99 (1%)

Query: 1292 LKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFELEII 1351
            L  N+AA Q+F GL  L  GWSKYGLKN++S   ++  +GK+SS+NILS +ST FE+++ 
Sbjct: 1019 LVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVT 1078

Query: 1352 SNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLL 1390
            SN   + +L  +K SGSSK+V RL  E+EN+  KEGVLL
Sbjct: 1079 SNGESSSVL-IRKKSGSSKAVLRLTTEIENIFSKEGVLL 1116

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/544 (64%), Positives = 408/544 (75%), Gaps = 62/544 (11%)

Query: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLT- 70
           V GN +GPWKLGETLG GSTGKVQLA N  T QQAAIK+ISK+VF               
Sbjct: 11  VTGNNIGPWKLGETLGFGSTGKVQLATNEQTNQQAAIKIISKSVFDHLVNSNNNNNSALA 70

Query: 71  ------------PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGEL 118
                        ++LPYGIEREIIIMKLLNH NVLRLYDVWET++NLYMVLEYAEKGEL
Sbjct: 71  ASDVNNGSVQHNQEALPYGIEREIIIMKLLNHTNVLRLYDVWETNNNLYMVLEYAEKGEL 130

Query: 119 FNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA 178
           FNLLVE+GPL ENEA+RFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMA
Sbjct: 131 FNLLVEKGPLAENEAVRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKSNIKIADFGMA 190

Query: 179 ALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNI 238
           ALETEDKLLETSCGSPHYAAPEI+SGLPY+GLETD+WSCG+ILFALLTGRLPFDEEDGNI
Sbjct: 191 ALETEDKLLETSCGSPHYAAPEIVSGLPYNGLETDIWSCGVILFALLTGRLPFDEEDGNI 250

Query: 239 RNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDS 298
           RNLLLKVQ G+FEMPG+DE+S EAQDLI KILTV+PK+RIKTREILKHPL+QKYP+IKDS
Sbjct: 251 RNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREILKHPLLQKYPNIKDS 310

Query: 299 KTIRNLPREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKT 358
           KTIR+LPREDTYLNPL+D+NG   EID  ILQNL VLWHG+D  EI KKLKEPGANAEKT
Sbjct: 311 KTIRDLPREDTYLNPLADNNGVDTEIDESILQNLTVLWHGKDKNEIIKKLKEPGANAEKT 370

Query: 359 LYALLDRFKNDTEKEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGALV------NT 412
           LY LL RFK DTE+E                  +H NS       + + +        N 
Sbjct: 371 LYVLLHRFKEDTERE------------------NHKNSQLRKRQSLMKASSSSSSNQGNV 412

Query: 413 PTKRKNRASMVSVSSAHKRPVSFNRLSRADLSNH-VIN--TGINGTPQRHSQIESSGTLQ 469
           P +RKNR SM+SV+S+HK+PVS+N+++    S+  VI+  +  N TP             
Sbjct: 413 PRRRKNRNSMISVTSSHKKPVSYNKIAMVGGSSKDVISLPSSSNTTP------------- 459

Query: 470 RNSSSKRMSINL-SSNKRISQLLANDLNTSPTPSNCTKRMS---IING---TPPVPMDIM 522
             +SSKR+S++L SSNKR S+L     ++SPTP+  ++R S   +IN     PP+P+D++
Sbjct: 460 --ASSKRISLSLSSSNKRNSRLYTQSNSSSPTPAPRSRRSSNQNLINKESEAPPIPVDVL 517

Query: 523 KNYN 526
           K+YN
Sbjct: 518 KDYN 521

 Score =  246 bits (628), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 205/591 (34%), Positives = 282/591 (47%), Gaps = 130/591 (21%)

Query: 606  RASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFE 665
            R SR  KR S   N +RGS+TTK++STYA+LAEDDDWEFIEKETKRVSS+FATLID IFE
Sbjct: 529  RGSRLSKRYSFLLNNKRGSVTTKIMSTYAKLAEDDDWEFIEKETKRVSSDFATLIDEIFE 588

Query: 666  HEKYEQIRKEKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDIDN 725
            HEK+E+IRKEK+                                             +  
Sbjct: 589  HEKFEKIRKEKEELERKVIEAKQKEERERKEAEAAAKEEAR----------------VRR 632

Query: 726  AKETVQTTEGKREAHNDKIKTETDDEERDIIVD-------------IQPRSVSAPLEKTE 772
             KE  +  + + +  ND       DEE  ++ D             I  RSVS P+    
Sbjct: 633  EKELARMNKEEEQLQNDI------DEEARLLKDEFNFVNDETQENPINSRSVSEPV---- 682

Query: 773  KSRDSPFDYSKQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHSTEDLHSTSSLNR--- 829
              ++   D   QRNFSL+TRP+SRLDPGLM+S               D+ + SS++    
Sbjct: 683  --KNGGTDEKGQRNFSLQTRPISRLDPGLMFSK------------LGDVDNNSSVDENLT 728

Query: 830  IDTQKVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAFQ-DSHLEEMNDVTEDLS 888
            ++ QK ILETIRRSKFLGSSFD              R++Q   Q    LEE         
Sbjct: 729  MNNQKTILETIRRSKFLGSSFDINKELNNANEERK-RLRQLQLQKQKELEE--------- 778

Query: 889  QHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQTIGLND--SSVQPRTLSEIKVPQFTRK 946
                    +RI ST+    E ++L K+  G    + L D  S V+PR +SE++VPQFTRK
Sbjct: 779  -------KERIASTSYVSNENQVLSKNAIG---VVDLKDFSSDVEPRKISEVQVPQFTRK 828

Query: 947  SKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINVEPTERSPTTKSQEPEFLFESPSV 1006
            SK+FSESNKRLSVLS YSS++S+TNLVDM+KE+     P E    T  ++P F FE    
Sbjct: 829  SKYFSESNKRLSVLSFYSSKQSYTNLVDMIKEN-----PVEDEDVT--EDPGFNFEDSQY 881

Query: 1007 DTYSRD-------SSTEDKPINEKENSEPIQSNNLRLSFHDRFNRQLSTEDTEKTKNSPS 1059
            D            S    K +++K   E   S +++L+F DRF+             + +
Sbjct: 882  DYLEEKNEAPLEVSDEVPKEVDDKVQEEEKNSVSMKLNFADRFS-------------NVN 928

Query: 1060 GHIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPLTTKKTDGLGIYQKSKQRTSSNAS 1119
             + K E   +D                  K P +  L+   T+GLG+Y K+ ++T     
Sbjct: 929  SNTKQESSFED------------------KFPNI--LSKSGTEGLGLYSKN-EKTEPKPV 967

Query: 1120 NPITPSS---TNAQLTSAAVNVTPPTTTMINESIQKLQESREKVNNSSKLI 1167
              + P      ++ +  A +N     T   N+S  K     +KV+N+S  +
Sbjct: 968  KSMIPEEDKVNSSPVVEAPLNKVVNKTRAENKSTSKGPSGSQKVSNTSSFL 1018

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 70/104 (67%), Gaps = 1/104 (0%)

Query: 1288 YDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFE 1347
            ++  L ++V   Q+F GL  L +GW+ YGLK++K   +     GK+S++NILS +ST+ E
Sbjct: 1035 FEVNLYSSVTETQLFNGLQNLLKGWTNYGLKDVKVDKQKKMIVGKLSNDNILSLRSTIVE 1094

Query: 1348 LEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLLK 1391
            L + + S K  ++  +K SGSSK++RRL +E+E VL KEGVL K
Sbjct: 1095 LCVFTES-KFSVIGIRKKSGSSKTMRRLASEIEKVLSKEGVLQK 1137

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/520 (66%), Positives = 396/520 (76%), Gaps = 36/520 (6%)

Query: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTP 71
           +KG+ +GPWKLG TLG GSTGKV +A + STGQQAA+K++SK++F              P
Sbjct: 18  LKGDKIGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKSIFGNQSNSSTIVGSNDP 77

Query: 72  DSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPEN 131
           D LPYGIEREIIIMKLLNHPNVLRLYDVWET+S+LYMVLEY EKGELFNLLV+RGPLPEN
Sbjct: 78  DVLPYGIEREIIIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFNLLVDRGPLPEN 137

Query: 132 EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSC 191
           EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALE++DKLLETSC
Sbjct: 138 EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSC 197

Query: 192 GSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFE 251
           GSPHYAAPEI+SGLPYHG E+DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSG+FE
Sbjct: 198 GSPHYAAPEIVSGLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGKFE 257

Query: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYL 311
           MP  +EIS EAQDLI+KILTVDP  RIK+R ILKHPL+QKYPSIKDSK+IRNLPREDTYL
Sbjct: 258 MPDTNEISGEAQDLIAKILTVDPAARIKSRGILKHPLLQKYPSIKDSKSIRNLPREDTYL 317

Query: 312 NPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDTE 371
           NPL   +G    ID  I+ NLVVLWHGRD  EIT KLKEPGAN EKT YALL RFK+D++
Sbjct: 318 NPLDSVDG---TIDDTIIGNLVVLWHGRDRNEITNKLKEPGANLEKTFYALLFRFKHDSQ 374

Query: 372 KEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSAHKR 431
           +E                      SN       SR ++ +T  K+K RA ++S SS+HKR
Sbjct: 375 QEQLKQQRRSQAMQVSPKKTGLRKSN-------SRRSINSTTPKKKTRAPVISASSSHKR 427

Query: 432 PVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSSNKRISQLL 491
           PVSF+RLS ++ SN   NT                    NSS KR S+NLSSNKRIS L+
Sbjct: 428 PVSFSRLSYSNGSNTDHNTP-------------------NSSGKRSSVNLSSNKRISALI 468

Query: 492 ANDLNTSPTPSNCTKRMSIIN---GTPPVPMDIMKNYNDA 528
             + N+SPTP   +KR S+       PP+P+D++K+YN A
Sbjct: 469 --NPNSSPTP--ASKRASLRELDPSAPPIPVDMLKDYNKA 504

 Score =  152 bits (385), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 133/375 (35%), Positives = 185/375 (49%), Gaps = 97/375 (25%)

Query: 762  RSVSAPLEKTEK-----SRDS----PFDYSKQRNFSLRTRPVSRLDPGLMYSSGTGSSAY 812
            RSVSAP+E   K     S D+      D   +R FSL TRP SRLDPG+           
Sbjct: 658  RSVSAPVESVLKVDKRSSMDALDGDIMDLLNRRTFSLETRPKSRLDPGIYTLEEV----- 712

Query: 813  NPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAF 872
             P+   +D         + T+K ILETIRRSKFLGSSFD               I ++  
Sbjct: 713  -PNSDIKD-----GGRDLKTEKTILETIRRSKFLGSSFD---------------INKELA 751

Query: 873  QDSHLEEMNDVTEDLSQHNVDTSNDRIVST-----TNDRYETEILPKSHAGKTQTIGLND 927
            ++  L+E  +    L Q   +   DR+VS      + + YE + LPK+ A    +   ND
Sbjct: 752  RERRLKE--ERAAALKQRKKE---DRVVSNATGNYSENGYEPQTLPKNAAATKIS---ND 803

Query: 928  SSVQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKE----DGINV 983
            +   PR +SE++VPQFTR+S+ F+ SNKRLSVLS+YS++ SFTNL D L+       IN 
Sbjct: 804  AGSDPRKISEVQVPQFTRRSRHFTASNKRLSVLSMYSTKASFTNLADHLRGKTDLQSING 863

Query: 984  EPTERSPTTKSQEP--EFLFESPSVDTYSR---DSSTEDKPINEKENSEP--IQSNNLRL 1036
             P    P+T   EP  EF+FE  SVD   +   D+S + +     E ++P     + +RL
Sbjct: 864  SP----PSTSRMEPETEFMFE--SVDGEGKETADTSADSRLYEVAEGNDPKGAARSAVRL 917

Query: 1037 SFHDRFNRQLSTEDTEKTKNSPSGHIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPL 1096
            +F DRFN+  S                               P++ ++ N +KLP+LPPL
Sbjct: 918  NFADRFNKPTSP-----------------------------PPQSVEDPNGIKLPSLPPL 948

Query: 1097 TTKKTD---GLGIYQ 1108
               K+D   GLG+YQ
Sbjct: 949  DKAKSDGVNGLGLYQ 963

 Score =  103 bits (256), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/74 (67%), Positives = 60/74 (81%), Gaps = 1/74 (1%)

Query: 600 AAQNVNR-ASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFAT 658
           AA   NR +SR  KR S  P  +RGSITTKLI+TYA+++ED+DWE+IEKETKR S++FAT
Sbjct: 504 AAPKANRKSSRISKRLSFLPGNKRGSITTKLIATYAKISEDNDWEYIEKETKRTSADFAT 563

Query: 659 LIDNIFEHEKYEQI 672
           L D IFEHEKYEQI
Sbjct: 564 LCDEIFEHEKYEQI 577

 Score = 88.6 bits (218), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 1287 DYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVF 1346
            +YDF+    +   QMF  L  L   W  YGLK++ +SP   +  GK+SS+N+LS +ST+F
Sbjct: 1059 EYDFKFDTVIEGTQMFNALSKLLAAWKDYGLKDVVASPSQKKIKGKMSSDNMLSLRSTLF 1118

Query: 1347 ELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLL 1390
            E+ I+S   +  ++ F K SGS+K+ ++LV E+E +L  +  L+
Sbjct: 1119 EISIVSKG-EGSIVGFTKKSGSTKTFKKLVKEIEKILESKKALV 1161

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/502 (66%), Positives = 382/502 (76%), Gaps = 39/502 (7%)

Query: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXX-XXLLT 70
           +K NT+GPWKLGETLGLGSTGKVQLA N STGQ+AA+KVISKAVF             +T
Sbjct: 11  IKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSIT 70

Query: 71  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPE 130
           PD+LPYGIEREIIIMKLLNHPNVLRLYDVWET+++LY+VLEYAEKGELFNLLVERGPLPE
Sbjct: 71  PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPE 130

Query: 131 NEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETS 190
           NEAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE KLLETS
Sbjct: 131 NEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETS 190

Query: 191 CGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQF 250
           CGSPHYAAPEI+SG+PY G  +DVWSCG+ILFALLTGRLPFDEEDGNIR LLLKVQ GQF
Sbjct: 191 CGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQF 250

Query: 251 EMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTY 310
           E+P +DE+SREAQDLI KILTVDPK+RIK R+ILKHPL+QKYPSI+DSK+IR LPREDTY
Sbjct: 251 ELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDTY 310

Query: 311 LNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDT 370
           L PLS+ N     ID  ILQNLV+LWHGRD   I +KLKEPGANAEKTLYALL RFK DT
Sbjct: 311 LTPLSESN---SSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKCDT 367

Query: 371 EKEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSAHK 430
           +KE+               + S  N             +  TP +RKNR S++SV+S+ K
Sbjct: 368 QKELIRQQQIKKRQSISSVSTSSPNK------------ISTTPQRRKNRESIISVTSSRK 415

Query: 431 RPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSSNKRISQL 490
           +P+SFN+ + +                      SS  L    SSKR+S N SS KR+S +
Sbjct: 416 KPISFNKFTASS--------------------ASSSNLTTPGSSKRLSKNFSSKKRLSTI 455

Query: 491 LANDLNTSPTPSNCTKRMSIIN 512
           +      SPTP++  KR SIIN
Sbjct: 456 VN---QASPTPASRNKRTSIIN 474

 Score =  258 bits (658), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 196/509 (38%), Positives = 270/509 (53%), Gaps = 76/509 (14%)

Query: 599  SAAQNVNRASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFAT 658
            S A+   + SRS K+ S+ P+M+R S+TTKL+STYA+LA DDDWE+IEKETKR SSNFAT
Sbjct: 486  STAKRNKKTSRSTKKLSLIPSMKRESVTTKLMSTYAKLAADDDWEYIEKETKRTSSNFAT 545

Query: 659  LIDNIFEHEKYEQIRKEKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 718
            LID IFE+EKYE+IRKEK                                          
Sbjct: 546  LIDEIFEYEKYEKIRKEKKELELKVREAKAREELERRKRKQEEK---------------- 589

Query: 719  XXGDIDNAKETVQTTEGKREAHNDKIKTETD--DEERDIIV------DIQPRSVSAPLEK 770
                 +++++ ++  E KR+    K + E D  D E ++        D   RS+SAP+E 
Sbjct: 590  -----EHSRKVLEKEELKRKQQELKKQIEIDISDLEHELSKHKEEKPDGNIRSISAPMES 644

Query: 771  TEKSRDS-PFDYS---KQRNFSLRTRPVSRLDPGLMYSSGT-GSSAYNPSHSTEDLHSTS 825
             EK+ +    D     ++RNFSL+TRPVSRLDPG+M+SS     SA  P  +  +     
Sbjct: 645  EEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPVEKESAVEPKRTENE----- 699

Query: 826  SLNRIDTQKVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAFQDSHLEEMNDVTE 885
               R+ T+K ILETIRRSKFLGSSF+             + +  Q               
Sbjct: 700  ---RLTTEKKILETIRRSKFLGSSFNIEKELKLSKMEYPSMVPPQRL------------- 743

Query: 886  DLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQ-------TIGLNDSSVQPRTLSEI 938
                     S +RIVS  +D Y + +LPK   G +Q       T G   S+ + R +SE+
Sbjct: 744  ---------SEERIVSDPSDDYGSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEV 794

Query: 939  KVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINV--EPTERSPTTKSQ- 995
            +VPQFTRKS+ FSESNKRLSVLS+YSS+ESFTNLVD+LK   I+V  + ++R PT KS  
Sbjct: 795  RVPQFTRKSRHFSESNKRLSVLSMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSAD 854

Query: 996  EPEFLFESPSVDTYSRDSSTEDKPINEKENSEPIQSNNLRLSFHDRFNRQLSTEDTEKTK 1055
            + EFLFE+ + +     +S+ D+ + +  +S     + L+L+F DRFN   + ++TE   
Sbjct: 855  DSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRFNASTNEKETENLH 914

Query: 1056 --NSPSGHIKDEPKKDDDNGVDLSTPKAK 1082
                P  +  DE  K  D  V    PK K
Sbjct: 915  LPTLPPLNGGDEVNKQKDEDVLGIQPKVK 943

 Score =  123 bits (309), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/109 (55%), Positives = 82/109 (75%), Gaps = 1/109 (0%)

Query: 1283 STSNDYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFK 1342
            S+++D   +L A V+A Q+F GL+ L RGW++YGLKNIKS P +L  TGK+SSENI S +
Sbjct: 1028 SSTSDKSVELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLR 1087

Query: 1343 STVFELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLLK 1391
            ST+FE+ I     K  +++FKK SG+ K+V++LVNEVENVL KEGVL K
Sbjct: 1088 STLFEISIYPRG-KMSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVLEK 1135

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/548 (62%), Positives = 400/548 (72%), Gaps = 50/548 (9%)

Query: 4   LTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXX 63
           + + P   +K + +GPWKLG  LG GS GKV +A + +TGQQAA+K++SK++F       
Sbjct: 10  IISSPLTTLKNDKIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNN 69

Query: 64  XXXXLLT--PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNL 121
               + +  PD LPYGIEREIIIMKLLNH NVLRLYDVWET SNLYMVLEY EKGELFNL
Sbjct: 70  SSTIVGSNDPDLLPYGIEREIIIMKLLNHTNVLRLYDVWETKSNLYMVLEYVEKGELFNL 129

Query: 122 LVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181
           LVERGPLPENEA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALE
Sbjct: 130 LVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 189

Query: 182 TEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNL 241
           ++DKLLETSCGSPHYAAPEI+SGLPYHG E+DVWSCG+IL+ALLTGRLPFDE++GNIR+L
Sbjct: 190 SKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDNGNIRSL 249

Query: 242 LLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTI 301
           LLKVQSG++EMPGNDEIS EAQDLI+KILTVDP +RIKTREILKHPL+QKYPSIKDSK+I
Sbjct: 250 LLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILKHPLLQKYPSIKDSKSI 309

Query: 302 RNLPREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYA 361
           RNLPREDTYLNPL  D+GD   ID  ILQNLVVLWHGRD  EI  KL EPGAN EKT Y 
Sbjct: 310 RNLPREDTYLNPL--DHGD-GSIDDGILQNLVVLWHGRDRNEIVAKLNEPGANLEKTFYV 366

Query: 362 LLDRFKNDTE---KEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGALVNTPT---- 414
           LL RFK+D     ++                      S  S Y    + A+  + +    
Sbjct: 367 LLFRFKHDVHQQQQQQQQQQQQQQQQQQQQQQQQQQQSRQSGYVSPKKLAMKKSASRKSI 426

Query: 415 -----------KRKNRASMVSVSSAHKRPVSFNRLSRADLSNHVINTGINGTPQRHSQIE 463
                      K+KNR SM+SVSS+HKRPVSFN+LS A  S+        GTP       
Sbjct: 427 TSTSLSGTTTPKKKNRVSMISVSSSHKRPVSFNKLSTAGKSDSAC-----GTP------- 474

Query: 464 SSGTLQRNSSSKRMSINLSSNKRISQLLANDLNTSPTPSNCTKRMSIIN---GTPPVPMD 520
                   SS+KRMSI+LSS+KR+S   A   NTSPTP+N  KRMS+ +     PPVPMD
Sbjct: 475 -------GSSTKRMSISLSSSKRLS---AMGPNTSPTPAN--KRMSVRDMDSSAPPVPMD 522

Query: 521 IMKNYNDA 528
           ++ +Y  A
Sbjct: 523 VLNDYTSA 530

 Score =  241 bits (614), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 213/651 (32%), Positives = 301/651 (46%), Gaps = 153/651 (23%)

Query: 762  RSVSAPLE----KTEKSRDSPF-------DYSKQRNFSLRTRPVSRLDPGLMYSSGTGSS 810
            R VSAP+     K +  RDS         D  K+R  SL+TRPVSRLDPG++ +   GS 
Sbjct: 691  RCVSAPIASSSAKDDGKRDSIARLSGDIDDLLKRRTVSLQTRPVSRLDPGIVAAENLGSV 750

Query: 811  AYNPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQ 870
             Y  +   ++         + T+K ILETIRRS+FLGSSFD            + R K++
Sbjct: 751  IYEEADGVDE-------TTLRTEKTILETIRRSRFLGSSFDIKKELER-----AQRKKEE 798

Query: 871  AFQDSHLEEMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQTIGLNDS-S 929
            A    H + +              S+    S TND YE+  LPK+ A       LND  +
Sbjct: 799  ALARQHQQRI-------------LSSATAASATNDAYESRALPKNAAA---VDTLNDERN 842

Query: 930  VQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINVEPTERS 989
             +PR +SEIKVPQFTR+S+ F+ SNKRLSVLS+YS++ SFTNL D LK      E +  +
Sbjct: 843  PEPRKISEIKVPQFTRRSRHFTASNKRLSVLSMYSTKSSFTNLADHLKGGADLQEVSGSA 902

Query: 990  PTTK--SQEPEFLFES-PSVDTYSRDSSTEDKPINE----KENSEPIQSNNLRLSFHDRF 1042
            P+T   +QEPEFLFES    D+     +T D  + E     E+S+      +RL+F DRF
Sbjct: 903  PSTTKITQEPEFLFESVHEEDSEETPDTTADSRLYEVPDGSESSKTSTKAAMRLNFADRF 962

Query: 1043 NRQLSTEDTEKTKNSPSGHIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPL---TTK 1099
            N +                         DN  D            VKLP LPPL    +K
Sbjct: 963  NTRAG-----------------------DNPAD------------VKLPPLPPLEKNGSK 987

Query: 1100 KTDGLGIYQKSKQRTSSNASNPITPSSTNAQLTSAAVNVTPPTTTMINESIQKLQESREK 1159
            K +GLGIYQ              +P    A     ++   P   +MI + I         
Sbjct: 988  KPNGLGIYQ--------------SPERPRADPNPTSMVHEPKVFSMIPDDIAG------- 1026

Query: 1160 VNNSSKLIPPKNSEIISQQNESVQIRDDYKTKPERS-NKADQSERAPPAETTLNDVMTKR 1218
                    P K+++    ++E+V      K++P+ + + AD  E + P    LN +M K 
Sbjct: 1027 --------PAKSTK--PAESENVPTSATKKSEPKNALHSADAPEASQPP---LNGMMRKN 1073

Query: 1219 NQSKSRDNPQPSEEGKKGVXXXXXXXXXXXXXXXXXXXXXXXXLADDKNIPSVPKPVAHP 1278
            N  K  ++  P+ E K+                                           
Sbjct: 1074 NDRKPLEDITPAAEKKRNRSFFRKFSR--------------------------------- 1100

Query: 1279 ASPVSTSNDYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENI 1338
            +S    S+++D +L  +V A QMF  L  L  GW  YGLK ++    +   TGK+SS+NI
Sbjct: 1101 SSEEKKSDNFDAKLNTSVEAVQMFNALGKLLGGWKDYGLKEVRVQGPTKTITGKLSSDNI 1160

Query: 1339 LSFKSTVFELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVL 1389
            LS +ST+FE+ +  +S K  ++ F K SGS+K+ +RLV EVE VL +E VL
Sbjct: 1161 LSLRSTMFEILVRDDSSKGSVVWFVKKSGSTKTFKRLVKEVEKVLERENVL 1211

 Score =  119 bits (297), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 64/71 (90%)

Query: 606 RASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFE 665
           RASR+ KR S  PN++RGSITTKLI+TYA+L+E+DDWE+IEKETKR S++FATL D IFE
Sbjct: 539 RASRASKRLSFLPNIKRGSITTKLIATYAKLSEEDDWEYIEKETKRTSADFATLCDQIFE 598

Query: 666 HEKYEQIRKEK 676
           HEKYEQIRKEK
Sbjct: 599 HEKYEQIRKEK 609

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/502 (66%), Positives = 383/502 (76%), Gaps = 39/502 (7%)

Query: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXX-LLT 70
           +K NT+GPWKLGETLGLGSTGKVQLA N STGQ+AA+KVISK VF              T
Sbjct: 11  IKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNTGNVSGTSIVGSTT 70

Query: 71  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPE 130
           PD+LPYGIEREIIIMKLLNHPNVLRLYDVWET+++LY+VLEYAEKGELFNLLVERGPLPE
Sbjct: 71  PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELFNLLVERGPLPE 130

Query: 131 NEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETS 190
           NEAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE KLLETS
Sbjct: 131 NEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETS 190

Query: 191 CGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQF 250
           CGSPHYAAPEI+SG+PY G  +DVWSCG+ILFALLTGRLPFDEEDGNIR LLLKVQ G+F
Sbjct: 191 CGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEF 250

Query: 251 EMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTY 310
           E+P +DEISREAQDLIS+ILTVDP++RIKTR+ILKHPL+QKYPSIKDSK+IR LPREDTY
Sbjct: 251 ELPSDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQKYPSIKDSKSIRGLPREDTY 310

Query: 311 LNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDT 370
           L PLS+ N     ID  ILQNLV+LWHGRD   I +KL+E GANAEKTLYALL RFK DT
Sbjct: 311 LTPLSESN---SSIDATILQNLVILWHGRDPDGIKEKLRETGANAEKTLYALLYRFKCDT 367

Query: 371 EKEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSAHK 430
           +KE+                      + S+ S      L  TP +RKNR SM+SVSS+ K
Sbjct: 368 QKELVKQQ------------QIKKRQSISSLSISPSKKLSTTPQRRKNRESMISVSSSRK 415

Query: 431 RPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSSNKRISQL 490
           +P+SFN+ + +                      SS  L    SSKR+S N SS K++S +
Sbjct: 416 KPISFNKFTASS--------------------ASSSNLTTPGSSKRLSKNFSSKKKLSTI 455

Query: 491 LANDLNTSPTPSNCTKRMSIIN 512
           +     +SPTP++  KR S+IN
Sbjct: 456 VN---QSSPTPASRNKRASVIN 474

 Score =  168 bits (425), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 129/340 (37%), Positives = 191/340 (56%), Gaps = 51/340 (15%)

Query: 762  RSVSAPLEKTEKSRD---SPFD-YSKQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHS 817
            RS+SAP+E  EK+ D   +  D   ++RNFSL+TRPVSRLDPG+++S        NP  +
Sbjct: 636  RSISAPMENEEKNIDHLGTDIDNILRRRNFSLQTRPVSRLDPGIVFS--------NPIET 687

Query: 818  TEDLHSTSSLN-RIDTQKVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAFQDSH 876
               +    S N R+ T+K ILETIRRSKFLGSSF+                 ++  + S 
Sbjct: 688  VYPVEPKRSENERLTTEKKILETIRRSKFLGSSFNI----------------EKELKLSK 731

Query: 877  LEEMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQ---------TIGLND 927
            +E  + +  +        S +R+VS  N +YE+ ILPK   G +Q         T  L+D
Sbjct: 732  MEYPSVLAPE------KLSGERVVSDLNGKYESLILPKDAKGVSQLKDDITSTTTEHLSD 785

Query: 928  SSVQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINV--EP 985
              +  R +SE++VPQFTRKS+ FSESNKRLS+LS+YS++ESFTNLVD+LK   ++V  + 
Sbjct: 786  GKL--RKISEVRVPQFTRKSRHFSESNKRLSLLSMYSTKESFTNLVDILKNSNLDVNNQQ 843

Query: 986  TERSPTTKSQ-EPEFLFESPSVDTYSRDSSTEDKPINEKENSEPIQSNNLRLSFHDRFNR 1044
            ++R PT +S  + EFLFE+ + +     +S+ D+ + +  +S       L+L+F DRFN 
Sbjct: 844  SQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKTALKLNFADRFNE 903

Query: 1045 QLSTEDTEKTK--NSPSGHIKDEPKKDDDNGVDLSTPKAK 1082
                ++T+     + P     DE +K +     L  PK K
Sbjct: 904  STEYKETDNLHLPSLPPLSGDDEMRKQNSEEDSLVQPKVK 943

 Score =  120 bits (301), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 82/109 (75%), Gaps = 1/109 (0%)

Query: 1283 STSNDYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFK 1342
            S+++D   +L A V+A Q+F GL+ L RGW+++GLKNIKS P +L  TGK+SSENI S +
Sbjct: 1029 SSASDKLVELYAKVSARQLFNGLEKLLRGWTQFGLKNIKSHPNNLTLTGKLSSENIFSLR 1088

Query: 1343 STVFELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLLK 1391
            ST+FE+ I     +  +++FKK SGS K+V++LVNEVENVL KEGVL K
Sbjct: 1089 STLFEINIYPKG-RMSVVQFKKISGSFKAVKKLVNEVENVLNKEGVLQK 1136

 Score =  118 bits (295), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 68/79 (86%)

Query: 599 SAAQNVNRASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFAT 658
           S A+   R S+S KR S+ P+M+R S+TTKL+STYA+LAEDDDWE+IEKETKR SSNFAT
Sbjct: 486 STAKKNKRTSKSIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFAT 545

Query: 659 LIDNIFEHEKYEQIRKEKD 677
           LID IFE+EKYEQIRKEK+
Sbjct: 546 LIDEIFEYEKYEQIRKEKE 564

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/502 (66%), Positives = 385/502 (76%), Gaps = 39/502 (7%)

Query: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXX-XXLLT 70
           +K NT+GPWKLGETLGLGSTGKVQLA N STGQ+AA+KVISKAVF              T
Sbjct: 11  IKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTT 70

Query: 71  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPE 130
           PD+LPYGIEREIIIMKLLNHPNVLRLYDVWET+++LY+VLEYAEKGELFNLLVERGPLPE
Sbjct: 71  PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPE 130

Query: 131 NEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETS 190
           +EAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE KLLETS
Sbjct: 131 HEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETS 190

Query: 191 CGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQF 250
           CGSPHYAAPEI+SG+PY G  +DVWSCG+ILFALLTGRLPFDEEDGNIR LLLKVQ G+F
Sbjct: 191 CGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEF 250

Query: 251 EMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTY 310
           EMP +DEISREAQDLI KILTVDP++RIKTR+ILKHPL+QKYPSI+DSK+IR LPREDTY
Sbjct: 251 EMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTY 310

Query: 311 LNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDT 370
           L PLS+ N     ID  ILQNLV+LWHGRD + I +KL+EPGANAEKTLYALL RFK DT
Sbjct: 311 LTPLSESN---SSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFKCDT 367

Query: 371 EKEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSAHK 430
           +KE+               + S S   ++            TP +R+NR S++SV+S+ K
Sbjct: 368 QKELIKQQQVKKRQSISSVSVSPSKKVST------------TPQRRRNRESLISVTSSRK 415

Query: 431 RPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSSNKRISQL 490
           +P+SFN+ + +                      SS  L    SSKR+S N SS K++S +
Sbjct: 416 KPISFNKFTASS--------------------ASSSNLTTPGSSKRLSKNFSSKKKLSTI 455

Query: 491 LANDLNTSPTPSNCTKRMSIIN 512
           +     +SPTP++  KR S+IN
Sbjct: 456 VN---QSSPTPASRNKRASVIN 474

 Score =  264 bits (674), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 188/461 (40%), Positives = 257/461 (55%), Gaps = 76/461 (16%)

Query: 606  RASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFE 665
            R+SRS KR S+ P+M+R S+TTKL+STYA+LAEDDDWE+IEKETKR SSNFATLID IFE
Sbjct: 493  RSSRSIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFE 552

Query: 666  HEKYEQIRKEKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDIDN 725
            +EKYEQIRKEK+                                                
Sbjct: 553  YEKYEQIRKEKEELERKVREAKAREELERRRRKQEEKE---------------------R 591

Query: 726  AKETVQTTEGKREAHNDKIKTETD--DEERDII------VDIQPRSVSAPLEKTEKSRDS 777
            A++ ++  + KR+    K + E D  D E+++       +D   RS+SAP+E  EK+ + 
Sbjct: 592  ARKLLEKEDLKRKQEELKKQIEIDISDLEQELSKHKEEKLDGNIRSISAPMENEEKNINH 651

Query: 778  -PFDYS---KQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHSTEDLHSTSSLNRIDTQ 833
               D     ++RNFSL+TRPVSRLDPG+M+SS T   +      TE+        R+ T+
Sbjct: 652  LEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRTEN-------ERLTTE 704

Query: 834  KVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAFQDSHLEEMNDVTEDLSQHNVD 893
            K ILETIRRSKFLGSSF+             + I  Q                       
Sbjct: 705  KKILETIRRSKFLGSSFNIDKELKLSKMEYPSIIAPQRL--------------------- 743

Query: 894  TSNDRIVSTTNDRYETEILPKSHAGKTQTIGLNDSSV--------QPRTLSEIKVPQFTR 945
             S +R+VS +ND YE+ ILPK   G +Q   L DS+         + R +SEI+VPQFTR
Sbjct: 744  -SEERVVSDSNDGYESLILPKDGNGVSQ---LKDSTATTAPVSDGRLRKISEIRVPQFTR 799

Query: 946  KSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINV--EPTERSPTTKSQ-EPEFLFE 1002
            KS+ FSESNKRLSVLS+YS++ESFTNLVD+LK   ++V  + ++R PT +S  + EFLFE
Sbjct: 800  KSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSADDSEFLFE 859

Query: 1003 SPSVDTYSRDSSTEDKPINEKENSEPIQSNNLRLSFHDRFN 1043
            + + +     +S+ D+ + +  +S     + L+L+F DRFN
Sbjct: 860  TVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRFN 900

 Score =  122 bits (307), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/109 (55%), Positives = 81/109 (74%), Gaps = 1/109 (0%)

Query: 1283 STSNDYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFK 1342
            S S+D   +L A ++A Q+F GL+ L RGW++YGLKNIKS P +L  TGK+SS+NI S +
Sbjct: 1035 SKSSDKTMELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLR 1094

Query: 1343 STVFELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLLK 1391
            ST+FE+ I     K  +++FKK SGS K+V++LVNEVENVL KEGVL K
Sbjct: 1095 STLFEVNIYPRG-KMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVLQK 1142

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/525 (63%), Positives = 396/525 (75%), Gaps = 53/525 (10%)

Query: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTP 71
           +KG+T+GPWKLG TLG+GSTGKV +AYN + GQQAA+K+ISK++F              P
Sbjct: 9   LKGDTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGN--DP 66

Query: 72  DSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPEN 131
           D LPYGIEREIIIMKLLNHPNVLRLYDVWET  +LYMVLEY EKGELFNLLVERGPLPEN
Sbjct: 67  DVLPYGIEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPEN 126

Query: 132 EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSC 191
           EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+N+K+ADFGMAALE++DKLLETSC
Sbjct: 127 EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALESKDKLLETSC 186

Query: 192 GSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFE 251
           GSPHYAAPEI+SGLPYHG E+DVWSCG+IL+ALLTGRLPFDEEDGNIRNLLLKVQSG+FE
Sbjct: 187 GSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKFE 246

Query: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYL 311
           MPG+DEIS EAQDLI++ILTVDP++RIKTREILKHPL++KYPSIKDSK+IRNLPREDTYL
Sbjct: 247 MPGDDEISSEAQDLIARILTVDPEQRIKTREILKHPLLRKYPSIKDSKSIRNLPREDTYL 306

Query: 312 NPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDTE 371
           NPLS + G+ C +D  ILQNLVVLWHGR+ ++I  KL EPGAN EKT YALL RFK+D  
Sbjct: 307 NPLSLEGGNQC-VDETILQNLVVLWHGRNKEDIITKLMEPGANLEKTFYALLHRFKHDNY 365

Query: 372 KEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGAL---------VNTPTKRKNRASM 422
           ++                       + S+ S +  G+L         V TP  +K R S+
Sbjct: 366 QD------------QLKQQELQKKQSVSSNSLMYVGSLPSPNKSDSPVTTP--KKKRTSI 411

Query: 423 VSVSSAHKRPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLS 482
           +  SS+HKRPVS  +LS    S H                  S  ++  S  KR+S    
Sbjct: 412 IVASSSHKRPVSMQKLS----SQH------------------SSPVKNGSIGKRLSKTFP 449

Query: 483 SNKRISQLLANDLNTSPTPSNCTKRMSIIN--GTPPVPMDIMKNY 525
           SNKRISQL++N  ++SPTP+   KR+S IN    PPVP +++++Y
Sbjct: 450 SNKRISQLVSN--SSSPTPA-AHKRVSRINDSAAPPVPKEMLRDY 491

 Score =  230 bits (586), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 170/450 (37%), Positives = 225/450 (50%), Gaps = 76/450 (16%)

Query: 576  VINTKYTNPANSTQISTNGQTSDSAAQNV---------NRASRSQKRKSVRPNMQRGSIT 626
            V N+    PA   ++S   + +DSAA  V          ++ R  KR S+ PNM+RGSIT
Sbjct: 458  VSNSSSPTPAAHKRVS---RINDSAAPPVPKEMLRDYKRQSKRQSKRFSLLPNMKRGSIT 514

Query: 627  TKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFEHEKYEQIRKEKDXXXXXXXXX 686
            TKLI+TYA+L+ED +WE+IEKETKR S +FATL+D IFEHEKYEQIRKEK+         
Sbjct: 515  TKLIATYAKLSEDSEWEYIEKETKRTSQDFATLMDQIFEHEKYEQIRKEKEELERKVNEA 574

Query: 687  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDIDNAKETVQTTEGKREAHNDKIKT 746
                                                 D  ++ +   + + EA       
Sbjct: 575  REKEEAERKERERIEREEQERLEREERKRAERQKELQDQMEDEIAKLKAEYEA------V 628

Query: 747  ETDDEERDIIVDIQPRSVSAPLE--KTEKSRDSPF-------DYSKQRNFSLRTRPVSRL 797
            +   +ER+       RSVSAP+E  +T   RDS F       +    RNFSL+TRPVSRL
Sbjct: 629  QGSSDERNTA---NGRSVSAPIETDRTANKRDSTFGIKNDINELINTRNFSLQTRPVSRL 685

Query: 798  DPGLMYSSGTGSSAYNPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDXXXXXX 857
            DPG++ +    S+      + ED       ++   +K ILETIRRSKFLGS F+      
Sbjct: 686  DPGIIAAESRLSA------NLED-------DQASKEKTILETIRRSKFLGSQFNLNVELE 732

Query: 858  XXXXXXSNRIKQQAFQDSHLEEMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHA 917
                   ++ +Q+                           R  S    +YE + LPK+  
Sbjct: 733  KAQKDLVSKERQEQL-------------------------RKYSEQTAKYEVQKLPKNAK 767

Query: 918  GKTQTIGLNDSSVQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLK 977
                   L D  V+PR LSE+KVPQFTR+SK FS SNKR SVLSLYS++ SFTNLVD LK
Sbjct: 768  A---VATLRDDEVEPRKLSEVKVPQFTRRSKHFSSSNKRFSVLSLYSTKTSFTNLVDHLK 824

Query: 978  EDGINVEPT----ERSPTTKSQEPEFLFES 1003
             D   +EP     E S +  +QEPEF+FE+
Sbjct: 825  NDNY-LEPLPGQPEYSSSKVAQEPEFMFET 853

 Score =  103 bits (258), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 72/103 (69%)

Query: 1288 YDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFE 1347
            +D QLKA V+AP+M+K LD L   W+ YGLK+++SSP     +GK++S+NILS +ST F+
Sbjct: 1007 FDSQLKAGVSAPKMYKALDRLLNEWTNYGLKHVESSPNDFVISGKLTSDNILSLRSTGFK 1066

Query: 1348 LEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLL 1390
            + ++       +++F K SGS+K+  RLV E+E +L KE VL+
Sbjct: 1067 ITVLPGEGNGSIIQFTKKSGSTKTFNRLVKEIEKILEKEKVLV 1109

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/532 (63%), Positives = 394/532 (74%), Gaps = 38/532 (7%)

Query: 1   MVKLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXX 60
           M  +  + +  V+G+ VGPWKLGETLG GSTGKVQLA N  T Q AA+K ISKA+F    
Sbjct: 1   MSGMNKRSAPTVRGDKVGPWKLGETLGFGSTGKVQLACNEITQQSAAVKEISKAIFSAKT 60

Query: 61  XXXXXXXLL-TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119
                     TPD LPYGIEREIIIMKLLNHPNVLRLYDVWET+ +LYMVLEYAEKGELF
Sbjct: 61  APGNSSIAASTPDPLPYGIEREIIIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELF 120

Query: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           NLLVE GPLPENEA+ FFRQIIIG+SYCHALGIVHRDLKPENLLLDH  NIKIADFGMAA
Sbjct: 121 NLLVENGPLPENEAVCFFRQIIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAA 180

Query: 180 LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIR 239
           LETEDKLLETSCGSPHYAAPEI+SG+PYHG  +D+WSCG+I FALLTGRLPFDEEDGNIR
Sbjct: 181 LETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDIWSCGVIFFALLTGRLPFDEEDGNIR 240

Query: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSK 299
           NLLLKVQSG+FEMP +DEIS EAQDL++KILTVDP+ RIK REILKHPL+QKYP++ D+K
Sbjct: 241 NLLLKVQSGKFEMPDDDEISPEAQDLLAKILTVDPECRIKPREILKHPLLQKYPNVSDNK 300

Query: 300 TIRNLPREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTL 359
           +IRNLPREDTYL+PLSD      E+D  ILQNLVVLWHGR + EI  KLK+PGANAEKTL
Sbjct: 301 SIRNLPREDTYLHPLSDSGS--SEVDQNILQNLVVLWHGRPAGEIAAKLKDPGANAEKTL 358

Query: 360 YALLDRFKNDTEKEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGALVNTPTKRKNR 419
           YALL RFKNDTE+E                T +  N+N     HVS         K++NR
Sbjct: 359 YALLARFKNDTERE-AARQKQIKKRSSLNGTGAGVNNN-----HVS--------PKKRNR 404

Query: 420 ASMVSVSSAHKRPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSI 479
           AS ++ SS+HKRPVS  +LS                   +S   S+ +    +  KRMS+
Sbjct: 405 ASTINASSSHKRPVSLIKLS----------------GSSNSNSNSNPSSTSTTPPKRMSV 448

Query: 480 NLSSNKRISQLLANDLNTSPTPSNCTKRMSII-----NGTPPVPMDIMKNYN 526
           NLSSNKR+S +       SPTP++ +KR+SII      G PPVP+D++K+YN
Sbjct: 449 NLSSNKRLSTVKTQGNGGSPTPASRSKRVSIIESDKNGGAPPVPIDMLKDYN 500

 Score =  322 bits (825), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 272/815 (33%), Positives = 382/815 (46%), Gaps = 155/815 (19%)

Query: 603  NVNRASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDN 662
            N  R SR+  R S +P  +RGS+TTKLISTYA+L+E+DDWE+IEKETKR SS+FATLID 
Sbjct: 504  NSKRLSRASVRLSFKPTNKRGSVTTKLISTYAKLSEEDDWEYIEKETKRTSSDFATLIDE 563

Query: 663  IFEHEKYEQIRKEKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGD 722
            IFEHEK+EQIRKEK                                              
Sbjct: 564  IFEHEKFEQIRKEKAELERRVKETKEREERERKEREEKELNEKLENDARQKREMEAQEAQ 623

Query: 723  IDNAKETVQTTEGKREAHND--KIKTETDDEERDIIVDIQPRSVSAPLEKTEKSRDSPFD 780
             D+  +T        +A N    +    + ++RD +V++Q     + +E          +
Sbjct: 624  GDDGTDTESDVHSNNQAPNGVRSVSAPLERKKRDSMVNVQ-----SDIE----------E 668

Query: 781  YSKQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHSTEDLHSTSSLNRIDTQKVILETI 840
               QR  SL+TRPVSRLDPGL Y+  +         +  +   T    ++ TQK ILETI
Sbjct: 669  IFGQRTMSLQTRPVSRLDPGLFYAEES---------NEPEAGDTEEEKKLRTQKNILETI 719

Query: 841  RRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAFQDSHLEEMNDVTEDLSQHNVDTSNDRIV 900
            RRSKFLGSSFD                          +E+ +  E+L +       DR V
Sbjct: 720  RRSKFLGSSFDIG------------------------KELQN--EELKKKASQPHRDRTV 753

Query: 901  STTNDRYETEILPKSHAGKTQTIGLNDSSVQPRTLSEIKVPQFTRKSKFFSESNKRLSVL 960
            S TN+ Y+T +LP        T  L D   +PR +SEI VPQFTRKS+FFS+SNKRLSVL
Sbjct: 754  SQTNEPYDTRVLPTQAVA---TAPLRDQ--EPRKISEISVPQFTRKSRFFSDSNKRLSVL 808

Query: 961  SLYSSRESFTNLVDMLKE----DGINVEPTERSPTTKSQEPEFLFESPSVDTYSRDSSTE 1016
            S+YS++ S+ NL ++L +    DG      E S     +EPEF FE+       R++S E
Sbjct: 809  SMYSTKHSYNNLSNLLNDSDASDGRLNSAAEYSDVKGKKEPEFQFEA------VREASDE 862

Query: 1017 DKPINEKENSEPIQSN-------------------NLRLSFHDRFNRQLSTEDTEKTKNS 1057
            D  I+   N++    N                   N++L+F DRF+              
Sbjct: 863  DNGISRLSNNDERLRNVSGTSGGSGVPHDNLSSKHNMKLNFADRFS-------------- 908

Query: 1058 PSGHIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPL-TTKKTDGLGIYQKSKQRTSS 1116
                  DEP      G   S+  +K+    VKLP LPPL  T + +GLGIYQ S    S 
Sbjct: 909  -----ADEPTA----GSSNSSSASKN----VKLPTLPPLDGTSEANGLGIYQSS----SE 951

Query: 1117 NASNPITPSSTNAQLTSAAVNVTPPTTTMINESIQKLQESREKVNNSSKLIPPKNSEIIS 1176
            +  + + P+               P + + + S    QE  E+V      +  K+S I +
Sbjct: 952  SFRDIVEPT---------------PKSKLQDNSSNPEQEVEEEVAGREGSV--KHSAIDT 994

Query: 1177 QQNESVQIRDDYKTKPERSNKADQSERAPPAETTLNDVMTKRNQSKSRDNPQPSEEGKKG 1236
               E  +  D    K   S + + +         LND M KR     R N   + +G+ G
Sbjct: 995  ASKERSKRTDRIDAKKPSSFQENLASAGASKGPPLNDSMPKRRNEDPR-NGSTAAKGENG 1053

Query: 1237 VXXXXXXXXXXXXXXXXXXXXXXXXLADDKNIPSVPKPVAHPASPVSTSNDYDFQLKANV 1296
                                      +D K   S  +  +      +T  D   ++   V
Sbjct: 1054 RAPLKDITTN----------------SDKKRNVSFFRKFSKSNEKDTTGFDG--EINTTV 1095

Query: 1297 AAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFELEIISNSVK 1356
            +A Q+F GL  L  GW++YGLK+++S PE +  TGK++SENILS +ST+FE+ + S   K
Sbjct: 1096 SAKQLFLGLQNLLHGWTQYGLKDVRSHPEKMTLTGKLTSENILSLRSTLFEMVVWSRG-K 1154

Query: 1357 TCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLLK 1391
              ++ F+K SGSSK++RRLV+EVE VL KEGV+ K
Sbjct: 1155 VSVVGFRKKSGSSKAMRRLVSEVEKVLLKEGVISK 1189

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/502 (66%), Positives = 382/502 (76%), Gaps = 39/502 (7%)

Query: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLL-T 70
           +K NT+GPWKLGETLGLGSTGKVQLA N STGQ+AA+KVISKAVF              T
Sbjct: 11  IKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNSGNVSGTSIVGSNT 70

Query: 71  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPE 130
           PD+LPYGIEREIIIMKLLNHPNVLRLYDVWET+++LY+VLEYAEKGELFNLLVERGPLPE
Sbjct: 71  PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPE 130

Query: 131 NEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETS 190
           NEAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE KLLETS
Sbjct: 131 NEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETS 190

Query: 191 CGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQF 250
           CGSPHYAAPEI+SG+PY G  +DVWSCG+ILFALLTGRLPFDEEDGNIR LLLKVQ G+F
Sbjct: 191 CGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRALLLKVQKGEF 250

Query: 251 EMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTY 310
           E+P +DEISREAQDLISKILTVDP++RIK R+ILKHPL+QKYPSI+DSK+IR+LPREDTY
Sbjct: 251 ELPSDDEISREAQDLISKILTVDPERRIKARDILKHPLLQKYPSIRDSKSIRDLPREDTY 310

Query: 311 LNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDT 370
           L PLS+ N     ID  ILQNLV+LWHGRD   I  KL+EPGANAEKTLYALL RFK DT
Sbjct: 311 LTPLSESN---SSIDATILQNLVILWHGRDPDGIRAKLQEPGANAEKTLYALLYRFKCDT 367

Query: 371 EKEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSAHK 430
           +KE+               + S     ++            TP +R+NR S++SVSS+ K
Sbjct: 368 QKELIKQQQIRKRQSIGSVSISPPKRTST------------TPQRRRNRESIISVSSSRK 415

Query: 431 RPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSSNKRISQL 490
           +P+SFN+ + +                      SS  L    SSKR+S N SS K++S +
Sbjct: 416 KPISFNKFTASS--------------------ASSSNLTTPGSSKRLSKNFSSKKKLSTI 455

Query: 491 LANDLNTSPTPSNCTKRMSIIN 512
           +     +SPTPS+  KR SI N
Sbjct: 456 VN---QSSPTPSSRNKRTSIAN 474

 Score =  255 bits (651), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 181/464 (39%), Positives = 258/464 (55%), Gaps = 80/464 (17%)

Query: 606  RASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFE 665
            RAS+S +R S+ P+M+R S+TTKL+STYA+LAEDDDWE+IEKETKR SSNFATLID IFE
Sbjct: 493  RASKSTRRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFE 552

Query: 666  HEKYEQIRKEKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDIDN 725
            +EKY+QIRKEK+                                              + 
Sbjct: 553  YEKYDQIRKEKEELERKVKEAKALEELERRKRKQEEK---------------------ER 591

Query: 726  AKETVQTTEGKREAHNDKIKTETD--DEERDII------VDIQPRSVSAPLEKTEKS--- 774
            A++ ++  E KR+    K + + D  D E ++I       +   RS+SAP+E  E +   
Sbjct: 592  ARKLLEKEELKRKQEELKKQIDIDISDLEHELINHREEKFEGNIRSISAPMENEENNINH 651

Query: 775  RDSPFD-YSKQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHSTEDLHSTSSLN-RIDT 832
             ++  D   ++RNFSL+TRPVSRLDPG+++SS        P  + + +    + N R+ T
Sbjct: 652  LEADIDNILRRRNFSLQTRPVSRLDPGIIFSS--------PIETEDPVEPKKAENERLTT 703

Query: 833  QKVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAFQDSHLEEMNDVTEDLSQHNV 892
            +K ILETIRRSKFLGSSF+                     ++  L +M        Q   
Sbjct: 704  EKKILETIRRSKFLGSSFNID-------------------KELKLSQMEYPGMAAPQR-- 742

Query: 893  DTSNDRIVSTTNDRYETEILPKSHAGKTQTIGLNDSSV----------QPRTLSEIKVPQ 942
              S +RIVS +N +YE+ +LPK   G      L D++           + R +S+I+VPQ
Sbjct: 743  -LSEERIVSDSNGKYESLVLPKDAKGVAH---LKDNTAPTTTELLSNGELRKISDIRVPQ 798

Query: 943  FTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINVEP--TERSPTTKS-QEPEF 999
            FTRKS+ FSESNKRLSVLS+YS++ESFTNLVD+LK   +++ P   +R PT +S  + EF
Sbjct: 799  FTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDINPQQNQRVPTPRSADDSEF 858

Query: 1000 LFESPSVDTYSRDSSTEDKPINEKENSEPIQSNNLRLSFHDRFN 1043
            LFE+ + +     +S+ D+ + +  +S     N L+L+F DRFN
Sbjct: 859  LFETVNEEAEYTGNSSNDERLYDVGDSCIKDKNTLKLNFADRFN 902

 Score =  116 bits (290), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 75/100 (75%), Gaps = 1/100 (1%)

Query: 1292 LKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFELEII 1351
            L A V+A Q+F GL+ L RGW++YGLKN+KS+P +L  TGK+SSEN+ S +ST+FE+ I 
Sbjct: 1030 LYAKVSAKQLFNGLEKLLRGWNQYGLKNVKSNPNNLTLTGKLSSENMFSLRSTLFEVSIY 1089

Query: 1352 SNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLLK 1391
                K  ++ FKK SGS K+V++LV EVENVL KEGVL K
Sbjct: 1090 QKG-KVSVVEFKKISGSFKTVKKLVKEVENVLNKEGVLQK 1128

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/509 (65%), Positives = 389/509 (76%), Gaps = 28/509 (5%)

Query: 4   LTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXX 63
           +TNK +  +KG+ +G WK+GETLGLGSTGKVQLAYN +TG QAAIKVISK +F       
Sbjct: 2   ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTS 61

Query: 64  XXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLV 123
                 TPD+LPYGIEREI+IMKLLNH NVLRLYDVWET+SNLYMVLEYAEKGELFNLLV
Sbjct: 62  MVDNT-TPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLV 120

Query: 124 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 183
           ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLD KYNIKIADFGMAALETE
Sbjct: 121 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETE 180

Query: 184 DKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLL 243
           DKLLETSCGSPHYAAPEI+SG+PYHG  +DVWSCG+IL+ALLTGRLPFDEEDGNIRNLLL
Sbjct: 181 DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLL 240

Query: 244 KVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRN 303
           KVQ+GQFEMP +DEIS+EAQ+LISKIL V+P +RI  R+ILKHPL+QKYPSIKDSK+IRN
Sbjct: 241 KVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRN 300

Query: 304 LPREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALL 363
           LPREDTYL+PL++ N     ID  ILQNLVVLWHGRD  EI  KLKE GANAEKTLYA+L
Sbjct: 301 LPREDTYLHPLAETN---SAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAML 357

Query: 364 DRFKNDTEKEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMV 423
           +RFK D E+E                T     +N S   + S G    TP ++KNRAS++
Sbjct: 358 NRFKLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTP-RKKNRASVI 416

Query: 424 SVSSAHKRPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSS 483
           SV+S+HKRP+SF +L   + ++ +            + I  S + +R    KR+S     
Sbjct: 417 SVTSSHKRPISFQKLPTLNSTSSL------------AAITPSTSARR----KRLS----- 455

Query: 484 NKRISQLLANDLNTSPTPSNCTKRMSIIN 512
             +IS    +++N SPTP++  KR S+ N
Sbjct: 456 --KISGYPVSNVNGSPTPASRKKRNSMAN 482

 Score =  144 bits (364), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 121/356 (33%), Positives = 176/356 (49%), Gaps = 76/356 (21%)

Query: 760  QPRSVSAPLEKTEKSRDSPF-DYSKQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHST 818
            + RSVS PL K +   +    +  +QRN +L+TRP SRLDPGL + S   S   NPS   
Sbjct: 636  ESRSVSEPLNKKQGGVEIEVKELLRQRNAALQTRPKSRLDPGLFFDSAE-SDTRNPSL-- 692

Query: 819  EDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAFQDSHLE 878
              +      N++ T+K ILETIRRSKFLGSSFD            S  +K  +       
Sbjct: 693  -QVFEGEVDNKLKTEKAILETIRRSKFLGSSFDI-----------SKELKSAS------- 733

Query: 879  EMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQTIGLNDSSVQPRTLSEI 938
                     ++ +   +  R+++  ++   +++LPK +A  T  + ++    + R +S+I
Sbjct: 734  ---------ARSDYSRAPGRVITAPSNLERSDVLPK-NAIATAPLRIHSDQPEVRKISDI 783

Query: 939  KVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINVEPTER-----SPTTK 993
            KVPQFTRKS+ FSES+KRLSVLS+YS+R+SF NL DM+  +  N +  E      +P + 
Sbjct: 784  KVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFESENTDAAENRGQIATPNSA 843

Query: 994  SQEPEFLFESPSVDTY-SRDSSTEDKPINEKENSEPIQSNNLRLSFHDRFNRQLSTEDTE 1052
             Q  EFLFES + +   + ++ST+ K     E+ E      LR++  DR+N+  S  D E
Sbjct: 844  GQS-EFLFESVNEEAENTNNTSTDGKLYEVSESPESSSKKGLRVNLSDRYNKANSEADME 902

Query: 1053 KTKNSPSGHIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPLTTKKTDGLGIYQ 1108
                                                KLP LPPL   +  GLGIYQ
Sbjct: 903  N-----------------------------------KLPILPPLDP-EIAGLGIYQ 922

 Score =  109 bits (273), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 61/69 (88%)

Query: 609 RSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFEHEK 668
           R+ KR S+ PN + G+I +KLISTYA+L+EDD+WE++E+ETKR SSNFATLID IFEHEK
Sbjct: 502 RASKRVSILPNNKNGTIASKLISTYAKLSEDDEWEYLEQETKRTSSNFATLIDEIFEHEK 561

Query: 669 YEQIRKEKD 677
           YEQIRKEK+
Sbjct: 562 YEQIRKEKE 570

 Score =  103 bits (256), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/95 (53%), Positives = 69/95 (72%), Gaps = 1/95 (1%)

Query: 1296 VAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFELEIISNSV 1355
            V+A QM++GL  L RGW  YGLK+IK + E++  TGK++SENILS +ST+FE+ II    
Sbjct: 1029 VSATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIREG- 1087

Query: 1356 KTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLL 1390
            K   +  KK SGS+K+V RL  EV+NVL KEGV++
Sbjct: 1088 KGSKVDIKKKSGSTKAVNRLAGEVKNVLVKEGVMI 1122

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/527 (63%), Positives = 398/527 (75%), Gaps = 75/527 (14%)

Query: 11  EVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXL-L 69
           ++KG+T+GPWKLG+TLGLGSTGKV+LAYN +T QQAAIK+ISK++F              
Sbjct: 9   KMKGDTIGPWKLGKTLGLGSTGKVELAYNETTSQQAAIKIISKSIFSQGTVGESSMVSNS 68

Query: 70  TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLP 129
           +PD+LPYGIEREIIIMKLL HPNVL LYDVWET+S LYM+LEYAEKGELFNLLVERGPLP
Sbjct: 69  SPDALPYGIEREIIIMKLLRHPNVLSLYDVWETNSKLYMILEYAEKGELFNLLVERGPLP 128

Query: 130 ENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLET 189
           E EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK NIKIADFGMAALET+DK+LET
Sbjct: 129 EKEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAALETKDKMLET 188

Query: 190 SCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQ 249
           SCGSPHYAAPEI+SG+PYHG ++DVWSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQSG+
Sbjct: 189 SCGSPHYAAPEIVSGVPYHGFQSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGE 248

Query: 250 FEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDT 309
           +EMP +DEIS+EAQDLI +ILTVDP++RIKTR+ILKHPL+QKYPSIKDS++I+NLPREDT
Sbjct: 249 YEMPDDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPLLQKYPSIKDSRSIKNLPREDT 308

Query: 310 YLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKND 369
           YL PLS++N     ID  ILQNLV LWHGRD  +I  KL+E GA+AEKT+YALL RFK +
Sbjct: 309 YLYPLSENNSI---IDDSILQNLVALWHGRDKDDIAGKLRESGADAEKTVYALLYRFKVE 365

Query: 370 TEKEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSAH 429
            EK                        NT +           +P +RKNR SM+SVSS+H
Sbjct: 366 AEK-----------------------MNTCS-----------SP-RRKNRISMISVSSSH 390

Query: 430 KRPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSSN--KRI 487
           KRPVS  ++S          T  N TP                S++R+SI+LSS   KR+
Sbjct: 391 KRPVSMKKIS----------TVQNNTP---------------PSNRRLSISLSSTQRKRM 425

Query: 488 SQLLANDLNTSPTPSNCTKRMSIIN-------GTPPVPMDIMKNYND 527
           S +L +  N+SPTPS  TKR+S+IN         PPVPM+++++Y +
Sbjct: 426 SGILQHT-NSSPTPSR-TKRISVINIDDSENKAPPPVPMEMLEDYKN 470

 Score =  124 bits (310), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 90/244 (36%), Positives = 134/244 (54%), Gaps = 64/244 (26%)

Query: 762  RSVSAPLEKTEKSRDSPFDYSKQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHSTEDL 821
            RSVSAP+++ E   ++  +   +R FSL+TRPVSRLDPG++YS+     A  PS+    +
Sbjct: 606  RSVSAPIKENEDEDENENELRNRRQFSLQTRPVSRLDPGILYSA----PAEIPSYERVVV 661

Query: 822  HSTSSLNRIDTQKVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAFQDSHLEEMN 881
            + + + +    Q+ ILETIRRSKFLGSSF+               I+Q+           
Sbjct: 662  NESGNKSSAQQQRKILETIRRSKFLGSSFN---------------IQQEL---------- 696

Query: 882  DVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQTIGLNDSSVQP--RTLSEIK 939
                + SQ NV      +V T                K Q + +++  ++   R +SE+K
Sbjct: 697  ----EFSQRNV------LVPT----------------KEQVVDVDEVKLEGGLRKISEVK 730

Query: 940  VPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINVEPTERSPTTKSQEPEF 999
            +PQFTRKS+ FS+SNKRLSVLS+YS+++S+TNL  +LK+     EP +++       PE 
Sbjct: 731  IPQFTRKSRHFSDSNKRLSVLSMYSTKQSYTNLGHILKDGTEESEPAKKT-------PEL 783

Query: 1000 LFES 1003
            LFES
Sbjct: 784  LFES 787

 Score =  105 bits (262), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 48/107 (44%), Positives = 72/107 (67%)

Query: 1283 STSNDYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFK 1342
            +T   YD ++  N+ + Q++ GL  L  GW++YGLK+++S   +++ TGK++++NILS +
Sbjct: 916  ATIKGYDHEIYVNIGSRQLYTGLRKLLEGWTQYGLKDVRSDNTAMKITGKLANDNILSLR 975

Query: 1343 STVFELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVL 1389
            ST+FEL +     K  L+ F K  GSSK VRRL  E+E VL KEGVL
Sbjct: 976  STLFELLVEPKGSKYSLIGFTKVQGSSKVVRRLFTEIEKVLNKEGVL 1022

 Score = 97.8 bits (242), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/59 (74%), Positives = 55/59 (93%)

Query: 619 NMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFEHEKYEQIRKEKD 677
           N +R SITTKL+STYA+L+EDD+WE+IE+ETKR SS+FATLID +FEHEKYE+IRKEK+
Sbjct: 495 NNKRVSITTKLLSTYAKLSEDDNWEYIERETKRTSSDFATLIDELFEHEKYERIRKEKE 553

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/515 (63%), Positives = 385/515 (74%), Gaps = 40/515 (7%)

Query: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTP 71
           ++G+ +GPWKLGETLG GSTGKV LA N+ TGQ AA+KVISK+VF              P
Sbjct: 11  LRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSN--DP 68

Query: 72  DSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPEN 131
           D LPYGIEREIIIMKLLNHPNVLRLYDVWET  +LYMVLEY EKGELFNLLV+RGPLPEN
Sbjct: 69  DVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPEN 128

Query: 132 EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSC 191
           EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAALE++DKLLETSC
Sbjct: 129 EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSC 188

Query: 192 GSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFE 251
           GSPHYAAPEI+SGLPYHG E+DVWSCG+IL+ALLTGRLPFDEEDGNIRNLLLKVQSG++E
Sbjct: 189 GSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYE 248

Query: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYL 311
           +PG DEIS EA+DLI +ILTV+P++RIKTREILKHPL+QKYPSIKDSK+IRNLPREDTYL
Sbjct: 249 IPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYL 308

Query: 312 NPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDTE 371
           NPL  ++G    ID  ILQNLVVLWHGRD  EIT KLKEPGAN EKT YALL RFK   E
Sbjct: 309 NPLDHNDGT---IDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFK--FE 363

Query: 372 KEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSAHKR 431
            E                + S   +   + S  S   +++TP  +K R+S ++VSSAHKR
Sbjct: 364 NEQQQLKQQQIAKRISSTSSSPQQNIVKSSSRRSINNILSTP--KKKRSSAINVSSAHKR 421

Query: 432 PVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSSNKRISQLL 491
           PVS  +L+                          GTL   S SK+ S+   SN+++S +L
Sbjct: 422 PVSIQKLN------------------------DCGTLNPTSPSKKRSL---SNRKLSAVL 454

Query: 492 ANDLNTSPTPSNCTKRMSIINGTPPVPMDIMKNYN 526
           A   ++SP+     KRMS+    PPVP  ++++YN
Sbjct: 455 AGSNSSSPS----RKRMSVGQDAPPVPTAVLRDYN 485

 Score =  140 bits (353), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 125/369 (33%), Positives = 175/369 (47%), Gaps = 75/369 (20%)

Query: 762  RSVSAPLEK--TEKSRDSPF--------DYSKQRNFSLRTRPVSRLDPGLMYSSGTGSSA 811
            RS+S P+E+  T  S+   F           K+R  SL TRP+SRLDPG+  S       
Sbjct: 638  RSISEPMERKGTRPSKRDSFLALQNNINSLLKRRTLSLETRPISRLDPGIRLSEEN---- 693

Query: 812  YNPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQA 871
               +   +DL      +R+  +K ILETIRRSKFLGS +D              ++  + 
Sbjct: 694  ---TILEDDLECNE--DRLRVEKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRK 748

Query: 872  FQDSHLEEMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQTIG-LNDSSV 930
             QD  LE          Q     S+   V+++++  E+ ILPK+       IG L D   
Sbjct: 749  SQDRKLEP----GLHSRQEQRFVSDGTTVTSSHEDSESIILPKN----VTAIGVLKDEES 800

Query: 931  QPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDG--INVEPTER 988
            +PR LSE+K+PQFTR+SK FS S+KRLSVLS+YS++ S+TNL D L  D    +++P+  
Sbjct: 801  EPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYTNLADYLNNDVQLKSLQPSAP 860

Query: 989  SPTTKSQEPEFLFESPSVDTYSRDSSTEDKPI--------NEKENSEPIQSNNLRLSFHD 1040
            +     QEPEF+FES   +   + ++  D  +         + E  EP++   L  S  D
Sbjct: 861  TSIKIPQEPEFMFESAGQENRYQAAAPTDTYLERPKVGVEGDHEPGEPVELIELDDS-ED 919

Query: 1041 RFNRQLSTEDTEKTKNSPSGHIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPLT-TK 1099
            R ++Q S ED  K                                  VKLP LPPL    
Sbjct: 920  R-SKQYSEEDIAK----------------------------------VKLPILPPLDHLN 944

Query: 1100 KTDGLGIYQ 1108
            K +GLGIYQ
Sbjct: 945  KPNGLGIYQ 953

 Score =  110 bits (274), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/72 (70%), Positives = 65/72 (90%), Gaps = 1/72 (1%)

Query: 606 RASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFE 665
           RASR+ KR S  P+ +RGSITTK+I+TYA+L+ED+DWE+I++E KR SS+FATLIDNIFE
Sbjct: 487 RASRASKRLSFLPS-KRGSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFATLIDNIFE 545

Query: 666 HEKYEQIRKEKD 677
           HEKYEQIR+EK+
Sbjct: 546 HEKYEQIRREKE 557

 Score =  103 bits (257), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/105 (47%), Positives = 69/105 (65%)

Query: 1286 NDYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTV 1345
            +D D QL   V   +MF+ L+ L  GW+ YGLK ++S P S   TGK+SS+NILS +ST 
Sbjct: 1035 SDCDVQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTA 1094

Query: 1346 FELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLL 1390
            FE+ I+S +     ++F K SGS K+  RLVNE+E +L KE VL+
Sbjct: 1095 FEIVILSVADTGSSVKFTKKSGSKKTFTRLVNEIEKILEKESVLV 1139

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/503 (63%), Positives = 376/503 (74%), Gaps = 41/503 (8%)

Query: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTP 71
           +K N +GPWKLGETLG GSTGKV LA N +T QQAA+KVISKAVF               
Sbjct: 12  IKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGD--AT 69

Query: 72  DSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPEN 131
           ++LPY IE+EIIIMKLLNHPNVLRL+DVWET+S+LY+VLEYAEKGELFN+LVERGPLPEN
Sbjct: 70  NALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPEN 129

Query: 132 EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSC 191
           EA+R FRQIIIGISYCH+LG+VHRDLKPENLLLD+K NIKIADFGMAALE+EDKLLETSC
Sbjct: 130 EAVRAFRQIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESEDKLLETSC 189

Query: 192 GSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFE 251
           GSPHYAAPEIISGLPY G  +DVWSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQ G+FE
Sbjct: 190 GSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFE 249

Query: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYL 311
           MP +DEI++EAQDL++++LTVDP KRI  REILKHPL+QKYPSIKDS++IRNLPREDTYL
Sbjct: 250 MPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPREDTYL 309

Query: 312 NPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDTE 371
           +PL+D N    +ID  ILQNLV+LWHG+D++EI  KL+EPGAN EKTLYALL RFK DT+
Sbjct: 310 SPLADTN---SKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFKCDTQ 366

Query: 372 KEIXXXXXXXXXXXXXXXTHS---HSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSA 428
           +E                  S    S S    Y          TP K+  RAS+++ SS 
Sbjct: 367 REANRARRQSKIVQRNSTIRSTAPESPSKKKTY----------TPQKKNKRASIIASSS- 415

Query: 429 HKRPVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSSNKRIS 488
            KRPVS  + +    +N  +N+ I GTP+               S+KRMS+N S+ KR+S
Sbjct: 416 -KRPVSVTKTA----TNITVNSSITGTPK---------------SAKRMSMNNSARKRMS 455

Query: 489 QLLANDLNTSPTPSNCTKRMSII 511
            L       SPT ++ ++R SII
Sbjct: 456 ALYGT--RDSPTKTSRSRRSSII 476

 Score =  114 bits (286), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 65/71 (91%)

Query: 606 RASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFE 665
           RAS+S KR S+ PN++R S+TTKL++TYA+L+EDDDWE+IE+ETKR SS+FATLID IFE
Sbjct: 497 RASKSSKRISLVPNLKRQSVTTKLMATYAKLSEDDDWEYIERETKRTSSDFATLIDEIFE 556

Query: 666 HEKYEQIRKEK 676
           +EKYEQIRKEK
Sbjct: 557 YEKYEQIRKEK 567

 Score =  111 bits (277), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 93/239 (38%), Positives = 129/239 (53%), Gaps = 48/239 (20%)

Query: 762 RSVSAPLE-KTEKSRDSPFDYS---KQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHS 817
           RSVS PLE K++K  D   D     + R +SL+TRPVSRLDPG+ +          P  S
Sbjct: 635 RSVSEPLESKSKKIEDIEEDIDGILRNRKYSLQTRPVSRLDPGIGFID-------KPRQS 687

Query: 818 TEDLHSTSSLN--RIDTQKVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAFQDS 875
            + +  T +L     +T++ ILETIRRSKFLGSSFD               IK++     
Sbjct: 688 EQHVPETVNLEPELEETEQKILETIRRSKFLGSSFD---------------IKKE----- 727

Query: 876 HLEEMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQTIGLNDSSVQPRTL 935
                    E++ +H    ++  I          E LPK+   K  ++   D S+  R +
Sbjct: 728 --------LENVKRHR--QTSQPIEKEMAPPALPETLPKAVEKKNVSM---DPSL--RKI 772

Query: 936 SEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINVEPTERSPTTKS 994
           S+IKVPQFTRKS+ FS SN+RLSVLS+YS++ES++NL D+LK      E  + +PT KS
Sbjct: 773 SDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNGPGEKEMIQTAPTPKS 831

 Score = 98.2 bits (243), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 69/104 (66%), Gaps = 1/104 (0%)

Query: 1286 NDYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTV 1345
            ++ D  L  +V++ Q+F GL  L +GW+KYGLK I     S   TGK++++NILSF+ST 
Sbjct: 999  DNVDVTLSTSVSSKQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTA 1058

Query: 1346 FELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVL 1389
            F + I S   K   + F+K SGS K+VRRL +EV+ VL KEGVL
Sbjct: 1059 FSILIFSQE-KGSAVTFRKVSGSGKAVRRLSDEVKKVLSKEGVL 1101

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/515 (62%), Positives = 372/515 (72%), Gaps = 39/515 (7%)

Query: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTP 71
           +KG  +GPW LGETLG+GSTGKV +A N  TGQ AA+K+ISK++F              P
Sbjct: 12  LKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSN--DP 69

Query: 72  DSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPEN 131
           D LPYGIEREI IMKLLNHPNVLRLYDVWET ++LYMVLEY EKGELFNLL+ERGPLPEN
Sbjct: 70  DVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPEN 129

Query: 132 EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSC 191
           EA+RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAALE++DKLLETSC
Sbjct: 130 EAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSC 189

Query: 192 GSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFE 251
           GSPHYAAPEI+SGLPYHG E+DVWSCG+IL+ALLTGRLPFDE+DGNIR LLLKVQSG+FE
Sbjct: 190 GSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFE 249

Query: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYL 311
           MP  DEIS EAQDLI+KILTVDP  RIKTREILKHPL++KYPSIKDSK+IRNLPREDTYL
Sbjct: 250 MPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPREDTYL 309

Query: 312 NPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDTE 371
           NPL  ++G V   D  IL+NLVVLWHGRD  EI  KL E G N EKT YALL RFK   E
Sbjct: 310 NPLDHNDGTV---DRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFK--YE 364

Query: 372 KEIXXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSAHKR 431
            E                + S   +   + S  S   ++ TP  +K R+S ++VSSAHKR
Sbjct: 365 NEQQQLKQQQIAKRISSASSSPQRNIVKSSSRRSINQILVTP--KKKRSSGINVSSAHKR 422

Query: 432 PVSFNRLSRADLSNHVINTGINGTPQRHSQIESSGTLQRNSSSKRMSINLSSNKRISQLL 491
           PVS  +          I  G NG                 S SK+ S+   SN+++S +L
Sbjct: 423 PVSIQKWGE-------IGGGNNGLI---------------SPSKKRSL---SNRKLSAIL 457

Query: 492 ANDLNTSPTPSNCTKRMSIINGTPPVPMDIMKNYN 526
                 +P+ S   KRMSI    PP+P  ++++YN
Sbjct: 458 -----NTPSSSPSRKRMSIAQDAPPMPTSVLRDYN 487

 Score =  146 bits (368), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 127/381 (33%), Positives = 199/381 (52%), Gaps = 64/381 (16%)

Query: 762  RSVSAPLEK--TEKSRDS--PFDYS-----KQRNFSLRTRPVSRLDPGLMYSSGTGSSAY 812
            RSVS P ++  +   RDS     YS      +R  S++TRP+SRLDPG+M        A+
Sbjct: 666  RSVSEPHKRHSSTSKRDSLLALQYSINTVLNKRAVSVQTRPISRLDPGIM----AQEVAH 721

Query: 813  NPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAF 872
               +  E++ S  +L R   +K ILETIRRS FLGS FD             N  K++  
Sbjct: 722  ELDYDDEEILSERTLRR---EKTILETIRRSNFLGSQFDIHKELK-------NAKKEKIE 771

Query: 873  QDSHLEEMNDVTED-LSQHNVD-TSNDRIVSTTNDRYETEILPKSHAGKTQTIG-LNDSS 929
            +    +++N    D +S H+    S+   +++ +D Y+T  L +       T+G L D  
Sbjct: 772  KAKKRKQLNRKLPDRISYHDQRFVSDGTTITSAHDGYDTTSLTRH-----TTVGVLRDDE 826

Query: 930  VQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINVEPTERS 989
             +P+ LSE+++P+ TR+S+  S S+KR SVLS+YS+  S+TNL D +K D + ++P   +
Sbjct: 827  SEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFMKSD-VQLKPLNDT 885

Query: 990  PTTK-SQEPEFLFESPSVDTYSRDSSTEDKPINEKENSEPIQSNN--LRLSFHDRFNRQL 1046
             ++K +Q+PEF+FES ++D   R SS ++  I+  E       NN  ++L++ DRF + +
Sbjct: 886  ASSKVTQQPEFMFES-TIDNVERISSNDNSHISSME-----APNNTVIKLNYADRFYKPV 939

Query: 1047 STEDTEKTKNSPSGHIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPL--TTKKTDGL 1104
               + + T N                    + P  +++   VKLPALPPL    K  +GL
Sbjct: 940  EVIELDDTDN--------------------TQPDTEEDITKVKLPALPPLEKLNKSPNGL 979

Query: 1105 GIYQKSKQRTS-SNASNPITP 1124
            GIYQ S  R    +A   +TP
Sbjct: 980  GIYQHSSPREDFKHAVRSVTP 1000

 Score =  110 bits (276), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 50/72 (69%), Positives = 65/72 (90%)

Query: 606 RASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFE 665
           RASR+ KR S  P+++R SIT+K+I+TYA+L+ED+DWE+I+KE KR SS+FATLIDNIFE
Sbjct: 489 RASRNSKRFSFLPSIKRQSITSKIIATYAKLSEDNDWEYIDKEAKRTSSDFATLIDNIFE 548

Query: 666 HEKYEQIRKEKD 677
           HEKYEQIR+EK+
Sbjct: 549 HEKYEQIRREKE 560

 Score =  104 bits (260), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 70/104 (67%), Gaps = 1/104 (0%)

Query: 1287 DYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVF 1346
            +YD+QL   V   +MF+ LD L  GW+ YGLK ++SSP     TGK+SS+NILS +ST F
Sbjct: 1059 EYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPSVSMITGKLSSDNILSLRSTAF 1118

Query: 1347 ELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLL 1390
            ++ +++ S     +RF K SGS K+  RLVNE+E +L KE VL+
Sbjct: 1119 QV-VVAGSNHGSSVRFTKKSGSKKTFARLVNEIEKILEKEKVLI 1161

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score =  560 bits (1442), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 288/499 (57%), Positives = 352/499 (70%), Gaps = 30/499 (6%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSL 74
           N +GPWKLGETLG GSTGKVQLA +  TGQ+ A+KVI K++F           +L     
Sbjct: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVL----- 70

Query: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAI 134
           P+ IEREI+IMKLL+HPNVL LYDVWETD+NLY++LEYAEKGELFNLLV+RGPLPE EAI
Sbjct: 71  PFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAI 130

Query: 135 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSP 194
           + F+QIII ISYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAAL+T+  +LETSCGSP
Sbjct: 131 KCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSP 190

Query: 195 HYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPG 254
           HYAAPEI+SGLPY G  +DVWSCG+ILFALLTGRLPFDEE+GN+R+LLLKVQ GQFEMP 
Sbjct: 191 HYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPN 250

Query: 255 NDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPL 314
           N EIS +AQDLI +IL VDP +RIK R+IL HPL++KY +IKDSK+I++LPRE+TYL PL
Sbjct: 251 NAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPL 310

Query: 315 SD-DNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDTEKE 373
           +D DN     ID  ILQNLV+LWHGR ++EI KKL++ G N EKTLYALL RFK ++ KE
Sbjct: 311 ADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKE 370

Query: 374 IXXXXXXXXXXXXXXX-----------THSHSNSNTSAYSHVSRGALVNTPTKRKNRASM 422
                                        +H + +++   H SRG   N P+ RK  + +
Sbjct: 371 TNKRSRSKINKTKKSKRVSTLSSSSSSAFNHQSLDSAPRKHASRGHSKNFPSSRKRSSFI 430

Query: 423 VSVSSAHKRPVSFNRLSRADLSNHVINTGINGTPQRHSQI-ESSGTLQRNS--SSKRMSI 479
           +S +S    P+      R  +S+ V        P    Q+ +SS  L+RNS  SSKR+S 
Sbjct: 431 LSSNSTDCSPIPLRSSKRISISSAV--------PGNTLQVPDSSLKLKRNSKRSSKRLSY 482

Query: 480 --NLSSNKRISQLLANDLN 496
             NL      + LL+N  N
Sbjct: 483 MPNLGRGSLTTNLLSNYTN 501

 Score = 95.9 bits (237), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 59/82 (71%)

Query: 595 QTSDSAAQNVNRASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSS 654
           Q  DS+ +    + RS KR S  PN+ RGS+TT L+S Y  L +DDDWE+I+K+TKR SS
Sbjct: 461 QVPDSSLKLKRNSKRSSKRLSYMPNLGRGSLTTNLLSNYTNLIDDDDWEYIDKDTKRTSS 520

Query: 655 NFATLIDNIFEHEKYEQIRKEK 676
           NFATLID IFE EK+E  ++EK
Sbjct: 521 NFATLIDEIFEPEKFELAKREK 542

 Score = 85.1 bits (209), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 67/101 (66%)

Query: 1289 DFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFEL 1348
            +  ++A ++  ++++GL  L  GW +YGLKN+  +   +  +GK+ ++ ILS +ST+FE+
Sbjct: 930  ELDVRAKISEKRLYEGLHKLLEGWKQYGLKNLGINTADMIISGKLVNDGILSLRSTLFEI 989

Query: 1349 EIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVL 1389
             I+ N     L++F K +GS+K++ +   E++ +L+KEGVL
Sbjct: 990  VILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQKEGVL 1030

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 108/403 (26%), Positives = 170/403 (42%), Gaps = 109/403 (27%)

Query: 764  VSAPLEKTEKSRDSPFD-----YSKQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHST 818
            VS+PL   E S+           + +   S  TRP+SRLDPGL  +  TG+  ++    T
Sbjct: 586  VSSPLMNYEFSQKELLQDIDTLLTNRYQLSSYTRPISRLDPGL--TPVTGAIPHSIKEKT 643

Query: 819  EDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAFQDSHLE 878
              L         DT+  I+ETIR+S+FLGS                              
Sbjct: 644  ALLQ--------DTEMKIIETIRKSEFLGS------------------------------ 665

Query: 879  EMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQTIGLNDSSVQPRTLSEI 938
             + +V E +SQ N            N     E+ PK     T  +  ND  V+ R +S++
Sbjct: 666  -LLNVREGISQDN------------NQLASIEVSPKI---STTPLMYNDQ-VEIRKISDV 708

Query: 939  KVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINVEPTERSPTTKSQEPE 998
            +VP FTRKSK F+ +N R SVLSLYS +ES  +L                +  +K++EP 
Sbjct: 709  EVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDL----------------NQISKNEEP- 751

Query: 999  FLFESP---SVDTYSRDSSTE-DKPINEKENSEPIQSNNLRLSFHDRFNRQLSTEDTEKT 1054
               +SP   S D  S+    +  + + E++NS+  Q ++   +  +  N      D  + 
Sbjct: 752  ---DSPPQGSTDNASKSELVDVIEEVTEQKNSQHDQDDS---NDSNGMNNNNILYDVPEC 805

Query: 1055 KNSPSGHIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPLTTKKTDGLGIYQKSKQRT 1114
             +SP G+       +D +       K+ +   +VKLP+L     K   GLGIYQ+   R 
Sbjct: 806  VDSPQGY-----DINDAHSTQSPASKSTEPKPVVKLPSLSSFQRKNASGLGIYQRESSRE 860

Query: 1115 SSNASNPITPSSTNAQLTSAAVNVTPPTTTMINESIQKLQESR 1157
            S               L S  +N++    T  NE+ ++++  +
Sbjct: 861  S---------------LPSVTINISESDKTTENEAQKEIKHDK 888

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score =  546 bits (1407), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 255/356 (71%), Positives = 293/356 (82%), Gaps = 6/356 (1%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           T+GPWKLGETLG GSTGKVQLA +  TG + A+KVISK++F           +L     P
Sbjct: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVL-----P 71

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 135
           Y IEREI+IMKLL+HPNVL LYDVWET++NLY++LEYAEKGELFNLLV+ GPLPE EAI 
Sbjct: 72  YNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAIN 131

Query: 136 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 195
            FRQIIIGISYCHALGIVHRDLKPENLLLD  YNIKIADFGMAAL+T+  LLETSCGSPH
Sbjct: 132 CFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPH 191

Query: 196 YAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGN 255
           YAAPEI+SGLPY G  +DVWSCG+ILFALLTGRLPFDEE+GN+R+LLLKVQ GQFEMP +
Sbjct: 192 YAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPND 251

Query: 256 DEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPLS 315
            EISR+AQDLI KIL VDP++RIK R+IL HPL++KY +IKDSK+I++LPRE+TYL PL+
Sbjct: 252 TEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLA 311

Query: 316 DDNGDV-CEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDT 370
           D N      ID  ILQNLVVLWHGR + +I  KLKE G N EK LYALL RFK D+
Sbjct: 312 DSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367

 Score =  129 bits (324), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 155/541 (28%), Positives = 231/541 (42%), Gaps = 163/541 (30%)

Query: 591  STNGQTSDSAAQN---VNRASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEK 647
            S N Q + S   N    N   RS KR S  PN +R S+T+K +S +  L +DDDWE+IEK
Sbjct: 456  SANTQATPSGVPNPHKRNSKKRSSKRLSYMPNTKRSSLTSKSLSNFTNLIDDDDWEYIEK 515

Query: 648  ETKRVSSNFATLIDNIFEHEKYEQIRKEKDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 707
            + KR SSNFATLID IFE EK+E  ++EK                               
Sbjct: 516  DAKRTSSNFATLIDEIFEPEKFELAKREK------------------------------- 544

Query: 708  XXXXXXXXXXXXXGDIDNAKETVQTTEGKREAHN------DKIKTETDDEERDI--IVDI 759
                              A+   +  E KR++ N      D+  +E  D  +++  I D 
Sbjct: 545  ------------------AELQRKVQEAKRQSVNAQKINEDEFGSEVSDGMKELKKIND- 585

Query: 760  QPRSVSAPLEKTEKSRDSPFD-----YSKQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNP 814
                VS+PL   E S+           + +   S  TRP+SRLDPGL     T  +   P
Sbjct: 586  ---KVSSPLINYEFSQQELLQDIDTLLTNRYQLSSYTRPISRLDPGL-----TPVTETLP 637

Query: 815  SHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAFQD 874
            ++  E    T+ L   DT+K I+ETIRRSKFLGS  +                       
Sbjct: 638  NNLKE---KTALLQ--DTEKKIIETIRRSKFLGSLLNVRGGLSPGKS------------- 679

Query: 875  SHLEEMNDVTEDLSQHNVDTSNDRIVSTT----NDRYETEILPKSHAGKTQTIGLNDSSV 930
                E+  + E             IVSTT    NDR E                      
Sbjct: 680  ----ELAPIEE-----------SPIVSTTPLIYNDRME---------------------- 702

Query: 931  QPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINVEPTERSP 990
             PR +S+++VP FTRKSK F+ +N R SVLSLY +++S  +L + L ++  ++ P   + 
Sbjct: 703  -PRRISDVEVPHFTRKSKHFTTANNRRSVLSLY-AKDSIKDLNEFLIKEDPDLPPQGSTD 760

Query: 991  T-TKSQEPEFLFESPSVDTYSRDSSTEDKPINEKENSEPIQSNNLRLSFHDRFNRQLSTE 1049
              ++S++PE    + S+ T SR+   ++   ++ ++ + + ++N+   F           
Sbjct: 761  NESRSEDPEI---AESI-TDSRNIQYDE---DDSKDGDNVNNDNILSDF----------- 802

Query: 1050 DTEKTKNSPSG-HIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPLTTKKTDGLGIYQ 1108
                    P G  I  E    D N       K+ + + +VKLP+L     K   GLG+YQ
Sbjct: 803  --------PQGVGISQEYDMKDKNPNQSPISKSAEPTLVVKLPSLSSFQGKNASGLGLYQ 854

Query: 1109 K 1109
            +
Sbjct: 855  R 855

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 68/101 (67%)

Query: 1289 DFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFEL 1348
            + ++ A +   ++++GL  L  GW +YGLKN+  +  ++  TGK+ +++IL  +ST+FE+
Sbjct: 935  ELEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFEI 994

Query: 1349 EIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVL 1389
             ++ N     L++F K +GS+K++ +L  E++ +L+KEGVL
Sbjct: 995  MVLPNGDGRSLIKFNKKTGSTKTLTKLATEIQIILQKEGVL 1035

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score =  541 bits (1393), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 262/418 (62%), Positives = 313/418 (74%), Gaps = 17/418 (4%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSL 74
           +T+GPWKLGETLG+GS GKV+LA +  T  + A+K+ISK++F           +L     
Sbjct: 16  STIGPWKLGETLGVGSAGKVRLAQHEGTAHKTAVKIISKSIFNTEGNYGNHGSVL----- 70

Query: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAI 134
           PY IEREI+IMKLL+HPNVL LYDVWET++NLY++LEYAEKGELFNLLV+RG LPE EA+
Sbjct: 71  PYNIEREIVIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDRGALPEREAM 130

Query: 135 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSP 194
           + FRQIII +SYCHALGIVHRDLKPENLLLD  YNIK+ADFGMAAL+T+  LLETSCGSP
Sbjct: 131 KCFRQIIIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAALQTDAALLETSCGSP 190

Query: 195 HYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPG 254
           HYAAPEI+SGLPY G  +DVWSCG+ILFALLTGRLPFDEE+GNIR LLLKVQ GQFEMP 
Sbjct: 191 HYAAPEIVSGLPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPD 250

Query: 255 NDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPL 314
           + EIS++AQDLISKIL VDP +RIK R+IL HPL+++Y +IKDSK+I++LPREDTYL PL
Sbjct: 251 DTEISKDAQDLISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLPREDTYLYPL 310

Query: 315 SDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDTEKEI 374
           +D       ID  ILQNLVVLWHGR + EI  KLK  G N EKTLYALL RFK ++ +E 
Sbjct: 311 ADAG---AAIDDSILQNLVVLWHGRHADEIKAKLKASGTNTEKTLYALLYRFKLESMRE- 366

Query: 375 XXXXXXXXXXXXXXXTHSHSNSNTSAYSHVSRGA-LVNTPTKRKNRASMVSVSSAHKR 431
                          T    N   S  S + +G  L +TP KR ++    + SS  KR
Sbjct: 367 -------SNKRRRHKTKKTKNRKFSTSSSLVKGRNLESTPRKRTSKTHSNNFSSGKKR 417

 Score = 86.3 bits (212), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 53/67 (79%)

Query: 610 SQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFEHEKY 669
           S KR S  PN++ GS+T++L+S Y +L ++DDWE IEK+TKR SSNFATLID IFE E++
Sbjct: 468 SSKRSSYMPNLKSGSVTSRLLSNYNKLIDEDDWECIEKDTKRTSSNFATLIDEIFEPEEF 527

Query: 670 EQIRKEK 676
           E  ++EK
Sbjct: 528 ELAKREK 534

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 88/330 (26%), Positives = 147/330 (44%), Gaps = 83/330 (25%)

Query: 787  FSLRTRPVSRLDPGLMYSSGTGSSAYNPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFL 846
             S  TRP+S+LDPGLM ++GT         +  D+   ++L R DT+  I+ETI RSKFL
Sbjct: 598  LSAYTRPISKLDPGLMPAAGT---------TPHDIKEQTALIR-DTEVKIIETIHRSKFL 647

Query: 847  GSSFDXXXXXXXXXXXXSNRIKQQAFQDSHLEEMNDVTEDLSQHNVDTSNDRIVSTTNDR 906
            GS  +               +++   +D   +E+  + E             I+STT   
Sbjct: 648  GSLLN---------------VREGMSKDD--DELAPIEES-----------SIISTTPLI 679

Query: 907  YETEILPKSHAGKTQTIGLNDSSVQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSR 966
            Y                   D   + R +S+++VP FTRKS+ F+ ++ R SVLSLYSSR
Sbjct: 680  Y-------------------DDRTEVRKISDVEVPHFTRKSRHFTAASNRRSVLSLYSSR 720

Query: 967  ESFTNLVDMLKEDGINVEPTERSPTTKSQEPEFLFESPSVDTYSRDSSTEDKPINEKENS 1026
            +SF +L  + K +  +  P++RS                      D ++  K +   E+ 
Sbjct: 721  DSFKDLSQISKNE-YSDSPSQRSV---------------------DDTSSSKKVGHTESL 758

Query: 1027 EPIQSNNLRLSFHDRFNRQLSTEDTEKTKNSPSG-HIKDEPKKDDDNGVDLSTPKAKDES 1085
              +  +    S++D  N  +++++     + P G  +  E K  D+         + + +
Sbjct: 759  ASVAEHIDDDSYNDH-NSGMNSDNV--LYDVPEGVDLPQEVKNSDEQSSCSLVSSSLEPT 815

Query: 1086 NLVKLPALPPLTTKKTDGLGIYQKSKQRTS 1115
             +V+LP+L     K   GLGIYQ+   + S
Sbjct: 816  PVVELPSLSSFQGKNASGLGIYQREPSKVS 845

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 66/108 (61%)

Query: 1282 VSTSNDYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSF 1341
            +S     + ++ A +   ++F+GL  L  GW +YGLK +      +   GK+ +++ILS 
Sbjct: 908  ISKGKILELEIHAKIPNKRLFEGLHKLLEGWKQYGLKKLGFDAAKMIIKGKLVNDSILSL 967

Query: 1342 KSTVFELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVL 1389
            +ST+FE+ ++ N     L++F K +GSSK + +L  E++ +L+KEGVL
Sbjct: 968  RSTLFEIIVLPNGDDRSLIKFNKKTGSSKVLTKLATEIQIILQKEGVL 1015

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score =  540 bits (1392), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 253/359 (70%), Positives = 299/359 (83%), Gaps = 6/359 (1%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSL 74
           NT+GPW+LGETLG GSTG+VQLA +  TG + A+KVISK +F                +L
Sbjct: 8   NTIGPWRLGETLGSGSTGRVQLAQHERTGHKTAVKVISKTIFDTEDGGGXXXL-----AL 62

Query: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAI 134
           PY IEREI++MKLL+HPNVL LYDVWET++NLY++LEYAEKGELFNLLV+RGPLPE EA+
Sbjct: 63  PYNIEREIVVMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDRGPLPEKEAV 122

Query: 135 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSP 194
           + FRQIII ISYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAAL+T+ +LLETSCGSP
Sbjct: 123 KCFRQIIIAISYCHALGIVHRDLKPENLLLDNDYNIKIADFGMAALQTDARLLETSCGSP 182

Query: 195 HYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPG 254
           HYAAPEI+SGLPY G  +DVWSCG+ILFALLTGRLPFDE++GN+R+LLLKVQ GQFEMP 
Sbjct: 183 HYAAPEIVSGLPYRGFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMPD 242

Query: 255 NDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPL 314
             EIS++AQ+LIS+IL VDP +R+KTR+IL HPL++KY +I+DSK+IRNLPRE+TYL PL
Sbjct: 243 ATEISKDAQNLISRILVVDPTQRMKTRDILTHPLLKKYQTIRDSKSIRNLPRENTYLYPL 302

Query: 315 SD-DNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDTEK 372
           +D  N     ID  ILQNLVVLWHGR + EI   LK+ G N EKTLYALL RFK +  K
Sbjct: 303 ADAGNHTNATIDGSILQNLVVLWHGRPADEIVANLKDNGTNTEKTLYALLYRFKQEANK 361

 Score = 92.0 bits (227), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 55/70 (78%)

Query: 607 ASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFEH 666
           + RS KR S  PN++RGS+T+K +S Y  L ++DDWE+IEK+TKR SSNFATLID IFE 
Sbjct: 463 SKRSSKRLSYVPNVKRGSLTSKSLSKYTNLIDEDDWEYIEKDTKRTSSNFATLIDEIFEP 522

Query: 667 EKYEQIRKEK 676
           EK+E  R+EK
Sbjct: 523 EKFELARREK 532

 Score = 90.9 bits (224), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 70/101 (69%)

Query: 1289 DFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFEL 1348
            + ++ A + A ++F+GL  L  GW +YGLKN+     ++  TGK+ ++NILS +ST+FE+
Sbjct: 922  ELEIHAKIPAERLFEGLHKLLEGWKQYGLKNLGFDTANMIITGKLVNDNILSLRSTLFEI 981

Query: 1349 EIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVL 1389
             ++ N     L++F K +GS+K++++L  E++ VL+KEGVL
Sbjct: 982  IVLPNRDDRSLIKFNKKTGSTKTLKKLGYEIQIVLQKEGVL 1022

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 99/218 (45%), Gaps = 61/218 (27%)

Query: 764 VSAPLEKTEKSRDSPFD-----YSKQRNFSLRTRPVSRLDPGLMYSSGTGSSAYNPSHST 818
           VS+PL   E S+           + +   S  TRP+S+LDPGLM +  T    Y+    T
Sbjct: 576 VSSPLINYEYSQQELLQDINTLLTNRCQLSAYTRPISKLDPGLMPTPET--IPYDIKEKT 633

Query: 819 EDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAFQDSHLE 878
           + L        +DT+  ILETIR+SK L SS +               ++++  +D+   
Sbjct: 634 DLL--------LDTEMKILETIRKSKILDSSLN---------------LRKEVSRDA--- 667

Query: 879 EMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQTIGLNDSSVQPRTLSEI 938
                             DR+ S          + +S    T  +  N+ S +   +S+I
Sbjct: 668 ------------------DRLPS----------VEESPIASTTPLVYNNDSKEVCKISDI 699

Query: 939 KVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDML 976
           +VP FTRKSK F+ +N R SVLSLYSSR SF  L  +L
Sbjct: 700 QVPHFTRKSKCFTPTNNRRSVLSLYSSRHSFKGLSRIL 737

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score =  407 bits (1045), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 202/360 (56%), Positives = 253/360 (70%), Gaps = 31/360 (8%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSL 74
           +T+GPWKLG+TLG GS+G+V+LA N  TG+ AA+K++ K                 P++L
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVKIVPKTKSSR------------PNAL 100

Query: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAI 134
           PYGIEREIIIMKL++HPNV+ LY+VWE    L++VLEY + GELF+ LV RG L E EAI
Sbjct: 101 PYGIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLSEKEAI 160

Query: 135 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEDKLLETSCGS 193
            +FRQII G +YCH+  I HRDLKPENLLLD K   IKIADFGMAAL+T +KLLETSCGS
Sbjct: 161 HYFRQIIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGS 220

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           PHYA+PEI+ G  Y+G  +DVWSCGIILFALLTG LPF+  D NI+ LLLKVQ+G+++MP
Sbjct: 221 PHYASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQMP 278

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNP 313
               IS EAQDLIS+IL VDP KRI   +IL HPL+ KY   K SK+       ++ L+ 
Sbjct: 279 --QAISLEAQDLISRILVVDPNKRITINDILSHPLITKY-DYKRSKS-------NSDLHI 328

Query: 314 LSDDNGDVC------EIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFK 367
           LS  +  +C      ++DP ILQNL +LWHG     I K+L EP    EKT Y+LL  ++
Sbjct: 329 LSHTSPQICTIRSERDVDPTILQNLQILWHGAPKDYIMKRLLEPELTEEKTFYSLLLAYQ 388

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score =  410 bits (1054), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 205/354 (57%), Positives = 255/354 (72%), Gaps = 16/354 (4%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSL 74
           +TVGPWKLG+TLG GS+G+V+LA N  TG+ AAIK++ K               LT  SL
Sbjct: 59  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPK------RNVRHNNTQLT--SL 110

Query: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAI 134
           PYGIEREIIIMKL++HPNV+ LY+VWE    LY+VLEY E GELF+ L+ RG LPE EA+
Sbjct: 111 PYGIEREIIIMKLISHPNVMALYEVWENKPELYLVLEYVEGGELFDYLISRGKLPEQEAV 170

Query: 135 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEDKLLETSCGS 193
            +F+QI+ G+SYCH   I HRDLKPENLLLD K  ++KIADFGMAALET DKLLETSCGS
Sbjct: 171 HYFKQIVQGVSYCHHFNICHRDLKPENLLLDKKNLSVKIADFGMAALETTDKLLETSCGS 230

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           PHYA+PEI+ G  YHG  +DVWSCGIILFALLTG LPF+  D N++ LLLKVQSG+++MP
Sbjct: 231 PHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQMP 288

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNP 313
            N  IS EA+DLI+KIL VDP  RI   E+L+HPL+ KY   + SK+  NL   D+  N 
Sbjct: 289 QN--ISNEAKDLIAKILIVDPAMRITIDEVLEHPLLLKYQKTR-SKSSSNLHALDSTPNI 345

Query: 314 LSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFK 367
           +  ++ D  +ID  IL NL +LWHG   + +T KL + G   EK  Y+LL R++
Sbjct: 346 VVLESED--KIDESILSNLQILWHGAPKEYLTGKLLQQGFTEEKLFYSLLLRYQ 397

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score =  406 bits (1043), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 201/356 (56%), Positives = 250/356 (70%), Gaps = 14/356 (3%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSL 74
           +TVGPWKLG+TLG GS+G+V+LA N  TG+ AAIK++ K V                 +L
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKKVVRSTNASKKSNA--ANGNL 113

Query: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAI 134
           PYGIEREIIIMKL++HPN++ LY+VWE  S L++VLEY E GELF+ LV +G LPE EA+
Sbjct: 114 PYGIEREIIIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDYLVSKGKLPEQEAV 173

Query: 135 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEDKLLETSCGS 193
            +FRQII G++YCH   I HRDLKPENLL+D K + IKIADFGMAALET +KLLETSCGS
Sbjct: 174 HYFRQIIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMAALETTNKLLETSCGS 233

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           PHYA+PEI+ G  YHG  +DVWSCGIILFALLTG LPF+  D NI+ LLLKVQSG++ MP
Sbjct: 234 PHYASPEIVMGKNYHGSPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQSGKYHMP 291

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSI--KDSKTIRNLPREDTYL 311
            N  IS EAQDLISKIL VDP+ RI   E+L+HPL+ KY     K +  +  L R    +
Sbjct: 292 QN--ISSEAQDLISKILIVDPRGRITINEVLQHPLITKYDKARSKSNSDLHLLSRTPQLV 349

Query: 312 NPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFK 367
              S +     +ID  IL NL +LWHG  S+ I  +L + G   EK  Y+LL +++
Sbjct: 350 TLQSKE-----DIDGSILGNLQILWHGAPSEYIVARLLQHGFTEEKLFYSLLWQYQ 400

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score =  406 bits (1044), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 199/354 (56%), Positives = 247/354 (69%), Gaps = 15/354 (4%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSL 74
           +TVGPWKLG+TLG GS+G+V+LA N  +G+ AAIK++ K                   +L
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVT--------AL 107

Query: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAI 134
           PYGIEREIIIMKL+ HPN++ LY+VWE  S LY+VLEY E GELF+ L+ RG LPE EAI
Sbjct: 108 PYGIEREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAI 167

Query: 135 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEDKLLETSCGS 193
            +F+QI+ G+SYCH   I HRDLKPENLLLD K   +KIADFGMAALET ++LLETSCGS
Sbjct: 168 HYFKQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNRLLETSCGS 227

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           PHYA+PEI+ G  YHG  +DVWSCGIILFALLTG LPF+  D N+R LLLKVQ G+++MP
Sbjct: 228 PHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVRKLLLKVQHGRYQMP 285

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNP 313
            N  +S+EA+DLISKIL VDP+KRI   +IL+HPL+ KY +    K     P E     P
Sbjct: 286 SN--VSKEAKDLISKILVVDPEKRITVDKILEHPLLVKYDN--PGKGGLACPLEKPEERP 341

Query: 314 LSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFK 367
              D   + +ID  IL NL +LWHG   + +  KL + G   EK  YALL R++
Sbjct: 342 KVLDIHSIDDIDETILSNLQILWHGAPKEYLVDKLLQSGFTEEKLFYALLLRYQ 395

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score =  401 bits (1030), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 197/361 (54%), Positives = 251/361 (69%), Gaps = 17/361 (4%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSL 74
           +TVGPWKLG+TLG GS+G+V+LA N  TG+ +AIK++ K                    L
Sbjct: 68  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQ----------L 117

Query: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAI 134
           PYGIEREIIIMKL++HPNV+ LY+VWE  S LY+VLEY E GELF+ LV +G LPE+EAI
Sbjct: 118 PYGIEREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAI 177

Query: 135 RFFRQIIIGISYCHALGIVHRDLKPENLLLD-HKYNIKIADFGMAALETEDKLLETSCGS 193
            +F+QI+  ++YCH   I HRDLKPENLLLD  K +IKIADFGMAALET DKLLETSCGS
Sbjct: 178 HYFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAALETSDKLLETSCGS 237

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           PHYA+PEI+ G  YHG  +DVWSCGIILFALLTG LPF+  D N++ LLLKVQSG+++MP
Sbjct: 238 PHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQMP 295

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNP 313
               +S EA+DLIS+IL VDP +RI   +IL+H L+ KY     SK+  +L   +   N 
Sbjct: 296 --QWLSVEAKDLISRILVVDPNRRITIDQILQHELLTKYDQKSRSKSNSDLNLLNRTPNI 353

Query: 314 LSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDTEKE 373
           +S  +    +ID  IL NL +LWHG   K +  +L +PG   EK  Y+LL  ++   +K 
Sbjct: 354 VSFSSER--DIDETILSNLQILWHGAARKHLVTRLMKPGFTEEKMFYSLLWNYQEKQQKS 411

Query: 374 I 374
           +
Sbjct: 412 M 412

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score =  407 bits (1045), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 208/392 (53%), Positives = 253/392 (64%), Gaps = 44/392 (11%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLT---- 70
           +TVGPWKLG+TLG GS+G+V+LA N  TGQ AAIK++ K               L+    
Sbjct: 68  DTVGPWKLGKTLGKGSSGRVRLAKNMKTGQLAAIKIVPKNFHSKKKRQDSPAKSLSSSPD 127

Query: 71  -----------PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119
                      P +  YGIEREI+IMKL++HPNV+ LY+VWE  S LY+VLEY + GELF
Sbjct: 128 KPYTTHSNETNPSNNSYGIEREIVIMKLISHPNVMGLYEVWENKSELYLVLEYVDGGELF 187

Query: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYN-IKIADFGMA 178
           + LV RG LPE EA+ +F+QII G++YCHA  I HRDLKPENLLLD K   IKIADFGMA
Sbjct: 188 DYLVSRGKLPEREAVHYFKQIIQGVAYCHAFNICHRDLKPENLLLDKKNKIIKIADFGMA 247

Query: 179 ALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNI 238
           ALE  DKLL TSCGSPHYA+PEI+ G  YHG  TDVWSCGIILFALLTG LPF+ +  NI
Sbjct: 248 ALEVSDKLLSTSCGSPHYASPEIVMGKSYHGSPTDVWSCGIILFALLTGHLPFNHD--NI 305

Query: 239 RNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYP----- 293
           + LLLKVQSG + MP   ++S +A+DLISKIL VDP KR+ T EIL H L+ KY      
Sbjct: 306 KKLLLKVQSGVYHMPS--DLSPDAKDLISKILVVDPDKRLTTTEILNHSLITKYDRMGLT 363

Query: 294 --------SIKDSKTIRNLPREDTYLNPLSDDNGDV-----CEIDPKILQNLVVLWHGRD 340
                   S+   K+  NL     ++N LS  N D+     C+ID  IL NL +LWHG  
Sbjct: 364 NRNYNNNLSMARDKSNSNL----NFINNLS--NVDILLQNPCDIDTSILSNLQILWHGES 417

Query: 341 SKEITKKLKEPGANAEKTLYALLDRFKNDTEK 372
              I  KL +P  N EK  Y+LL ++K    K
Sbjct: 418 KHAIIDKLLQPNMNEEKLFYSLLLKYKQKNSK 449

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score =  402 bits (1034), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 204/402 (50%), Positives = 269/402 (66%), Gaps = 40/402 (9%)

Query: 2   VKLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISK-------- 53
           V +  K S     +TVGPWKLG+TLG GS+G+V+LA N  TGQ AAIK++ K        
Sbjct: 63  VSVATKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCS 122

Query: 54  ---AVFXXXXXXXXXXXLLTP-----------DSLPYGIEREIIIMKLLNHPNVLRLYDV 99
               V            + +P            + PYGIEREI+IMKL++H NV+ L++V
Sbjct: 123 NNGTVPNSYSSSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEV 182

Query: 100 WETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKP 159
           WE  S LY+VLEY + GELF+ LV +G LPE EAI +F+QI+ G+SYCH+  I HRDLKP
Sbjct: 183 WENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKP 242

Query: 160 ENLLLDHK-YNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCG 218
           ENLLLD K   IKIADFGMAALE  +KLL+TSCGSPHYA+PEI+ G PYHG  +DVWSCG
Sbjct: 243 ENLLLDKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCG 302

Query: 219 IILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRI 278
           I+LFALLTG LPF+  D NI+ LLLKVQSG+++MP N  +S EA+DLISKIL +DP+KRI
Sbjct: 303 IVLFALLTGHLPFN--DDNIKKLLLKVQSGKYQMPSN--LSSEARDLISKILVIDPEKRI 358

Query: 279 KTREILKHPLVQKYPSIKDSKTIRNLPREDTY-------LNPLSDDNGDVC------EID 325
            T+EILKHPL++KY  +  +K +R + +++         L+ L++ +  +       EID
Sbjct: 359 TTQEILKHPLIKKYDDLPVNKVLRKMRKDNMARGKSNSDLHLLNNVSPSIVTLHSKGEID 418

Query: 326 PKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFK 367
             IL++L +LWHG   + IT KL +   + EK  Y+LL ++K
Sbjct: 419 ESILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score =  402 bits (1032), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/402 (50%), Positives = 270/402 (67%), Gaps = 40/402 (9%)

Query: 2   VKLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISK-------- 53
           V +T K S     +TVGPWKLG+TLG GS+G+V+LA N  TGQ AAIK++ K        
Sbjct: 63  VSVTTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRS 122

Query: 54  ---AVFXXXXXXXXXXXLLTPDSL-----------PYGIEREIIIMKLLNHPNVLRLYDV 99
               V            + +P  +           PYGIEREI+IMKL++H NV+ L++V
Sbjct: 123 NNGTVPNSYSSSMVTSNVSSPSIVSKEHSNHSQTNPYGIEREIVIMKLISHANVMALFEV 182

Query: 100 WETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKP 159
           WE  S LY+VLEY + GELF+ LV RG LPE EAI +F+QI+ G+SYCH+  I HRDLKP
Sbjct: 183 WENKSELYLVLEYVDGGELFDYLVSRGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKP 242

Query: 160 ENLLLDHK-YNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCG 218
           ENLLLD K   IKIADFGMAALE  +KLL+TSCGSPHYA+PEI+ G PYHG  +DVWSCG
Sbjct: 243 ENLLLDKKNKKIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCG 302

Query: 219 IILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRI 278
           I+LFALLTG LPF+  D NI+ LLLKVQSG+++MP N  +S EA++LISKIL +DP+KRI
Sbjct: 303 IVLFALLTGHLPFN--DDNIKKLLLKVQSGKYQMPMN--LSLEARNLISKILVIDPEKRI 358

Query: 279 KTREILKHPLVQKYPSIKDSKTIRNLP-------REDTYLNPLSDDNGDVC------EID 325
            T+EIL+HPL++KY ++  +K +R +        + ++ L+ L + +  +       EID
Sbjct: 359 TTQEILEHPLIKKYDNLPVNKMLRKMKGDSMTRGKSNSDLHLLDNVSPSIVTLNTKNEID 418

Query: 326 PKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFK 367
             IL++L +LWHG   + IT KL +   + EK  Y+LL R+K
Sbjct: 419 ESILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLRYK 460

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score =  397 bits (1020), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 201/360 (55%), Positives = 249/360 (69%), Gaps = 19/360 (5%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSL 74
           +T+GPWKLG+TLG GS+G+V+LA N  TG+ AAIK++ K                   SL
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRT------------GSL 100

Query: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAI 134
           PYGIEREIIIMKL++HPNV+ LY+VWE    L++VLEY + GELF+ LV RG LPE EAI
Sbjct: 101 PYGIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAI 160

Query: 135 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEDKLLETSCGS 193
            +FRQII G +YCH   I HRDLKPENLLLD K   IKIADFGMAAL+T +KLLETSCGS
Sbjct: 161 HYFRQIIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGS 220

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           PHYA+PEI+ G  Y+G  +DVWSCGIILFALLTG LPF+  D NI+ LLLKVQ+G+++MP
Sbjct: 221 PHYASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQMP 278

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNP 313
               +S  AQDLIS+IL VDP KRI   EIL HPL+ KY + K SK+  +L    ++  P
Sbjct: 279 --QSVSSGAQDLISRILVVDPDKRISINEILAHPLLAKYGN-KRSKSNSDL-HILSHSKP 334

Query: 314 LSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDTEKE 373
                    ++DP ILQNL +LWHG   + I K L +P    EKT Y+LL  ++    K+
Sbjct: 335 QISTIKSESDVDPTILQNLQILWHGAPKESILKGLLKPELTEEKTFYSLLLAYQQRQSKQ 394

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score =  400 bits (1028), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 200/389 (51%), Positives = 264/389 (67%), Gaps = 40/389 (10%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISK-----------AVFXXXXXXX 63
           +TVGPWKLG+TLG GS+G+V+LA N  TGQ AAIK++ K            +        
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSTNGTMPNSYSSSM 135

Query: 64  XXXXLLTPDSL-----------PYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEY 112
               + +P  +           PYGIEREI+IMKL++H NV+ L++VWE  S LY+VLEY
Sbjct: 136 VTSNVSSPSIVSKEYSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEY 195

Query: 113 AEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-YNIK 171
            + GELF+ LV +G LPE EAI +F+QI+ G+SYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIK 255

Query: 172 IADFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPF 231
           IADFGMAALE  +KLL+TSCGSPHYA+PEI+ G PYHG  +DVWSCGI+LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 232 DEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
           +  D NI+ LLLKVQSG+++MP N  +S EA+DLISKIL +DP KRI T+EILKHPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVIDPAKRITTQEILKHPLIKK 371

Query: 292 YPSIKDSKTIRNLPREDTY-------LNPLSDDNGDVC------EIDPKILQNLVVLWHG 338
           Y  +  +K +R + R++         L+ L++ +  +       +ID  IL++L +LWHG
Sbjct: 372 YDDLPVNKILRKMKRDNMARGKSNSDLHLLNNVSPSIVTLYSRSDIDESILRSLQILWHG 431

Query: 339 RDSKEITKKLKEPGANAEKTLYALLDRFK 367
              + IT KL +   + EK  Y+LL ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score =  398 bits (1022), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 201/389 (51%), Positives = 265/389 (68%), Gaps = 40/389 (10%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISK-----------AVFXXXXXXX 63
           +TVGPWKLG+TLG GS+G+V+LA N  TGQ AAIK++ K            V        
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSM 135

Query: 64  XXXXLLTP-----------DSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEY 112
               + +P            + PYGIEREI+IMKL++H NV+ L++VWE  S LY+VLEY
Sbjct: 136 ITSNVSSPSIASKEHSNHTQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEY 195

Query: 113 AEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-YNIK 171
            + GELF+ LV +G LPE EAI +F+QI+ G+S+CH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSFCHSFNICHRDLKPENLLLDKKNRKIK 255

Query: 172 IADFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPF 231
           IADFGMAALE  +KLL+TSCGSPHYA+PEI+ G PYHG  +DVWSCGI+LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 232 DEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
           +  D NI+ LLLKVQSG+++MP N  +S EA+DLISKIL ++P+KRI T+EIL HPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVINPEKRITTQEILNHPLIKK 371

Query: 292 YPSIKDSKTIRNLPREDTY-------LNPLSDDNGDVC------EIDPKILQNLVVLWHG 338
           Y ++  +K IR + R++         L+ L++ +  V       EID  IL++L +LWHG
Sbjct: 372 YDNLPINKMIRKMKRDNMARGKSNSDLHLLNNVSPSVVTLHSRGEIDESILRSLQILWHG 431

Query: 339 RDSKEITKKLKEPGANAEKTLYALLDRFK 367
              + IT KL +   + EK  Y+LL ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score =  394 bits (1012), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 201/392 (51%), Positives = 256/392 (65%), Gaps = 43/392 (10%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISK--------------------- 53
           +TVGPWKLG+TLG GS+G+V+LA N  TGQ AAIK++ K                     
Sbjct: 74  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKNNVLGKNDACSTSSASYTSN 133

Query: 54  -----AVFXXXXXXXXXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYM 108
                 +                 + PYGIEREI+IMKL++H NVL LY+VWE  S LY+
Sbjct: 134 SSQTSTMMNTTANNYTTAGHSNVATNPYGIEREIVIMKLISHANVLGLYEVWENKSELYL 193

Query: 109 VLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKY 168
           VLEY + GELF+ LV RG L E EA+ +F+QII G+SYCHA  I HRDLKPENLLLD K 
Sbjct: 194 VLEYVDGGELFDYLVSRGRLCEREAVHYFKQIIQGVSYCHAFNICHRDLKPENLLLDKKN 253

Query: 169 N-IKIADFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTG 227
           + IKIADFGMAALE  +KLL+TSCGSPHYA+PEI+ G  YHG  +DVWSCGIILFALLTG
Sbjct: 254 STIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGKQYHGGPSDVWSCGIILFALLTG 313

Query: 228 RLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHP 287
            LPF+  D +I+ LLLKVQSG+++MP N  +S+EAQDLI+KILTV+P KR+ T EIL+HP
Sbjct: 314 HLPFN--DDSIKKLLLKVQSGKYQMPQN--LSKEAQDLIAKILTVNPAKRLTTEEILRHP 369

Query: 288 LVQKYPSIKDSKTIRNL------PREDTYLNPLSDDNGDVC------EIDPKILQNLVVL 335
           L+ KY S+  +K  + L       + +  L+ L++            +ID  IL NL +L
Sbjct: 370 LIVKYDSMMKTKKYKALYKNMGQGKSNADLHLLNNYEATTINLNSRKDIDDTILNNLQIL 429

Query: 336 WHGRDSKEITKKLKEPGANAEKTLYALLDRFK 367
           WHG   + I  KL +P  + EK  Y+LL ++K
Sbjct: 430 WHGASRELIVAKLLQPRMSEEKVFYSLLLKYK 461

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score =  392 bits (1008), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 203/383 (53%), Positives = 259/383 (67%), Gaps = 37/383 (9%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKA-VFXXXXXXXXXXXLLTPDS 73
           +TVGPWKLG+TLG GS+G+V+LA N  TGQ AAIK++ K  +F             + + 
Sbjct: 87  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKTKIFRKQNDNSFQMSSYSSND 146

Query: 74  L---------------PYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGEL 118
                           PYGIEREI+IMKL++HPNV+ LY+VWE  S L++VLEY + GEL
Sbjct: 147 ESPKHTNNNDTYSKINPYGIEREIVIMKLISHPNVMGLYEVWENKSELFLVLEYVDGGEL 206

Query: 119 FNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYN-IKIADFGM 177
           F+ LV RG L E EA+ +F+QII G+SYCH+  I HRDLKPENLLLD K N IKIADFGM
Sbjct: 207 FDYLVSRGKLSEREAVHYFKQIIEGVSYCHSFNICHRDLKPENLLLDKKINTIKIADFGM 266

Query: 178 AALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGN 237
           AALE  +KLL TSCGSPHYA+PEI+ G  YHG  +DVWSCGIILFALLTG LPF+  D +
Sbjct: 267 AALELPNKLLVTSCGSPHYASPEIVMGKSYHGSPSDVWSCGIILFALLTGHLPFN--DDS 324

Query: 238 IRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKD 297
           I+ LLLKVQSG+F+MP N  IS EA+DLIS+IL VDP+KRI+  +IL HPL++KY   +D
Sbjct: 325 IKKLLLKVQSGKFQMPQN--ISLEAEDLISRILVVDPEKRIQINDILIHPLIRKY---ED 379

Query: 298 SKTIRN-------LPREDTYLNPLSDDNGDVC------EIDPKILQNLVVLWHGRDSKEI 344
           +KT  N         + ++ L+ L+D    +       EID  IL+NL +LWHG   + I
Sbjct: 380 NKTDSNNVSSYKKSSKSNSNLHILNDMGPSIVTLKARNEIDESILKNLQILWHGTSRELI 439

Query: 345 TKKLKEPGANAEKTLYALLDRFK 367
             KL +   + EK  Y+LL ++K
Sbjct: 440 ISKLLQTPMSEEKLFYSLLLQYK 462

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score =  387 bits (994), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/377 (53%), Positives = 253/377 (67%), Gaps = 29/377 (7%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISK-----AVFXXXXXXXXXXXLL 69
           +TVGPWKLG+TLG GS+G+V+LA N   GQ AAIK++ K                   L 
Sbjct: 83  DTVGPWKLGKTLGKGSSGRVRLAKNMENGQLAAIKIVPKNKCLKGGTDNCSSNDNSTTLT 142

Query: 70  TPDSL-----------PYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGEL 118
           T  S+           PYGIEREI+IMKL++H NV+ L++VWE  ++L++VLEY + GEL
Sbjct: 143 TNYSMENTSDKDIPLNPYGIEREIVIMKLISHRNVMGLFEVWENKNDLFLVLEYVDGGEL 202

Query: 119 FNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYN-IKIADFGM 177
           F+ LV +G LPE EA+ +F+QII G+++CH+  I HRDLKPENLLLD K   IKIADFGM
Sbjct: 203 FDYLVSKGKLPEWEAVHYFKQIIEGVAFCHSYNICHRDLKPENLLLDKKNKIIKIADFGM 262

Query: 178 AALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGN 237
           AALE  +KLLETSCGSPHYA+PEI+ G PYHG  +DVWSCGIILFALLTG LPF+  D N
Sbjct: 263 AALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFN--DDN 320

Query: 238 IRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKD 297
           IR LLLKVQSG+F +P N  IS EAQDLI+KIL V+P++RIK  +ILKHPL+ KY     
Sbjct: 321 IRKLLLKVQSGRFRLPRN--ISLEAQDLIAKILVVNPRQRIKISDILKHPLITKYRQFFK 378

Query: 298 SK-------TIRNLPREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKE 350
            K       +  NL  E   L P +       +ID  IL+NL +LWHG   + I  KL +
Sbjct: 379 VKFNQVPNPSATNLNSEH-MLTPNNLKLASRADIDESILRNLQILWHGTSREIIIAKLLQ 437

Query: 351 PGANAEKTLYALLDRFK 367
              +AEK  Y+LL ++K
Sbjct: 438 YPMSAEKIFYSLLWQYK 454

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score =  388 bits (997), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/411 (49%), Positives = 255/411 (62%), Gaps = 49/411 (11%)

Query: 2   VKLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXX 61
           +  T K S     +TVGPWKLG+TLG GS+G+V+LA N  TGQ AAIK++ K        
Sbjct: 83  ISTTTKSSKRRSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKCKNDPG 142

Query: 62  XXXXXXLLTPD------------------------------SLPYGIEREIIIMKLLNHP 91
                     D                              + PYGIEREI+IMKL++H 
Sbjct: 143 SHSSSKSTESDFSATMNTTTNTNRATTNGGTNANAGPSEVPANPYGIEREIVIMKLISHS 202

Query: 92  NVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALG 151
           N+L LY+VWE  S LY+VLEY + GELF+ LV RG L E EA+ +F+QI+ G+SYCH+  
Sbjct: 203 NILGLYEVWENKSELYLVLEYVDGGELFDYLVSRGKLGEREAVHYFKQIVQGVSYCHSFN 262

Query: 152 IVHRDLKPENLLLDHK-YNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGL 210
           I HRDLKPENLLLD K  +IKIADFGMAALE  +KLL+TSCGSPHYA+PEI+ G PYHG 
Sbjct: 263 ICHRDLKPENLLLDKKNKSIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGRPYHGG 322

Query: 211 ETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKIL 270
            +DVWSCGIILFALLTG LPF+  D NI+ LLLKVQSG+F MP N  +S EA+DL+SKIL
Sbjct: 323 PSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQSGKFHMPQN--LSAEAKDLMSKIL 378

Query: 271 TVDPKKRIKTREILKHPLVQKYPSIKDSKTIR--------NLPREDTYLNPLSDDNGDVC 322
            V+P KRI T EIL HPL+ KY  +      R        +  + ++ L+ L   N ++ 
Sbjct: 379 VVNPFKRIATEEILNHPLLTKYDKLVKPVKYRSSVNPVALSQGKSNSDLHVLDASNSNIV 438

Query: 323 ------EIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFK 367
                 +ID  I+ NL +LWHG   + I  KL +P  + EK  Y+LL  +K
Sbjct: 439 DLRSREDIDDSIVSNLQILWHGASRELIVAKLLQPRMSEEKLFYSLLLSYK 489

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score =  383 bits (983), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/387 (51%), Positives = 254/387 (65%), Gaps = 44/387 (11%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISK-------------AVFXXXXX 61
           +TVGPWKLG+TLG GS+G+V+LA N  TGQ AAIK++ K             + F     
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSAASN 155

Query: 62  XXXXXXLLT-------------PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYM 108
                  L              P+  PYGIEREI+IMKL++HPNV+ LY+VWE  S LY+
Sbjct: 156 SNSNISTLATSPPMNNGSEKNQPN--PYGIEREIVIMKLISHPNVMALYEVWENKSELYL 213

Query: 109 VLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK- 167
           VLEY + GELF+ LV +G L E EA+ +F+QII G+SYCH+  I HRDLKPENLLLD K 
Sbjct: 214 VLEYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKN 273

Query: 168 YNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTG 227
            +IKIADFGMAALE  +KLL+TSCGSPHYA+PEI+ G  YHG  +DVWSCGIILFALLTG
Sbjct: 274 KSIKIADFGMAALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTG 333

Query: 228 RLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHP 287
            LPF+  D NI+ LLLKVQ+G+F MP    +S EAQDLIS+IL +DP KRI T  IL HP
Sbjct: 334 HLPFN--DDNIKKLLLKVQAGKFRMPST--LSPEAQDLISRILVIDPSKRITTDRILNHP 389

Query: 288 LVQKY-PSIKDSKTIRNLPREDTYL------NPLSDDNGDVCEIDPKILQNLVVLWHGRD 340
           L+ KY P+ K+   +      D ++       P+S  + +  +ID  IL+NL +LWHG  
Sbjct: 390 LILKYEPAGKN--MVSGKSNSDLHVLEHISPQPISLTSRN--DIDASILKNLQILWHGTS 445

Query: 341 SKEITKKLKEPGANAEKTLYALLDRFK 367
            + I  KL +   + EK  Y+LL ++K
Sbjct: 446 RELIIAKLLQTPMSEEKLFYSLLWQYK 472

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score =  378 bits (971), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/400 (49%), Positives = 261/400 (65%), Gaps = 51/400 (12%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISK-AVFXXXXXXXXXXX-----L 68
           +TVGPWKLG+TLG GS+G+V+LA N  TG+ AAIK++ K   F                 
Sbjct: 89  DTVGPWKLGKTLGKGSSGRVRLAKNIETGKLAAIKIVPKNKKFNNQHRSKNTNSNNGDLF 148

Query: 69  LTPDSL------------------------PYGIEREIIIMKLLNHPNVLRLYDVWETDS 104
           L+  S+                        PYGIEREI+IMKLL+HPNV+ LY+VWE ++
Sbjct: 149 LSYSSIHNTTNTHNARNTDNTAIENSGGGNPYGIEREIVIMKLLSHPNVMALYEVWENNN 208

Query: 105 NLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL 164
            LY+VLEY + GELF+ LV +G L E+EA+ +F+QII GISYCH+  I HRDLKPENLLL
Sbjct: 209 ELYLVLEYVDGGELFDYLVSKGKLTESEAVHYFKQIINGISYCHSFNICHRDLKPENLLL 268

Query: 165 DHKYN-IKIADFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFA 223
           D K   IKIADFGMAAL+  ++LL+TSCGSPHYA+PEI+ G  Y+G  +D+WSCGIILFA
Sbjct: 269 DKKRRIIKIADFGMAALQVSNRLLQTSCGSPHYASPEIVMGKCYNGAPSDIWSCGIILFA 328

Query: 224 LLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREI 283
           LLTG LPF+  D NI+ LL+KVQ+G+++MP    IS+EA++LIS+IL VDP KRI T +I
Sbjct: 329 LLTGHLPFN--DDNIKKLLIKVQNGRYQMPS--YISQEAKNLISRILVVDPSKRISTEQI 384

Query: 284 LKHPLVQKYP---SIKDSKTIRN-----LPREDTYLNPLSD--DNGDVC------EIDPK 327
           L HPL+ KY      KD K  +N       + ++ LN LS+   N ++       +ID  
Sbjct: 385 LSHPLLTKYDKRLGKKDRKVTKNNKIMHRGKSNSDLNMLSNIPQNTEIVKLRARSDIDES 444

Query: 328 ILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFK 367
           IL+NL +LWHG     I  KL +   + EK +Y+LL ++K
Sbjct: 445 ILKNLQILWHGISRDIIIAKLLQTPMSEEKLIYSLLWKYK 484

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score =  374 bits (960), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 195/394 (49%), Positives = 249/394 (63%), Gaps = 54/394 (13%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLL----- 69
           +TVGPWKLG+TLG GS+G+V+LA N   G  AAIK++ K  +                  
Sbjct: 88  DTVGPWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSG 147

Query: 70  ----------------TPDSL-PYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEY 112
                           T  +L PYGIEREI+IMKL++HPNV+ L +VWE  S LY+VLEY
Sbjct: 148 TDSKDSSNREDPIKNGTDSALNPYGIEREIVIMKLISHPNVMGLLEVWENKSELYLVLEY 207

Query: 113 AEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYN-IK 171
            + GELF+ LV +G L E EA+ +F QII G+SYCH+  I HRDLKPENLLLD K   IK
Sbjct: 208 VDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIK 267

Query: 172 IADFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPF 231
           IADFGMAALE  +KLLETSCGSPHYA+PEI+ G PYHG  +DVWSCGIILFALLTG LPF
Sbjct: 268 IADFGMAALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPF 327

Query: 232 DEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
           +  D NI+ LLLKVQ+G+F++P    ++ +A+DLI++IL  +P+KR+   EIL HPL++K
Sbjct: 328 N--DDNIKKLLLKVQAGRFQLP--PYLTNDAKDLITRILVTNPEKRLTINEILNHPLIKK 383

Query: 292 YPSIKDSKTIRNLPREDTYLNPL--SDDNGD-----------VC-----EIDPKILQNLV 333
           Y         RN P     LN L     N D           VC     +ID  IL++L 
Sbjct: 384 Y---------RNPPAHIRKLNLLGRGKSNSDLHVLEYNTPATVCLNSEEDIDQSILKSLQ 434

Query: 334 VLWHGRDSKEITKKLKEPGANAEKTLYALLDRFK 367
           +LWHG   + + ++L   GA  EK  Y+LL ++K
Sbjct: 435 ILWHGTPRQRLVERLLVEGATEEKLFYSLLFQYK 468

>Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016C -
           Hypothetical ORF [contig 120] FULL
          Length = 964

 Score =  361 bits (926), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/325 (59%), Positives = 225/325 (69%), Gaps = 36/325 (11%)

Query: 205 LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQD 264
           LPYHG E+DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP +DEIS EAQD
Sbjct: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69

Query: 265 LISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPLSDDNGDVCEI 324
           LI+KILTVDP  RIK+REILKHPL+QKYPSIKDSK+IRNLPREDTYLNPL   NG    I
Sbjct: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGS---I 126

Query: 325 DPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDTEKEIXXXXXXXXXX 384
           D  I+ NLVVLWHGRD  EIT +LKEPGAN EKT YALL RFK+D+ +E           
Sbjct: 127 DESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQAS 186

Query: 385 XXXXXTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSAHKRPVSFNRLSRADLS 444
                  +  NS       VSR ++ N   K+KN+A ++S SS+HKRPVSFNRLS     
Sbjct: 187 HISPKRSNMRNS-------VSRRSITNVTPKKKNKAPVISASSSHKRPVSFNRLS----- 234

Query: 445 NHVINTGING--TPQRHSQIESSGTLQRNSSSKRMSINLSSNKRISQLLANDLNTSPTPS 502
               N G N   TP               S+SKR S+NLSSNKRIS L+  + N SPTP 
Sbjct: 235 ---FNNGSNTAHTPP-------------TSASKRASVNLSSNKRISALI--NPNNSPTPV 276

Query: 503 NCTKRMSIINGT-PPVPMDIMKNYN 526
           +    M  ++ + PP+PMD++K+YN
Sbjct: 277 HKRSSMRDLDASAPPIPMDMLKDYN 301

 Score =  158 bits (399), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 141/428 (32%), Positives = 201/428 (46%), Gaps = 99/428 (23%)

Query: 762  RSVSAPLEKTEK--SRDSPFDYSK-------QRNFSLRTRPVSRLDPGLMYSSGTGSSAY 812
            RSVSAP E   K   R S  +          +R FSL TRP SRLDPG+ Y+S       
Sbjct: 457  RSVSAPAESVLKVDKRGSTGNLDNDIMALLNRRTFSLETRPKSRLDPGI-YTS------- 508

Query: 813  NPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDXXXXXXXXXXXXSNRIKQQAF 872
                  ED  S +    + T+K ILETIRRSKFLGSSFD               I ++  
Sbjct: 509  ----EEEDFGSKNHGADLSTEKTILETIRRSKFLGSSFD---------------INKELA 549

Query: 873  QDSHLEEMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQTIGLNDSSVQP 932
            ++  L+E               SN    +   + YE++ LPK   G        ++S +P
Sbjct: 550  RERRLKEERAALAKRKDEERVASNATTANVVGNGYESQTLPKRKMGSAM-----EASSEP 604

Query: 933  RTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINVEPTERSPTT 992
            R +SE++VPQFTR+S+ F+ SNKRLSVLS+YS++ SFTNL D LK    +V+  + SP +
Sbjct: 605  RKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLKGKA-DVQLIQTSPPS 663

Query: 993  KS---QEPEFLFES------PSVDTYSRDSSTEDKPINEKENSEPIQSNNLRLSFHDRFN 1043
             S   QE EF+FES       + DT +     E     + +N++P     ++L+F DRFN
Sbjct: 664  ASKMDQEAEFMFESVDKEGKETADTSADSRLYEVAETKDAKNAKPA----VKLNFADRFN 719

Query: 1044 RQLSTEDTEKTKNSPSGHIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPLTTKK--- 1100
            R  S                  P +D D+            S  +KLPALPPL   K   
Sbjct: 720  RPTSP-----------------PSQDTDS------------SAAIKLPALPPLDKNKPNM 750

Query: 1101 TDGLGIYQKSKQRTSSNASNPITPSSTNAQLTSAAVNVTPPTTTMINESIQKLQESREKV 1160
              GLG+YQ + +           PS  +AQ  + ++ +    + +  E    + E+ E  
Sbjct: 751  VSGLGLYQATAE-----------PSHEDAQPVAKSMVIDDVESEITTEPRNTVTETEEAA 799

Query: 1161 NNSSKLIP 1168
             NS+ ++P
Sbjct: 800  KNST-VVP 806

 Score =  107 bits (268), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 65/79 (82%)

Query: 599 SAAQNVNRASRSQKRKSVRPNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFAT 658
           SA +   R++R  KR S  P  +RGSITTKLI+TYA++++D+DWE+IEKET+R S++FAT
Sbjct: 303 SAPKVSRRSTRLSKRLSFLPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFAT 362

Query: 659 LIDNIFEHEKYEQIRKEKD 677
           L D IFEHEKYEQIRKEK+
Sbjct: 363 LCDEIFEHEKYEQIRKEKE 381

 Score = 86.7 bits (213), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 64/106 (60%), Gaps = 1/106 (0%)

Query: 1285 SNDYDFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKST 1344
            S DYDF+ K  +   QMF  L  L   W  YGLK++ +SP   +  GK+SS+NILS +ST
Sbjct: 857  SGDYDFRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRST 916

Query: 1345 VFELEIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLL 1390
            +F + ++    +   + F K SGS+K+ ++LV E+E +L  +  L+
Sbjct: 917  LFIITVVGRG-EGSYVEFTKKSGSNKTFKKLVKEIEKILESKKALV 961

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score =  337 bits (863), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 170/298 (57%), Positives = 214/298 (71%), Gaps = 10/298 (3%)

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 135
           YGIEREI+IMKL++HPNV+ LY+VWE  S LY++LEY + GELF+ LV RG LPE EAI 
Sbjct: 197 YGIEREIVIMKLISHPNVMGLYEVWENKSELYLILEYVDGGELFDYLVSRGKLPEAEAIH 256

Query: 136 FFRQIIIGISYCHALGIVHRDLKPENLL-LDHKYNIKIADFGMAALETEDKLLETSCGSP 194
           +F+QII G+SYCH+  I HRDLKPENLL    K +IKIADFGMAALE   KLL+TSCGSP
Sbjct: 257 YFKQIIQGVSYCHSFNICHRDLKPENLLIDKKKKSIKIADFGMAALELPKKLLQTSCGSP 316

Query: 195 HYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPG 254
           HYA+PEI+ G  YHG  +DVWSCGIILFALLTG LPF+  D NI+ LLLKVQ+G+++MP 
Sbjct: 317 HYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQAGKYQMPK 374

Query: 255 NDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKY-PSIKDSKTIRNLPREDTY-LN 312
           N  +S EA+DLIS+IL V P KR+ T EIL HPL+ KY  S K    ++     D + L+
Sbjct: 375 N--LSDEAKDLISRILVVSPSKRLTTVEILNHPLILKYEKSSKKKHMVKGKSNSDLHLLD 432

Query: 313 PLSDDNGDV---CEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFK 367
            +S +N  +    +ID  IL+NL +LWHG     I  KL +   + EK  Y+LL ++K
Sbjct: 433 SISPENITLNSRMDIDESILKNLQILWHGTSRDIIIAKLLQKPISEEKLFYSLLLQYK 490

 Score = 61.2 bits (147), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/39 (66%), Positives = 33/39 (84%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISK 53
           +TVGPWKLG+TLG GS+G+V+LA N  TGQ AAIK++ K
Sbjct: 88  DTVGPWKLGKTLGKGSSGRVRLAKNVETGQLAAIKIVPK 126

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score =  328 bits (841), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 164/314 (52%), Positives = 221/314 (70%), Gaps = 26/314 (8%)

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 135
           YGIEREI+IMKL++HPNV+ LY+VWE  + LY+VLEY + GELF+ LV +G L E EA+R
Sbjct: 205 YGIEREIVIMKLVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSKGKLTELEAVR 264

Query: 136 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYN-IKIADFGMAALETEDKLLETSCGSP 194
           +F+QII G+ YCH+  I HRDLKPENLLLD K   IKIADFGMAAL+  + LL+TSCGSP
Sbjct: 265 YFKQIIRGVQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMAALQVSNTLLKTSCGSP 324

Query: 195 HYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPG 254
           HYA+PEI+ G  Y+G  +DVWSCGIILFALLTG LPF+  D +I+ LL+KVQ+G+++MP 
Sbjct: 325 HYASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDSIKKLLIKVQNGRYQMP- 381

Query: 255 NDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYP---SIKDS--------KTIRN 303
            + +S++A+DLIS+IL V+PK R+ T +IL+HPL+ KY    S+K          K   N
Sbjct: 382 -NYLSKDAKDLISRILLVNPKARLTTEQILEHPLITKYDNQYSLKKENKLTKQAIKNYNN 440

Query: 304 LPR--EDTYLNPLSD--DNGDVCE------IDPKILQNLVVLWHGRDSKEITKKLKEPGA 353
           L R   +T L  L +  D  D+ +      ID  IL+NL +LW+G   + +  KL +   
Sbjct: 441 LMRGKSNTDLAILQNIPDKTDIIQLRSRNDIDDSILRNLQILWNGVPRETLISKLIQDPV 500

Query: 354 NAEKTLYALLDRFK 367
           + EK +Y+LL ++K
Sbjct: 501 SEEKLIYSLLWQYK 514

 Score = 59.3 bits (142), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 32/38 (84%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKA 54
           +GPWKLG+TLG GS+G+V+LA N  TGQ AAIK++ K+
Sbjct: 93  IGPWKLGKTLGKGSSGRVRLAKNKETGQLAAIKIVPKS 130

>Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507C
           (GIN4) - putative serine/threonine kinase [contig 120]
           PARTIAL
          Length = 148

 Score =  247 bits (630), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 111/120 (92%), Positives = 118/120 (98%)

Query: 85  MKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 144
           MKLL+H NVLRLYDVWET+SNLYMVLEY EKGELFNLLVERGPLPENEA+RFFRQIIIGI
Sbjct: 1   MKLLHHANVLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGI 60

Query: 145 SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISG 204
           SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALE++DKLLETSCGSPHYAAPEI+SG
Sbjct: 61  SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSG 120

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score =  258 bits (658), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 149/364 (40%), Positives = 221/364 (60%), Gaps = 26/364 (7%)

Query: 4   LTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXX 63
           ++NK S    G+ VG +++ +TLG GS GKV+LAY+ +TGQ+ A+K+I+K V        
Sbjct: 23  VSNKVSSLADGSRVGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKV-------- 74

Query: 64  XXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLV 123
                L    +   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V
Sbjct: 75  -----LAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIV 128

Query: 124 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 183
           +R  + E EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+
Sbjct: 129 QRNKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTD 188

Query: 184 DKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLL 243
              L+TSCGSP+YAAPE+ISG  Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L  
Sbjct: 189 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFK 246

Query: 244 KVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRN 303
            + +G + +P    +S  A DLI ++L V+P  RI   EI++    +    + +    ++
Sbjct: 247 NISNGVYTLP--KFLSPGASDLIKRMLIVNPLNRISIHEIMQDEWFK--VDLAEYLVPQD 302

Query: 304 LPREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKE----PGANAEKTL 359
           L +++ + N  S +  +V EID +++  L     G D  EI + L+     P  N  +  
Sbjct: 303 LKQQEQF-NKKSGNEENVEEIDDEMVVTLSKT-MGYDKDEIYEALESSEDTPAYNEIRNA 360

Query: 360 YALL 363
           Y L+
Sbjct: 361 YILI 364

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score =  253 bits (645), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 132/283 (46%), Positives = 186/283 (65%), Gaps = 22/283 (7%)

Query: 3   KLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXX 62
           +LTN      +G  +G +++ +TLG GS GKV+LAY+ STGQ+ A+K+I+K V       
Sbjct: 22  QLTN----HAQGQHIGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKV------- 70

Query: 63  XXXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLL 122
                 L    +   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +
Sbjct: 71  ------LAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYI 123

Query: 123 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           V+R  +PE EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T
Sbjct: 124 VQRDKMPEQEARRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMT 183

Query: 183 EDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLL 242
           +   L+TSCGSP+YAAPE+ISG  Y G E DVWS G+IL+ +L  RLPFD+E  +I  L 
Sbjct: 184 DGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLF 241

Query: 243 LKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285
             + +G + +P  + +S+ A  LI K+L V+P  RI   EI++
Sbjct: 242 KNISNGVYTIP--NFLSQGAASLIKKMLIVNPVNRITVHEIMQ 282

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score =  253 bits (646), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 128/272 (47%), Positives = 183/272 (67%), Gaps = 18/272 (6%)

Query: 14  GNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDS 73
           G+ +G +++ +TLG GS GKV+LAY+ +TGQ+ A+K+I+K V             L    
Sbjct: 40  GSHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKV-------------LAKSD 86

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEA 133
           +   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + E+EA
Sbjct: 87  MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEA 145

Query: 134 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGS 193
            RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGS
Sbjct: 146 RRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGS 205

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           P+YAAPE+ISG  Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L   + +G + +P
Sbjct: 206 PNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTIP 263

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILK 285
               +S+ A  LI K+L V+P  RI  +EI++
Sbjct: 264 --KFLSQGASTLIKKMLIVNPLNRISIQEIMQ 293

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score =  253 bits (646), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 128/277 (46%), Positives = 185/277 (66%), Gaps = 18/277 (6%)

Query: 14  GNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDS 73
           G+ +G +++ +TLG GS GKV+LA++S+T Q+ A+K+I+K V             L+   
Sbjct: 24  GSKIGNYQIVKTLGEGSFGKVKLAFHSTTRQKVALKIINKKV-------------LSKSD 70

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEA 133
           +   IEREI  ++LL HP++++LYDV ++   + MV+EYA+  ELF+ +V+R  + ENE 
Sbjct: 71  MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYADH-ELFDYIVQREKMSENEG 129

Query: 134 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGS 193
            RFF+QII  + YCH   IVHRDLKPENLLLD  YN+KI DFG++ + T+   L+TSCGS
Sbjct: 130 RRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHYNVKITDFGLSNIITDGNFLKTSCGS 189

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           P+YAAPE+ISG  Y G E DVWSCG+IL+ LL  RLPFD+E  +I  L   + +G + +P
Sbjct: 190 PNYAAPEVISGKLYAGPEVDVWSCGVILYVLLCRRLPFDDE--SIPTLFKNINNGVYTIP 247

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
             + +S  A  LI K+L V+P  RI   +I++ P  +
Sbjct: 248 --NFLSEGAASLIKKMLIVNPMNRITIGDIIQDPWFK 282

>Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON}
           (33810..35684) [1875 nt, 625 aa]
          Length = 624

 Score =  253 bits (646), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 126/272 (46%), Positives = 183/272 (67%), Gaps = 18/272 (6%)

Query: 14  GNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDS 73
           G+ +G +++ +TLG GS GKV+LA++ +TGQ+ A+K+I++ V             L+   
Sbjct: 36  GSRIGNYQIVKTLGEGSFGKVKLAFHVTTGQKVALKIINRKV-------------LSKSD 82

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEA 133
           +   IEREI  ++LL HP+++RLYDV ++   + M++EYA   ELF+ +V+R  + ENEA
Sbjct: 83  MQGRIEREIAYLRLLRHPHIIRLYDVIKSKDEIIMIIEYAHH-ELFDYIVQRDKMSENEA 141

Query: 134 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGS 193
            +FF+QII  + YCH   IVHRDLKPENLLLD  YN+KI DFG++ + T+   L+TSCGS
Sbjct: 142 RKFFQQIISAVDYCHRHMIVHRDLKPENLLLDEHYNVKITDFGLSNIMTDGNFLKTSCGS 201

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           P+YAAPE+ISG  Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L   + +G + +P
Sbjct: 202 PNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTLP 259

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILK 285
             + +S  A  LI K+L V+P  RI   EI++
Sbjct: 260 --NFLSDGAASLIKKMLIVNPINRISISEIMQ 289

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score =  252 bits (643), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 130/282 (46%), Positives = 183/282 (64%), Gaps = 18/282 (6%)

Query: 4   LTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXX 63
           L N  S    G  +G +++ +TLG GS GKV+LAY+++TGQ+ A+K+I+K V        
Sbjct: 39  LNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKV-------- 90

Query: 64  XXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLV 123
                L    +   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V
Sbjct: 91  -----LAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIV 144

Query: 124 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 183
           +R  + E EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+
Sbjct: 145 QRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTD 204

Query: 184 DKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLL 243
              L+TSCGSP+YAAPE+ISG  Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L  
Sbjct: 205 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFK 262

Query: 244 KVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285
            + +G + +P    +S  A  LI ++L V+P  RI   EI++
Sbjct: 263 NISNGVYTLPKF--LSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score =  252 bits (643), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 130/282 (46%), Positives = 184/282 (65%), Gaps = 18/282 (6%)

Query: 4   LTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXX 63
           L N  S    G  +G +++ +TLG GS GKV+LAY+++TGQ+ A+K+I+K V        
Sbjct: 38  LNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKV-------- 89

Query: 64  XXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLV 123
                L    +   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V
Sbjct: 90  -----LAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIV 143

Query: 124 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 183
           +R  + E+EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+
Sbjct: 144 QRDKMSEDEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTD 203

Query: 184 DKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLL 243
              L+TSCGSP+YAAPE+ISG  Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L  
Sbjct: 204 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFK 261

Query: 244 KVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285
            + +G + +P    +S  A  LI ++L V+P  RI   EI++
Sbjct: 262 NISNGVYSLPKF--LSPGAASLIKRMLIVNPLNRISIHEIMQ 301

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score =  252 bits (643), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 130/282 (46%), Positives = 183/282 (64%), Gaps = 18/282 (6%)

Query: 4   LTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXX 63
           L N  S    G  +G +++ +TLG GS GKV+LAY+++TGQ+ A+K+I+K V        
Sbjct: 39  LNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKV-------- 90

Query: 64  XXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLV 123
                L    +   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V
Sbjct: 91  -----LAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIV 144

Query: 124 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 183
           +R  + E EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+
Sbjct: 145 QRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTD 204

Query: 184 DKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLL 243
              L+TSCGSP+YAAPE+ISG  Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L  
Sbjct: 205 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFK 262

Query: 244 KVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285
            + +G + +P    +S  A  LI ++L V+P  RI   EI++
Sbjct: 263 NISNGVYTLP--KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score =  251 bits (641), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 127/272 (46%), Positives = 182/272 (66%), Gaps = 18/272 (6%)

Query: 14  GNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDS 73
           G+ +G +++ +TLG GS GKV+LAY+++TGQ+ A+K+I++ V             L    
Sbjct: 38  GSKIGNYQIIKTLGEGSFGKVKLAYHATTGQKVALKIINRKV-------------LAKSD 84

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEA 133
           +   IEREI  ++LL HP++++LYDV ++   + MV+EYA+  ELF+ +V+R  + E EA
Sbjct: 85  MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYADN-ELFDYIVQRDKMSEQEA 143

Query: 134 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGS 193
            RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGS
Sbjct: 144 RRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGS 203

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           P+YAAPE+ISG  Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L   + +G + +P
Sbjct: 204 PNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGIYTLP 261

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILK 285
               +S  A  LI K+L V+P  RI   EI++
Sbjct: 262 --RFLSEGASSLIKKMLIVNPLNRISIHEIMQ 291

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score =  251 bits (640), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 130/282 (46%), Positives = 183/282 (64%), Gaps = 18/282 (6%)

Query: 4   LTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXX 63
           L N  S    G  +G +++ +TLG GS GKV+LAY+++TGQ+ A+K+I+K V        
Sbjct: 40  LNNPKSSLADGAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKV-------- 91

Query: 64  XXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLV 123
                L    +   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V
Sbjct: 92  -----LAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIV 145

Query: 124 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 183
           +R  + E EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+
Sbjct: 146 QRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTD 205

Query: 184 DKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLL 243
              L+TSCGSP+YAAPE+ISG  Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L  
Sbjct: 206 GNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFK 263

Query: 244 KVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285
            + +G + +P    +S  A  LI ++L V+P  RI   EI++
Sbjct: 264 NISNGVYTLPKF--LSPGAAGLIKRMLIVNPLNRISIHEIMQ 303

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score =  248 bits (632), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 125/272 (45%), Positives = 183/272 (67%), Gaps = 18/272 (6%)

Query: 14  GNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDS 73
           G+ +G +++ +TLG GS GKV+LAY+ +T Q+ A+K+I+K +             L    
Sbjct: 36  GSRIGNYQIIKTLGEGSFGKVKLAYHVTTNQRVALKIINKKI-------------LAKSD 82

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEA 133
           +   IEREI  ++LL HP++++LYDV ++  ++ MV+EYA+  ELF+ +V+R  + ENEA
Sbjct: 83  MQGRIEREISYLRLLRHPHIIKLYDVIKSKEDIIMVIEYADH-ELFDYIVQRDKMSENEA 141

Query: 134 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGS 193
            +FF+QII  + YCH   IVHRDLKPENLLLD + N+KIADFG++ + T+   L+TSCGS
Sbjct: 142 RKFFQQIISAVEYCHRHKIVHRDLKPENLLLDEELNVKIADFGLSNIMTDGNFLKTSCGS 201

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           P+YAAPE+ISG  Y G E DVWSCG+IL+ +L  RLPFD  D +I  L   + +G + +P
Sbjct: 202 PNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPVLFKNISNGIYTLP 259

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILK 285
               +S  A +LI ++L V+P  RI   EI++
Sbjct: 260 --KFLSPGAANLIKRMLIVNPLNRISMNEIME 289

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  248 bits (633), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 126/271 (46%), Positives = 177/271 (65%), Gaps = 18/271 (6%)

Query: 14  GNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDS 73
           G  +G +++ +TLG GS GKV+LAY+ +T Q+ A+K+I+K V             L    
Sbjct: 62  GARIGNYQIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKKV-------------LAKSD 108

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEA 133
           +   +EREI  ++LL HP++++LYDV ++   + MV+EYA   ELF  +V+R  + ENEA
Sbjct: 109 MQGRVEREISFLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-NNELFEYIVQRDKMTENEA 167

Query: 134 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGS 193
            +FF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGS
Sbjct: 168 RKFFQQIISAVEYCHRHKIVHRDLKPENLLLDENLNVKIADFGLSNIMTDGNFLKTSCGS 227

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           P+YAAPE+ISG  Y G E DVWSCG+IL+ +L  RLPFD  D +I  L   + +G + +P
Sbjct: 228 PNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPALFKNISNGIYTLP 285

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREIL 284
               +S  A +LI K+L V+P  RI   EI+
Sbjct: 286 --KFLSEGAANLIKKMLIVNPLNRISMTEII 314

>KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON}
           Anc_5.611 YDR477W
          Length = 644

 Score =  248 bits (633), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 124/272 (45%), Positives = 181/272 (66%), Gaps = 18/272 (6%)

Query: 14  GNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDS 73
           G+ +G +++ +TLG GS GKV+LAY+ +TGQ+ A+K+I+K +             L    
Sbjct: 43  GSKIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKI-------------LAKSD 89

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEA 133
           +   IEREI  ++LL HP++++LYDV ++   + +V+E+A   ELF+ +++R  + ENEA
Sbjct: 90  MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSENEA 148

Query: 134 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGS 193
            RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGS
Sbjct: 149 RRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGS 208

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           P+YAAPE+ISG  Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L   + +G + +P
Sbjct: 209 PNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYILP 266

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILK 285
               +S  A  LI ++L V+P  RI   EI++
Sbjct: 267 KF--LSPGASSLIKRMLIVNPLNRISIHEIMQ 296

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score =  249 bits (636), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 127/272 (46%), Positives = 180/272 (66%), Gaps = 18/272 (6%)

Query: 14  GNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDS 73
           G  +G +++ +TLG GS GKV+LAY+ +TGQ+ A+K+I+K V             L    
Sbjct: 55  GAHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKV-------------LAKSD 101

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEA 133
           +   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + ENEA
Sbjct: 102 MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSENEA 160

Query: 134 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGS 193
            RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGS
Sbjct: 161 RRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGS 220

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           P+YAAPE+ISG  Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G + +P
Sbjct: 221 PNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTIP 278

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILK 285
               +S+ A  LI ++L V+P  RI   EI++
Sbjct: 279 --KFLSQGASSLIKRMLIVNPLNRISISEIMQ 308

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score =  246 bits (628), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 126/272 (46%), Positives = 179/272 (65%), Gaps = 18/272 (6%)

Query: 14  GNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDS 73
           G+ +G +++ +TLG GS GKV+LAY+ +TGQ+ A+K+I+K V             L    
Sbjct: 36  GSRIGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKV-------------LAKSD 82

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEA 133
           +   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + E EA
Sbjct: 83  MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEKEA 141

Query: 134 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGS 193
            RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGS
Sbjct: 142 RRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGS 201

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           P+YAAPE+ISG  Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G + +P
Sbjct: 202 PNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLP 259

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILK 285
               +S  A  LI ++L V+P  RI   EI++
Sbjct: 260 --KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 289

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score =  246 bits (627), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 127/272 (46%), Positives = 181/272 (66%), Gaps = 18/272 (6%)

Query: 14  GNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDS 73
           G  +G +++ +TLG GS GKV+LA++ STGQ+ A+K+I+K V             L    
Sbjct: 33  GQRIGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKV-------------LAKSD 79

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEA 133
           +   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + ENEA
Sbjct: 80  MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEA 138

Query: 134 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGS 193
            RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGS
Sbjct: 139 RRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGS 198

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           P+YAAPE+ISG  Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G + +P
Sbjct: 199 PNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSIP 256

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILK 285
               +S+ A +LI ++L V+P  RI   EI++
Sbjct: 257 --KFLSQGAANLIKRMLIVNPLNRITIHEIME 286

>Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {ON}
           similar to Ashbya gossypii AEL230W
          Length = 613

 Score =  245 bits (626), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 128/272 (47%), Positives = 179/272 (65%), Gaps = 18/272 (6%)

Query: 14  GNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDS 73
           G  +G +++ +TLG GS GKV+LAY+ ST Q+ A+K+I+K V             L    
Sbjct: 37  GQRIGKYQVIKTLGEGSFGKVKLAYHVSTSQKVALKIINKKV-------------LAKSD 83

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEA 133
           +   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + ENEA
Sbjct: 84  MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEA 142

Query: 134 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGS 193
            RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGS
Sbjct: 143 RRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGS 202

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           P+YAAPE+ISG  Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G + +P
Sbjct: 203 PNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSIP 260

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILK 285
               +S  A +LI K+L V+P  RI   EI++
Sbjct: 261 --KFLSPGAANLIKKMLIVNPLNRITIHEIME 290

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score =  246 bits (627), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 180/277 (64%), Gaps = 18/277 (6%)

Query: 14  GNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDS 73
           G+ +G +++ +TLG GS GKV+LAY+ +T Q+ A+K+I+K V             L    
Sbjct: 39  GSRIGNYQIVKTLGEGSFGKVKLAYHITTNQKVALKIINKKV-------------LAKSD 85

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEA 133
           +   IEREI  ++LL HP++++LYDV ++   + +V+E+A   ELF+ +++R  + E EA
Sbjct: 86  MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSEQEA 144

Query: 134 IRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGS 193
            RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGS
Sbjct: 145 RRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGS 204

Query: 194 PHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 253
           P+YAAPE+ISG  Y G E DVWSCG+IL+ +L  RLPFD+E  +I  L   + +G + +P
Sbjct: 205 PNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYILP 262

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
               +S  A +LI K+L V+P  RI   EI K    Q
Sbjct: 263 KF--LSLGAANLIKKMLIVNPLNRISISEIFKDEWFQ 297

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score =  244 bits (622), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 126/269 (46%), Positives = 178/269 (66%), Gaps = 18/269 (6%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           +G +++ +TLG GS GKV+LAY+ +TGQ+ A+K+I+K V             L    +  
Sbjct: 28  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKV-------------LAKSDMQG 74

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + ENEA RF
Sbjct: 75  RIEREISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRF 133

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L TSCGSP+Y
Sbjct: 134 FQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLRTSCGSPNY 193

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
           AAPE+ISG  Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G + +P   
Sbjct: 194 AAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGIYTLPKF- 250

Query: 257 EISREAQDLISKILTVDPKKRIKTREILK 285
            +S  A +LI ++L V+P  RI   EI++
Sbjct: 251 -LSPGAANLIKRMLIVNPLNRITIHEIMQ 278

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score =  242 bits (618), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 179/269 (66%), Gaps = 18/269 (6%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           +G +++ +TLG GS GKV+LAY+ +TGQ+ A+K+I+K V             L    +  
Sbjct: 29  IGKYQIIKTLGEGSFGKVKLAYHITTGQKVALKIINKKV-------------LAKSDMQG 75

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + E+EA RF
Sbjct: 76  RIEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMNEDEARRF 134

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+Y
Sbjct: 135 FQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNY 194

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
           AAPE+ISG  Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G + +P   
Sbjct: 195 AAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLP--K 250

Query: 257 EISREAQDLISKILTVDPKKRIKTREILK 285
            +S  A +LI ++L V+P  RI   EI++
Sbjct: 251 FLSPGASNLIKRMLIVNPLNRITIHEIMQ 279

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score =  243 bits (620), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 180/276 (65%), Gaps = 18/276 (6%)

Query: 10  LEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLL 69
           L   G+ +G +++ +TLG GS GKV+LAY+ +TGQ+ A+K+I+K V             L
Sbjct: 41  LLADGSHIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKV-------------L 87

Query: 70  TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLP 129
               +   IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + 
Sbjct: 88  AKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMS 146

Query: 130 ENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLET 189
           E EA RFF+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+T
Sbjct: 147 EEEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKT 206

Query: 190 SCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQ 249
           SCGSP+YAAPE+ISG  Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G 
Sbjct: 207 SCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGV 264

Query: 250 FEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285
           + +P    +S  A  LI ++L V+P  RI   EI++
Sbjct: 265 YTLP--KFLSEGAAGLIKRMLIVNPLNRISILEIMQ 298

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score =  241 bits (616), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 178/269 (66%), Gaps = 18/269 (6%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           +G +++ +TLG GS GKV+LAY+ +TGQ+ A+K+I+K V             L    +  
Sbjct: 27  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKV-------------LAKSDMQG 73

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            IEREI  ++LL HP++++LYDV ++   + MV+EYA   ELF+ +V+R  + E EA RF
Sbjct: 74  RIEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMSEREARRF 132

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F+QII  + YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+   L+TSCGSP+Y
Sbjct: 133 FQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNY 192

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
           AAPE+ISG  Y G E DVWS G+IL+ +L  RLPFD+E  +I  L   + +G + +P   
Sbjct: 193 AAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTLPKF- 249

Query: 257 EISREAQDLISKILTVDPKKRIKTREILK 285
            +S  A +LI ++L V+P  RI   EI++
Sbjct: 250 -LSPGAANLIKRMLIVNPLNRITIHEIME 277

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score =  211 bits (536), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 119/292 (40%), Positives = 170/292 (58%), Gaps = 17/292 (5%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQ-------AAIKVISKAVFXXXXXXXXXXXL 68
           T GP+ +G TLG G  GKV+LA++ S  QQ       A  K ++  V             
Sbjct: 44  TFGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLIKRDF 103

Query: 69  LTPD-SLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGP 127
           +T D S    I REI  +K L+HPN+++L +V +    + +VLEYA  GE +  +  +  
Sbjct: 104 ITKDPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYKFIQRKRR 163

Query: 128 LPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKL 186
           L EN A R F Q+I  + Y H+ G+VHRDLK ENLLLD++ N+ I DFG       ++ +
Sbjct: 164 LKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNEFLRQNGM 223

Query: 187 LETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEE----DGN-IRN 240
           ++TSCGSP YAAPE ++S  PY   + D WSCGIILFA+L G LP+D++    DG+ I  
Sbjct: 224 MKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNPDGHDISR 283

Query: 241 LLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKY 292
           L   + +   + P  + I+   +DL+ KIL +DPKKRI  R I KHP ++ +
Sbjct: 284 LYNYILNTPLKFP--EYINPVPRDLLRKILVIDPKKRINIRSIEKHPWLESH 333

>KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8.654
           YPL141C
          Length = 805

 Score =  209 bits (533), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 120/325 (36%), Positives = 176/325 (54%), Gaps = 40/325 (12%)

Query: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTG--------QQAAIKVISKAVFXXXXXXX 63
            K  + GP+ +G TLG G  GKV++ + +  G        +Q AIK+I +          
Sbjct: 34  AKCPSFGPYLIGSTLGQGGFGKVKMGWTTPMGNKGIYDVPKQVAIKLIKRDSISNDKSKE 93

Query: 64  XXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLV 123
                         I REI  +K L+HPN+++L +V +    + +VLEYA  GE +  + 
Sbjct: 94  VK------------IYREINALKQLHHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQ 141

Query: 124 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALET 182
           +R  L E+ A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      +
Sbjct: 142 KRRVLKEHVACRLFAQLISGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEYFS 201

Query: 183 EDKLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEE----DG- 236
           +++L+ TSCGSP YAAPE +IS  PY G   D+WSCGIILFA+L G LP+D++    DG 
Sbjct: 202 QNELMTTSCGSPCYAAPELVISTQPYQGRRADLWSCGIILFAMLAGYLPWDDDKDNPDGE 261

Query: 237 NIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPS-- 294
           +I  L   +     + P  + I+   +DL+ +IL  DP++R+  REI  H  ++K+    
Sbjct: 262 DIAKLYYYITHTALKFP--EYITPIPRDLLRRILVADPRRRVTLREIQGHQWLKKHAQFL 319

Query: 295 ---------IKDSKTIRNLPREDTY 310
                    I  SK I  LP+ + +
Sbjct: 320 SIQPEEWDRISQSKNITRLPKHNKH 344

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score =  208 bits (530), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 170/296 (57%), Gaps = 39/296 (13%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTG------QQAAIKVISKAVFXXXXXXXXXXXLL 69
           T GP+ +G TLG G  GKV+L ++ ++       +Q AIK+I +                
Sbjct: 36  TFGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRR---------------- 79

Query: 70  TPDSLPYGIEREIII------MKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLV 123
             D++P   E+EI I      +K LNHPN++RL +V +    + +VLEYA  GE +  + 
Sbjct: 80  --DTIPKNSEKEIKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQ 137

Query: 124 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALET 182
           ++  L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       
Sbjct: 138 KKRRLKEGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLP 197

Query: 183 EDKLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEE----DG- 236
           E++L++TSCGSP YAAPE +++  PY   + DVWSCG+IL+A+L G LP+D++    DG 
Sbjct: 198 ENELMKTSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGD 257

Query: 237 NIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKY 292
           +I  L   +     + P  D I+   +DL+ +IL  DPK+RI   + LKH  +Q +
Sbjct: 258 DIGKLYRYITRTPLKFP--DYIAPVPRDLLREILIPDPKRRITISKTLKHQWLQPH 311

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score =  208 bits (529), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 169/296 (57%), Gaps = 39/296 (13%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTG------QQAAIKVISKAVFXXXXXXXXXXXLL 69
           T GP+ +G TLG G  GKV++ ++ ++       +Q AIK+I +                
Sbjct: 36  TFGPYIVGSTLGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRR---------------- 79

Query: 70  TPDSLPYGIEREIII------MKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLV 123
             D++P   E+E+ I      +K LNHPN++RL +V +    + +VLEYA  GE +  + 
Sbjct: 80  --DTIPKNSEKEVKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQ 137

Query: 124 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALET 182
           ++  L E+ A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       
Sbjct: 138 KKRRLKESAACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLP 197

Query: 183 EDKLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEE----DG- 236
           E++L++TSCGSP YAAPE +++  PY   + D+WSCG+I++A+L G LP+D++    DG 
Sbjct: 198 ENELMKTSCGSPCYAAPELVVTARPYEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGD 257

Query: 237 NIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKY 292
           +I  L   +     + P  D I+   +DL+  IL  DPKKRI   + L H  +Q +
Sbjct: 258 DIGKLYRYITRTPLKFP--DYIAPVPRDLLRAILVADPKKRITIAQTLHHQWLQPH 311

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score =  207 bits (528), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 114/301 (37%), Positives = 165/301 (54%), Gaps = 31/301 (10%)

Query: 9   SLEVKGNTVGPWKLGETLGLGSTGKVQLAY----------NSSTGQQAAIKVISKAVFXX 58
           S+  K    GP+ +G T+G G  GKV+L +          N    +Q AIK+I +     
Sbjct: 58  SMRRKHIAFGPYIIGSTIGQGEFGKVKLGWSKNPPSSPPNNLGISKQVAIKLIKRDAISK 117

Query: 59  XXXXXXXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGEL 118
                         S    I REI  +K L+HPN+++L +V +    + +VLEYA  GE 
Sbjct: 118 D------------SSKELKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYASGGEF 165

Query: 119 FNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA 178
           +  +  +  L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG  
Sbjct: 166 YRYIQRKKRLKETAACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLVITDFGFV 225

Query: 179 -ALETEDKLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDG 236
               + ++L++TSCGSP YAAPE +IS  PY   + D+WSCGIIL+A+L G LP+D++ G
Sbjct: 226 NEFYSHNELMKTSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDSG 285

Query: 237 N-----IRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
           N     I  L   +     + P  D I+   +DL+ KIL  DP++RI  ++I KH  ++ 
Sbjct: 286 NPDGDDISRLYYYITKTPLKFP--DYINPIPRDLLRKILVSDPRRRITMKQIEKHEWLKP 343

Query: 292 Y 292
           +
Sbjct: 344 H 344

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score =  206 bits (524), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 112/283 (39%), Positives = 161/283 (56%), Gaps = 26/283 (9%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQ-----QAAIKVISKAVFXXXXXXXXXXXLLT 70
           T GP+ +G TLG G  GKV+L +  +T +     Q AIK+I +              +L 
Sbjct: 36  TFGPYYVGSTLGEGEFGKVKLGWTKTTSKLEMPKQVAIKLIRR------------DAILN 83

Query: 71  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPE 130
                  I REI  +K L HPN+++L +V +    + +VLE+A  GE +  + ++  L E
Sbjct: 84  YSEKETKIYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEFASGGEFYKYIQKKRRLKE 143

Query: 131 NEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLLET 189
             A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++L++T
Sbjct: 144 TPACRLFAQLVSGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFSQRNELMKT 203

Query: 190 SCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEE----DG-NIRNLLL 243
           SCGSP YAAPE +++  PY   + DVWSCGIIL+A+L G LP+D++    DG +I  L L
Sbjct: 204 SCGSPCYAAPELVVTTEPYEARKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKLYL 263

Query: 244 KVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
            +     + P  + I+   +DL+ KIL  DP KR+  R I KH
Sbjct: 264 YITKTALKFP--EYINPIQRDLLRKILVSDPTKRLNIRNIEKH 304

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score =  206 bits (523), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 115/290 (39%), Positives = 167/290 (57%), Gaps = 39/290 (13%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTG------QQAAIKVISKAVFXXXXXXXXXXXLL 69
           T GP+ +G TLG G  GKV+L ++ +        +Q AIK+I +                
Sbjct: 35  TFGPYIVGSTLGEGEFGKVKLGWSKAASSSLEVPKQVAIKLIRR---------------- 78

Query: 70  TPDSLP------YGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLV 123
             DS+P        I REI  +K L+HPN+++L +V +    + +VLEYA  GE +  + 
Sbjct: 79  --DSIPKNSEKEVKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQ 136

Query: 124 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALET 182
            +  L E  A R F Q++ G++Y H+ G+VHRDLK ENLLLD   N+ I DFG      +
Sbjct: 137 RKRRLKEAIACRLFAQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFVS 196

Query: 183 EDKLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEE----DGN 237
            ++L++TSCGSP YAAPE ++S  PY   ++DVWSCG+IL+A+L G LP+D++    DGN
Sbjct: 197 HNELMKTSCGSPCYAAPELVVSTKPYEARKSDVWSCGVILYAMLAGYLPWDDDPKNPDGN 256

Query: 238 -IRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
            I  L   +     + P  + I+  ++DL+ +IL  DPKKRI  R I KH
Sbjct: 257 DIVRLYYYITRTPLKFP--EYITPLSRDLLRRILVSDPKKRITLRSIHKH 304

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score =  205 bits (521), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 115/295 (38%), Positives = 167/295 (56%), Gaps = 38/295 (12%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTG-----QQAAIKVISKAVFXXXXXXXXXXXLLT 70
           T GP+ LG TLG G  G+V+L ++ +T      +Q AIK+I +                 
Sbjct: 40  TFGPYILGSTLGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRR----------------- 82

Query: 71  PDSLP------YGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVE 124
            D++P        I REI  +K L+HPN+++L +V +    + +VLEYA  GE +  + +
Sbjct: 83  -DTIPKNSDKEIKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQK 141

Query: 125 RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETE 183
           +  L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG        
Sbjct: 142 KRRLKEAVACRLFAQLISGVQYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFAH 201

Query: 184 DKLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEE----DGN- 237
            +L++TSCGSP YAAPE ++S  PY   + D+WSCG+IL+A+L G LP+D++    DGN 
Sbjct: 202 SELMKTSCGSPCYAAPELVVSSKPYEARKADIWSCGVILYAMLAGYLPWDDDTKNPDGND 261

Query: 238 IRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKY 292
           I  L   +     + P  + I+   +DL+ +IL  DPK+RI  R I KH  V+ +
Sbjct: 262 IGKLYQYITRTPLKFP--EYITPLPRDLLRRILYPDPKRRISMRSIQKHEWVKPH 314

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score =  206 bits (524), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 110/295 (37%), Positives = 169/295 (57%), Gaps = 38/295 (12%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTG-----QQAAIKVISKAVFXXXXXXXXXXXLLT 70
           T GP+ +G TLG G  GKV+L ++ +TG     +Q AIK+I +                 
Sbjct: 40  TFGPYIVGSTLGEGEFGKVKLGWSKTTGSNEVPKQVAIKLIRR----------------- 82

Query: 71  PDSLP------YGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVE 124
            D++P        I REI  +K L HPN++RL +V +    + +VLEYA  GE +  + +
Sbjct: 83  -DTVPKNSDKEVKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYRYIQK 141

Query: 125 RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETE 183
           +  L E+ A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       +
Sbjct: 142 KRRLKEHAACRLFAQLISGVHYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFNHK 201

Query: 184 DKLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGN----- 237
           ++L++TSCGSP YAAPE +++  PY   + D+WSCG+I++A+L G LP+D++  N     
Sbjct: 202 NELMKTSCGSPCYAAPELVVTTKPYEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDD 261

Query: 238 IRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKY 292
           I  L   +     + P  + I+   +DL+ +IL  +PKKR+  R++ +H  +Q +
Sbjct: 262 IAKLYHYITKTPLKFP--EYINPVPRDLLRRILVSNPKKRLNLRQVEQHQWLQPH 314

>Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {ON}
           YPL141C (REAL)
          Length = 858

 Score =  205 bits (522), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 115/297 (38%), Positives = 166/297 (55%), Gaps = 31/297 (10%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAY-----NSSTG-----QQAAIKVISKAVFXXXXXXXXX 65
           T GP+ LG TLG G  GKV+L +     NSST      +Q A+K+I +            
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKNFPNSSTSAFDFPKQVAVKLIKRDTISNDYKKEVK 96

Query: 66  XXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVER 125
                       I REI  +K L+HPN+++L +V +    + +VLEYA  GE +  + ++
Sbjct: 97  ------------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKK 144

Query: 126 GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETED 184
             L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + +
Sbjct: 145 RRLKETNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRN 204

Query: 185 KLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDE-----EDGNI 238
           +L++TSCGSP YAAPE ++S  PY   + D+WSCG+IL+A+L G LP+D+     E  +I
Sbjct: 205 ELMKTSCGSPCYAAPELVVSTKPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDI 264

Query: 239 RNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSI 295
             L   + S   + P  D I    +DL+ +IL  DPK+RI  ++I KH  ++ + S 
Sbjct: 265 GRLYNYICSTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIEKHGWLKSHSSF 319

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score =  206 bits (525), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 194/353 (54%), Gaps = 37/353 (10%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKA-------------------VF 56
           ++G W   ET+G GS GKV+LA N  T +  AIK++++A                   + 
Sbjct: 93  SLGEWDFIETVGAGSMGKVKLARNRQTREVCAIKIVNRATKIFLTKESKLMSHPTNHIIM 152

Query: 57  XXXXXXXXXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKG 116
                      L    S      RE  + ++L HP++ RL++++   ++ YM+ EY   G
Sbjct: 153 NEKDILDRQKRLEKEISRDRRTIREASLGQILYHPHICRLFEMYTLSNHFYMLFEYVSGG 212

Query: 117 ELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFG 176
           +L + +++ G L E+ A  F RQI+  + Y HA  IVHRDLK EN+++    NIKI DFG
Sbjct: 213 QLLDYIIQHGSLKESHARNFARQILSALKYLHANNIVHRDLKIENIMISSNGNIKIIDFG 272

Query: 177 MAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDG 236
           ++ L  + K L+T CGS ++AAPE++   PY G E DVWS G++L+ L+ G++PFD+E+ 
Sbjct: 273 LSNLYDKSKKLKTYCGSLYFAAPELLRANPYIGPEIDVWSFGVVLYVLVCGKVPFDDENS 332

Query: 237 NIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHP-LVQKYPSI 295
           N+  L  K++ G+   P    +S E   L+S +L VDP KR    +++KH  +V+ Y SI
Sbjct: 333 NV--LHEKIKQGRVFYP--QFLSIEVISLLSTMLVVDPFKRATLDQVMKHHWMVKDYDSI 388

Query: 296 KDSKTIRNLPREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKL 348
            D+    +LP+      PL+ ++     ID K+++ +  L    D ++  KKL
Sbjct: 389 PDA----HLPKRV----PLTSES-----IDMKVIKEMKHLEFIEDIEQTEKKL 428

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score =  203 bits (517), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 116/297 (39%), Positives = 165/297 (55%), Gaps = 31/297 (10%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAY-----NSSTG-----QQAAIKVISKAVFXXXXXXXXX 65
           T GP+ LG TLG G  GKV+L +     NSS       +Q AIK+I +            
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSISNDYRKEVK 96

Query: 66  XXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVER 125
                       I REI  +K L+HPN+++L +V +    + +VLEYA  GE +  + ++
Sbjct: 97  ------------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKK 144

Query: 126 GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETED 184
             L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + +
Sbjct: 145 RRLKEMNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRN 204

Query: 185 KLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDE-----EDGNI 238
           +L++TSCGSP YAAPE +IS  PY   + D+WSCG+IL+A+L G LP+D+     E  +I
Sbjct: 205 ELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSDI 264

Query: 239 RNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSI 295
             L   + S   + P  D I    +DL+ ++L  DPKKRI  ++I KH  ++ + S 
Sbjct: 265 GRLYNYINSTPLKFP--DYILPIPRDLLRRMLVSDPKKRINLKQIKKHEWLKPHSSF 319

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score =  203 bits (517), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 110/294 (37%), Positives = 163/294 (55%), Gaps = 27/294 (9%)

Query: 10  LEVKGNTVGPWKLGETLGLGSTGKVQLAY------NSSTGQQAAIKVISKAVFXXXXXXX 63
           L+ K  T GP+ +G TLG G  GKV+L +      N    +Q AIK+I +          
Sbjct: 34  LKRKQITFGPYYIGSTLGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLIRR---------- 83

Query: 64  XXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLV 123
               ++        I REI  +K L HPN+++L +V +    + +VLEYA  GE +  + 
Sbjct: 84  --DKIVKNSEKEIKIFREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYRYIQ 141

Query: 124 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALET 182
            +  L E    R F Q++ G++Y H+ G+VHRDLK ENLLLD   N+ I DFG       
Sbjct: 142 RKRRLKETAGCRLFTQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFLK 201

Query: 183 EDKLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDE-----EDG 236
           ++ L++TSCGSP YAAPE +IS  PY   + D+WSCGIIL+A+L G LP+D+     E  
Sbjct: 202 DNDLMKTSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDPQNPEGD 261

Query: 237 NIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
           +I  L   +     + P  + IS   +DL+ ++L  DP+KR+  R+I +H  ++
Sbjct: 262 DIARLYYFITRTSLKFP--EYISPIPRDLLRRLLVSDPRKRLNIRQIQQHEWLR 313

>KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {ON}
           Anc_8.654 YPL141C
          Length = 817

 Score =  202 bits (514), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 114/323 (35%), Positives = 176/323 (54%), Gaps = 33/323 (10%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAA-------IKVISKAVFXXXXXXXXXXXL 68
           T GP+ +G T+G G  GKV+L ++ S   + +       + + +               L
Sbjct: 57  TFGPYIIGSTIGQGEFGKVKLGWSKSISNKQSHSPSANGLGLYATPALPIEVPKQVAIKL 116

Query: 69  LTPDSLP------YGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLL 122
           +  D++         I REI  +K L HPN+++L +V +    + +VLEYA  GE +  +
Sbjct: 117 IRRDTISKDPRREIKIYREINALKQLTHPNIVKLDEVLQNSKYIGIVLEYASGGEFYKYI 176

Query: 123 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALE 181
             +  L E  A + F Q+I G++Y H+ G++HRDLK EN+LLD   N+ I DFG      
Sbjct: 177 QRKKRLKETIACKLFAQLISGVNYIHSKGLIHRDLKLENILLDKNENLIITDFGFVNEFV 236

Query: 182 TEDKLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEE-----D 235
           T ++L++TSCGSP YAAPE +IS  PY   + D+WSCGIILFA+L G LP+D++      
Sbjct: 237 TSNELMKTSCGSPCYAAPELVISSQPYEARKVDIWSCGIILFAMLAGYLPWDDDPENPSG 296

Query: 236 GNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH-------PL 288
            NI  L   + +   + P  + I+   +DL+ +IL  DPKKR+  R ILKH       P 
Sbjct: 297 ENIAKLYFYITTTPLKFP--EYITAIPRDLLRRILIADPKKRVDLRYILKHQWLKPHTPF 354

Query: 289 V----QKYPSIKDSKTIRNLPRE 307
           +    +++ +I  S++I  LP+ 
Sbjct: 355 LSISPEEWDNISRSQSILRLPKH 377

>Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {ON}
           YPL141C (REAL)
          Length = 865

 Score =  202 bits (514), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 113/288 (39%), Positives = 161/288 (55%), Gaps = 31/288 (10%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAY-----NSSTG-----QQAAIKVISKAVFXXXXXXXXX 65
           T GP+ LG TLG G  GKV+L +     NSS       +Q A+K+I +            
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKNFSNSSATTFEFPKQVAVKLIKRDTISNNYKKEVK 96

Query: 66  XXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVER 125
                       I REI  +K L+HPN+++L +V +    + +VLEYA  GE +  + ++
Sbjct: 97  ------------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKK 144

Query: 126 GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETED 184
             L E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + +
Sbjct: 145 RRLKETNACRLFSQLVSGVYYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRN 204

Query: 185 KLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGN-----I 238
           +L++TSCGSP YAAPE +IS  PY   + D+WSCG+IL+A+L G LP+D++  N     I
Sbjct: 205 ELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDSNNPEGSDI 264

Query: 239 RNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
             L   + S   + P  D I    +DL+ +IL  DPKKR+  ++I KH
Sbjct: 265 GRLYNYINSTPLKFP--DYILPIPRDLLRRILVPDPKKRMNLKQIKKH 310

>NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654
          Length = 864

 Score =  202 bits (514), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 115/298 (38%), Positives = 165/298 (55%), Gaps = 31/298 (10%)

Query: 6   NKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAY------NSSTG----QQAAIKVISKAV 55
           N P  + K  T GP+ +G TLG G  GKV+L +      +SS+G    +Q AIK+I +  
Sbjct: 34  NIPLEKRKHVTFGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDT 93

Query: 56  FXXXXXXXXXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEK 115
                                 I REI  +K L HPN+++L +V +    + +VLEYA  
Sbjct: 94  ISKDSSKEIK------------IYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASG 141

Query: 116 GELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADF 175
           GE +  +  +  L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DF
Sbjct: 142 GEFYKYIQRKKRLKEGPACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDF 201

Query: 176 GMAA-LETEDKLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDE 233
           G  +   +  +L++TSCGSP YAAPE ++S  PY   + D+WSCG+IL+A+L G LP+D+
Sbjct: 202 GFVSEFYSHGELMKTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWDD 261

Query: 234 EDGN-----IRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
           + GN     I  L   +     + P  D I+   +DL+ +IL  DP++RI  + I KH
Sbjct: 262 DAGNPDGDDISRLYHYITQTPLKFP--DYINPIPRDLLRRILISDPRRRITIKYIEKH 317

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score =  204 bits (519), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 104/303 (34%), Positives = 169/303 (55%), Gaps = 23/303 (7%)

Query: 5   TNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXX 64
           + +P  +    ++G W   ET+G GS GKV+LA +  T +  AIK++++A          
Sbjct: 139 SQEPPKQFHRKSLGDWDFLETVGAGSMGKVKLARHHKTNEVCAIKIVNRAT---KSFLQK 195

Query: 65  XXXLLTPDSLPYGIE----------------REIIIMKLLNHPNVLRLYDVWETDSNLYM 108
              L  P S    +E                RE  + ++L HP++ RL+++    ++ YM
Sbjct: 196 EASLPPPKSEEEALERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEICTMSNHFYM 255

Query: 109 VLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKY 168
           + EY   G+L + +++ G L E+ A +F R I   + Y H   IVHRDLK EN+++    
Sbjct: 256 LFEYVSGGQLLDYIIQHGSLREHHARKFTRGIASALQYLHGNNIVHRDLKIENIMISTSG 315

Query: 169 NIKIADFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGR 228
           +IKI DFG++ L    K L T CGS ++AAPE++   PY G E D+WS G++L+ L  G+
Sbjct: 316 DIKIIDFGLSNLYDSKKQLNTFCGSLYFAAPELLKANPYVGPEVDIWSFGVVLYVLACGK 375

Query: 229 LPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPL 288
           +PFD+E+ ++  L  K++ G+ + P    +S E   L+SK+L VDPKKR   ++I+ HP 
Sbjct: 376 VPFDDENSSV--LHEKIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRASLQQIVNHPW 431

Query: 289 VQK 291
           + +
Sbjct: 432 MTR 434

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score =  197 bits (500), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 111/286 (38%), Positives = 159/286 (55%), Gaps = 29/286 (10%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNS--------STGQQAAIKVISKAVFXXXXXXXXXXX 67
           T GP+ LG T+G G  GKV+  ++         + G+Q AIK+I +              
Sbjct: 51  TFGPYYLGSTIGEGEFGKVKSGWSRKPQNDNGLTIGKQVAIKLIRRDTLAEKKDQELK-- 108

Query: 68  LLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGP 127
                     + REI  +KLL+HPN+++L DV +    + +VLEYA  GE +  L  +  
Sbjct: 109 ----------VYREINALKLLSHPNIVKLEDVLQNSKYIGIVLEYASGGEFYKYLQRKKR 158

Query: 128 LPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKL 186
           L E  A   F Q+I G++Y H+ G+VHRDLK ENLLLD   N+ I DFG    + T +KL
Sbjct: 159 LKEPLACSTFAQLISGVAYIHSKGLVHRDLKLENLLLDKHSNLVITDFGFVNEISTNNKL 218

Query: 187 LETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEE----DG-NIRN 240
           ++T CGSP YAAPE ++S  PY   + D+WS G+IL+A+L G LP+D++    DG NI  
Sbjct: 219 MKTPCGSPCYAAPELVLSTKPYDARKADIWSAGVILYAMLAGYLPWDDDPENPDGSNIMR 278

Query: 241 LLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
           L   +     + P  D I   A+DLI KIL + PK R+   ++ +H
Sbjct: 279 LYEYITKNNLKFP--DYIEPLARDLIRKILVIQPKSRLNIVQVQQH 322

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score =  202 bits (514), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 169/288 (58%), Gaps = 25/288 (8%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTP---- 71
           ++G W+  ET+G GS GKV+LA +  T +  A+K++++A             +L P    
Sbjct: 114 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRAT----KAFLHKEQMLPPPKNE 169

Query: 72  -DSLPY--GIEREII----------IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGEL 118
            D L     +E+EI           + ++L HP++ RL+++    ++ YM+ EY   G+L
Sbjct: 170 QDVLERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTLSNHFYMLFEYVSGGQL 229

Query: 119 FNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA 178
            + +++ G + E++A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++
Sbjct: 230 LDYIIQHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLS 289

Query: 179 ALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNI 238
            L    K L T CGS ++AAPE++   PY G E DVWS G++LF L+ G++PFD+E+ ++
Sbjct: 290 NLYDSRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV 349

Query: 239 RNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
             L  K++ G+ E P    +S E   L+SK+L VDPK+R   +++++H
Sbjct: 350 --LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score =  202 bits (513), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 163/289 (56%), Gaps = 22/289 (7%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKA--VFXXXXXXXXXXXLLTPDS 73
           ++G W   ET+G GS GKV+LA N  T +  AIK++++A  +F              P S
Sbjct: 67  SLGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIPLS 126

Query: 74  LPYGIER----------------EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGE 117
               IER                E  + ++L HP++ RLY++    ++ YM+ EY   G+
Sbjct: 127 EKEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGGQ 186

Query: 118 LFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGM 177
           L + +++ G L E+ A  F RQI   + Y H+  IVHRDLK EN+++    NIK+ DFG+
Sbjct: 187 LLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFGL 246

Query: 178 AALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGN 237
           + L  +   L+T CGS ++AAPE++   PY G E DVWS G++L+ L+ G++PFD+E+ N
Sbjct: 247 SNLYDKCNKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSN 306

Query: 238 IRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
           +  L  K++ G+   P    +S E   L+SK+L VDP KR    +++ H
Sbjct: 307 V--LHEKIKQGKVFYP--QFLSIEVISLLSKMLVVDPFKRATLDQVMNH 351

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score =  198 bits (504), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 113/293 (38%), Positives = 159/293 (54%), Gaps = 29/293 (9%)

Query: 18  GPWKLGETLGLGSTGKVQLAYNS--------STGQQAAIKVISKAVFXXXXXXXXXXXLL 69
           G + LG TLG G  GKV+L +++        S  +Q AIK+I +                
Sbjct: 44  GNYILGATLGEGEFGKVKLGWSTASPTASLDSNSKQIAIKLIRRDYVKKGSDKEIK---- 99

Query: 70  TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLP 129
                   I REI  +KLL HPN++RL +V +    + +VLE+A  GE +  L  +  L 
Sbjct: 100 --------IYREINALKLLTHPNIVRLEEVLQNSKYIGIVLEFASGGEFYKYLQRKRRLK 151

Query: 130 ENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLLE 188
           E  A + F Q+I G++Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++L++
Sbjct: 152 EPHACQLFAQLISGVTYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFFGSNELMK 211

Query: 189 TSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGN-----IRNLL 242
            SCGSP YAAPE ++S  PY   + D+WSCGIIL+A+L G LP+D++  N     I  L 
Sbjct: 212 RSCGSPCYAAPELVLSTEPYRARKVDIWSCGIILYAMLAGYLPWDDDSQNPNGDDIGKLY 271

Query: 243 LKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSI 295
             +     + P    IS  A+DLI KILT +P +RI    I KH  ++ + S 
Sbjct: 272 QYITKTALKFPA--YISPLARDLIRKILTANPSRRISISYICKHDWLKPHASF 322

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score =  202 bits (514), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 119/301 (39%), Positives = 167/301 (55%), Gaps = 45/301 (14%)

Query: 11  EVKGN------TVGPWKLGETLGLGSTGKVQLAY------NSSTGQQAAIKVISKAVFXX 58
           E KGN      T GP+ +G TLG G  GKV+L +      ++   +Q AIK+I +     
Sbjct: 57  ENKGNGRRKHITFGPYIVGSTLGEGEFGKVKLGWVKASPNDTQVPKQVAIKLIRR----- 111

Query: 59  XXXXXXXXXLLTPDSLPYGIEREIII------MKLLNHPNVLRLYDVWETDSNLYMVLEY 112
                        D++  G E+EI I      +K L HPN++RL +V +    + +VLEY
Sbjct: 112 -------------DAIVKGSEKEIKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEY 158

Query: 113 AEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKI 172
           A  GE +  + ++  L E+ A   F Q++ G+ Y H  G+VHRDLK ENLLLD   N+ I
Sbjct: 159 ASGGEFYKYIQKKRRLKESVASNLFSQLVSGVYYMHCKGLVHRDLKLENLLLDKYGNLII 218

Query: 173 ADFGMA-ALETEDKLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLP 230
            DFG         +L++TSCGSP YAAPE +IS  PY   + D+WSCGIILFA+L G LP
Sbjct: 219 TDFGFVNEFSKFSELMKTSCGSPCYAAPELVISTRPYEARKADIWSCGIILFAMLAGYLP 278

Query: 231 FDEE----DGN-IRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285
           +D++    DGN I  L   + +   + P  + IS  A+DL+  IL   P+KR   ++ILK
Sbjct: 279 WDDDPKNPDGNDIAKLYKYITTTPLKFP--EYISPMARDLLRNILIPYPQKRATLKQILK 336

Query: 286 H 286
           H
Sbjct: 337 H 337

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score =  200 bits (508), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 114/297 (38%), Positives = 164/297 (55%), Gaps = 31/297 (10%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAY-----NSSTG-----QQAAIKVISKAVFXXXXXXXXX 65
           T GP+ LG TLG G  GKV+L +     +SS       +Q A+K+I +            
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKSFPSSSNATLEFPKQVAVKLIKRDTISNDYKKEVK 96

Query: 66  XXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVER 125
                       I REI  +K L+HPN+++L +V +    + +VLEYA  GE +  + +R
Sbjct: 97  ------------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYRYIQKR 144

Query: 126 GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETED 184
             L E  A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      + +
Sbjct: 145 RRLKEINACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRN 204

Query: 185 KLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDE-----EDGNI 238
           +L++TSCGSP YAAPE +IS  PY   + D+WSCG+IL+A+L G LP+D+     E  +I
Sbjct: 205 ELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDI 264

Query: 239 RNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSI 295
             L   +     + P  D I    +DL+ +IL  DPK+RI  ++I KH  ++ + S 
Sbjct: 265 GRLYNYISLTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIKKHEWLKPHFSF 319

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score =  199 bits (505), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 114/292 (39%), Positives = 163/292 (55%), Gaps = 26/292 (8%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAY---NSST--GQQAAIKVISKAVFXXXXXXXXXXXLLT 70
           T GP+ +G TLG G  GKV+L +   N ST   +Q AIK+I +              +L 
Sbjct: 30  TFGPYIVGSTLGKGEFGKVKLGWSRKNESTDISKQVAIKLIRR------------DSILQ 77

Query: 71  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPE 130
                  I REI  +K L HPN++RL +V +    + +VLEYA  GE +  + ++  L E
Sbjct: 78  DREKEIKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKE 137

Query: 131 NEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLLET 189
             A + F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG        ++L++T
Sbjct: 138 PIACKLFAQLVSGVYYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFLQNNELMKT 197

Query: 190 SCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGN-----IRNLLL 243
           SCGSP YAAPE +++  PY   + DVWSCGIILFA+L G LP+D++  N     I  L  
Sbjct: 198 SCGSPCYAAPELVVTSNPYKARKADVWSCGIILFAMLAGYLPWDDDPDNPRGDDIAKLYN 257

Query: 244 KVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSI 295
            + +   + P    IS   +DL+ KIL  +P +R+  REI  H  ++ + S 
Sbjct: 258 YITTSPLKFPS--YISAIPRDLLRKILVANPNQRLSLREIETHQWLKPHSSF 307

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score =  196 bits (497), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 160/294 (54%), Gaps = 31/294 (10%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNS--STG--------QQAAIKVISKAVFXXXXXXXXX 65
           T GP+ +G TLG G  GKV+L +    STG        +Q AIK+I +            
Sbjct: 40  TFGPYIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIK 99

Query: 66  XXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVER 125
                       I REI  +K L HPNV+RL +V +    + +VLEYA  GE +  +  +
Sbjct: 100 ------------IYREINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRK 147

Query: 126 GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETED 184
             L E+ A R F Q+I G++Y H+  +VHRDLK ENLLLD   N+ I DFG       ++
Sbjct: 148 RRLKESTACRLFAQLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDN 207

Query: 185 KLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGN-----I 238
           + ++TSCGSP YAAPE +IS  PY   + DVWSCGIIL+A+L G LP+D++  N     I
Sbjct: 208 EYMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDI 267

Query: 239 RNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKY 292
             L   +     + P  + I+   +DL+ KIL  DP KR+  + I +H  ++ +
Sbjct: 268 GKLYQYITRTPLKFP--EYITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPH 319

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score =  195 bits (495), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 108/298 (36%), Positives = 165/298 (55%), Gaps = 39/298 (13%)

Query: 17  VGPWKLGETLGLGSTGKVQLAY---------NSSTGQ---------QAAIKVISKAVFXX 58
            G + LG+TLG G  GKV+L Y         NSS  +         Q AIK+I +     
Sbjct: 56  FGLYTLGQTLGEGEFGKVKLGYINNDNIDTLNSSGSKLGNYSHMPKQVAIKLIRRDTLSA 115

Query: 59  XXXXXXXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGEL 118
                              + REI  +K+L HPN+++L +V +    + +VLEYA  GE 
Sbjct: 116 SKESEIK------------LYREINALKMLTHPNIVKLEEVLQNSKYIGIVLEYASGGEF 163

Query: 119 FNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA 178
           +  +  +  L E++A   F Q+I G+SY H+ G+VHRDLK ENLLLD   N+ I DFG  
Sbjct: 164 YKYIKFKKRLKESKACTIFAQLISGVSYIHSKGLVHRDLKLENLLLDKAGNLLITDFGFV 223

Query: 179 ALETE-DKLLETSCGSPHYAAPEIISGL-PYHGLETDVWSCGIILFALLTGRLPFDEEDG 236
              T+ +KL+ T CGSP YAAPE+++ + PY+  + D+WSCG+IL+A+L G LP+D++  
Sbjct: 224 NEVTKTNKLMHTPCGSPCYAAPELVTSVEPYNARKADIWSCGVILYAMLAGYLPWDDDPK 283

Query: 237 NIRN-----LLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLV 289
           NI       L   +++   + P  + I+   +DL+ ++L +DP KR+  + IL+H  +
Sbjct: 284 NINGTDIVKLYKYIENQPLKFP--EYINMVPRDLLRRMLEIDPAKRMSMKHILQHAWI 339

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score =  200 bits (509), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 169/288 (58%), Gaps = 25/288 (8%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTP---- 71
           ++G W+  ET+G GS GKV+LA +  T +  A+K++++A             +L P    
Sbjct: 127 SLGDWEFVETVGAGSMGKVKLAKHHYTNEVCAVKIVNRAT----KAFLHKEQMLPPPKNE 182

Query: 72  -DSLPY--GIEREII----------IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGEL 118
            D L     +E+EI           + ++L HP++ RL+++    ++ YM+ EY   G+L
Sbjct: 183 QDVLERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQL 242

Query: 119 FNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA 178
            + +++ G + E++A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++
Sbjct: 243 LDYIIQHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLS 302

Query: 179 ALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNI 238
            L    K L T CGS ++AAPE++   PY G E DVWS G++LF L+ G++PFD+E+ ++
Sbjct: 303 NLYDSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV 362

Query: 239 RNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
             L  K++ G+ E P    +S E   L+SK+L VDPK+R   +++++H
Sbjct: 363 --LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 406

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score =  201 bits (510), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 164/289 (56%), Gaps = 17/289 (5%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAV-------------FXXXXXX 62
           ++G W   ET+G GS GKV+LA +  TG+  AIK++++A                     
Sbjct: 104 SLGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIM 163

Query: 63  XXXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLL 122
                L    S      RE  + ++  HP++ RL+++    ++ YM+ EY   G+L + +
Sbjct: 164 ERQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYI 223

Query: 123 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L E+ A +F R +   + Y HA  IVHRDLK EN+++ +   IKI DFG++ +  
Sbjct: 224 IQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNVYD 283

Query: 183 EDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLL 242
             K L T CGS ++AAPE++   PY G E DVWS G++L+ L+ G++PFD+E+ ++  L 
Sbjct: 284 TRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 341

Query: 243 LKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
            K++ G+ E P    +S E   L+SK+L VDP +R   +++++HP + K
Sbjct: 342 EKIKRGKVEYP--QHLSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTK 388

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score =  199 bits (505), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 169/288 (58%), Gaps = 25/288 (8%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTP---- 71
           ++G W+  ET+G GS GKV+LA +  T +  A+K++++A             +L P    
Sbjct: 114 SLGDWEFIETVGAGSMGKVKLARHRRTNEVCAVKIVNRAT----KAFLHKEQMLPPPKNE 169

Query: 72  -DSLPY--GIEREII----------IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGEL 118
            D L     +E+EI           + ++L HP++ RL+++    ++ YM+ EY   G+L
Sbjct: 170 QDVLERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQL 229

Query: 119 FNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA 178
            + +++ G + E++A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++
Sbjct: 230 LDYIIQHGSIREHQAKKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLS 289

Query: 179 ALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNI 238
            L    K L T CGS ++AAPE++   PY G E DVWS G++LF L+ G++PFD+E+ ++
Sbjct: 290 NLYDSRKQLYTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV 349

Query: 239 RNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
             L  K++ G+ E P    +S E   L+SK+L VDPK+R   +++++H
Sbjct: 350 --LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score =  199 bits (505), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 169/288 (58%), Gaps = 25/288 (8%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTP---- 71
           ++G W+  ET+G GS GKV+LA +  T +  A+K++++A             +L P    
Sbjct: 116 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRAT----KAFLHKEQMLPPPKNE 171

Query: 72  -DSLPY--GIEREII----------IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGEL 118
            D L     +E+EI           + ++L HP++ RL+++    ++ YM+ EY   G+L
Sbjct: 172 QDVLERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQL 231

Query: 119 FNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA 178
            + +++ G + E++A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++
Sbjct: 232 LDYIIQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLS 291

Query: 179 ALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNI 238
            +    K L T CGS ++AAPE++   PY G E DVWS G++LF L+ G++PFD+E+ ++
Sbjct: 292 NIYDSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV 351

Query: 239 RNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
             L  K++ G+ E P    +S E   L+SK+L VDPK+R   +++++H
Sbjct: 352 --LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 395

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score =  199 bits (506), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 112/331 (33%), Positives = 182/331 (54%), Gaps = 39/331 (11%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           ++G W   ET+G GS GKV+LA +  T +  AIK++++A             L    S+P
Sbjct: 160 SLGDWDFLETVGAGSMGKVKLAKHHQTQEICAIKIVNRAT---------KAFLHKEQSMP 210

Query: 76  ------------YGIEREII----------IMKLLNHPNVLRLYDVWETDSNLYMVLEYA 113
                         +E+EI           + ++L HP++ RL+++    ++ YM+ EY 
Sbjct: 211 PPKNEQEIAERQKRLEKEISRDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYV 270

Query: 114 EKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIA 173
             G+L + +++ G L E+ A +F R I   + Y H   IVHRDLK EN+++ +   IKI 
Sbjct: 271 SGGQLLDYIIQHGSLREHHARKFARGIASALQYLHLNNIVHRDLKIENIMISNSGEIKII 330

Query: 174 DFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDE 233
           DFG++ +    K L T CGS ++AAPE++   PY G E DVWS GI+L+ L+ G++PFD+
Sbjct: 331 DFGLSNVFDNRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGIVLYVLVCGKVPFDD 390

Query: 234 EDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYP 293
           E+ ++  L  K++ G+ E P  + +S E   L+SK++ VDP KR   R++++HP + +  
Sbjct: 391 ENSSV--LHEKIRQGKVEYP--NHLSIEVISLLSKMIVVDPAKRASLRQVVEHPWMTRG- 445

Query: 294 SIKDSKTIRNLPREDTYLNPLSDDNGDVCEI 324
              D   +  LPR    L P + DN  + E+
Sbjct: 446 --YDFPPLSYLPRR-IPLTPEAIDNNVLREM 473

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score =  198 bits (504), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 101/292 (34%), Positives = 163/292 (55%), Gaps = 23/292 (7%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           ++G W   ET+G GS GKV+LA +  T +  AIK++++A             +  P S  
Sbjct: 75  SLGDWDFLETVGAGSMGKVKLARHRYTSEICAIKIVNRAA---KSFVHKQQQMTPPKSEQ 131

Query: 76  YGIE----------------REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119
             +E                RE  + ++L HP++ RL+++    ++ YM+ EY   G+L 
Sbjct: 132 EALERKRKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 191

Query: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++     IKI DFG++ 
Sbjct: 192 DYIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISTSGEIKIIDFGLSN 251

Query: 180 LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIR 239
           +    K L T CGS ++AAPE++   PY G E DVWS G++L+ L+ G++PFD+E+ ++ 
Sbjct: 252 MYDPKKQLHTFCGSLYFAAPELLKAHPYIGPEVDVWSFGVVLYVLVCGKVPFDDENASV- 310

Query: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
            L  K++ G+ E P    +S E   L+SK+L VDP KR   ++++ H  +Q+
Sbjct: 311 -LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVSHQWMQR 359

>NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654
          Length = 727

 Score =  194 bits (494), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 159/283 (56%), Gaps = 24/283 (8%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
            GP+ +G TLG G  GKV++ +++++     I   SK V            L+  D +  
Sbjct: 35  FGPYIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQV---------AIKLIRRDFIKK 85

Query: 77  GIEREIII------MKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPE 130
           G E+E+ I      +K L HPN++RL +V +    + +VLEYA  GE +  +  +  L E
Sbjct: 86  GSEKEMKIFREINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKE 145

Query: 131 NEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKLLET 189
             A R F Q+I G+SY H+ GIVHRDLK ENLLLD   N+ I DFG       +++L++T
Sbjct: 146 ATACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELMKT 205

Query: 190 SCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGN-----IRNLLL 243
           SCGSP YAAPE +I+  PY   + D+WSCGIIL+ +L G LP+D++  N     I  L  
Sbjct: 206 SCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRLYH 265

Query: 244 KVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
            +     + P  + I+   +DL+  IL  +P +R+ +R I KH
Sbjct: 266 YITKTPLKFP--EYITPLPRDLLRHILVSNPVRRMSSRHIKKH 306

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score =  198 bits (504), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 164/287 (57%), Gaps = 23/287 (8%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           ++G W   ET+G GS GKV+LA +  T +  AIKV+++A             L  P +  
Sbjct: 179 SLGDWDFLETVGAGSMGKVKLAKHHYTNEICAIKVVNRAT---KGFLHKEQTLPPPQTEQ 235

Query: 76  YGIE----------------REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119
             +E                RE  + ++L HP++ RL+++    ++ YM+ EY   G+L 
Sbjct: 236 EILERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 295

Query: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G L E+ A +F R I   + Y H+  IVHRDLK EN+++     IKI DFG++ 
Sbjct: 296 DYIIQHGSLREHHARKFARGIASALQYLHSNNIVHRDLKIENIMISTSGEIKIIDFGLSN 355

Query: 180 LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIR 239
           L    + L T CGS ++AAPE++   PY G E DVWS G++L+ L+ G++PFD+E+ ++ 
Sbjct: 356 LYDTTRQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV- 414

Query: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
            L  K++ G+ + P    +S E   L+SK+L VDPKKR   R++++H
Sbjct: 415 -LHEKIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRATLRQVVEH 458

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score =  198 bits (503), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 170/297 (57%), Gaps = 26/297 (8%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           ++G W   ET+G GS GKV+LA +  T +  AIK++++A+            +  P +  
Sbjct: 158 SLGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAM---KAFLHKEQSMPPPRTEQ 214

Query: 76  YGIER----------------EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119
             +ER                E  + ++L HP++ RL+++    ++ YM+ EY   G+L 
Sbjct: 215 EVLERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 274

Query: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ 
Sbjct: 275 DYIIQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLSN 334

Query: 180 LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIR 239
           +    K L T CGS ++AAPE++   PY G E DVWS G++L+ L+ G++PFD+E+ ++ 
Sbjct: 335 VFDRKKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV- 393

Query: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK---YP 293
            L  K++ G+ + P  + +S E   L+SK+L VDP +R   +++++HP + +   YP
Sbjct: 394 -LHEKIKQGKVDYP--NHLSIEVISLLSKMLVVDPLRRASLKQVVEHPWMTRGYDYP 447

>Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233W
           (REAL)
          Length = 806

 Score =  194 bits (492), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 105/290 (36%), Positives = 158/290 (54%), Gaps = 26/290 (8%)

Query: 13  KGNTVGPWKLGETLGLGSTGKVQLAYNSSTG-----QQAAIKVISKAVFXXXXXXXXXXX 67
           K  T GP+ +G TLG G  GKV+L +  ++      +Q AIK+I +              
Sbjct: 39  KHATFGPYIIGSTLGEGEFGKVKLGWTKASSPTEVPKQVAIKLIRRDTIKKDADKEVK-- 96

Query: 68  LLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGP 127
                     I REI  +K L HPN++ L +V +    + +VLE+   GE +  +  +  
Sbjct: 97  ----------IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRR 146

Query: 128 LPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDKL 186
           L E+ A R F Q+I G++Y H  G+VHRDLK ENLLLD   N+ I DFG       +++L
Sbjct: 147 LKESSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFKDNEL 206

Query: 187 LETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGN-----IRN 240
           + TSCGSP YAAPE ++S  PY   + DVWSCG+IL+A+L G LP+D++  N     I  
Sbjct: 207 MNTSCGSPCYAAPELVVSTKPYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIAR 266

Query: 241 LLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
           L   +     + P  + I+   +DL+ +IL  +P++R+  R I +H  ++
Sbjct: 267 LYQYITQTPLKFP--EYITPVPRDLLRRILVPNPRRRVSLRSIERHEWLK 314

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score =  196 bits (498), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 165/293 (56%), Gaps = 35/293 (11%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           ++G W   ET+G GS GKV+LA +  T +  AIK++++A             L    SLP
Sbjct: 141 SLGDWNFLETVGAGSMGKVKLAKHHRTNEICAIKIVNRAT---------KAFLHKEQSLP 191

Query: 76  Y------------GIEREII----------IMKLLNHPNVLRLYDVWETDSNLYMVLEYA 113
                         +E+EI           + ++L HP++ RL+++    ++ YM+ EY 
Sbjct: 192 APANDQEIMERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYV 251

Query: 114 EKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIA 173
             G+L + +++ G L E+ A RF R I   + Y HA  IVHRDLK EN+++     IK+ 
Sbjct: 252 SGGQLLDYIIQHGSLREHHARRFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKLI 311

Query: 174 DFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDE 233
           DFG++ L    K L T CGS ++AAPE++   PY G E DVWS G++L+ L+ G++PFD+
Sbjct: 312 DFGLSNLYDNRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLYVLVCGKVPFDD 371

Query: 234 EDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
           E+ ++  L  K++ G+ E   +  +S E   L+SK+L VDPK+R   ++++ H
Sbjct: 372 ENSSV--LHEKIKQGKVEY--SQHLSIEVISLLSKMLVVDPKRRASLKQVVDH 420

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score =  196 bits (498), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 105/307 (34%), Positives = 171/307 (55%), Gaps = 24/307 (7%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
            +G W   ET+G GS GKV+LA +  T +  AIK++++A             L  P S  
Sbjct: 105 ALGDWDFLETVGAGSMGKVKLAKHHHTNEICAIKIVNRAT---KAFLHKEQNLPPPKSEQ 161

Query: 76  YGIER----------------EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119
             ++R                E  + ++L HP++ RL+++    ++ YM+ EY   G+L 
Sbjct: 162 EILQRQKRLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 221

Query: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ 
Sbjct: 222 DYIIQHGSLREHHARKFARGIGSALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSN 281

Query: 180 LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIR 239
           +    K L T CGS ++AAPE++   PY G E DVWS G++L+ L+ G++PFD+E  ++ 
Sbjct: 282 VYDPRKQLHTFCGSLYFAAPELLKARPYLGPEVDVWSFGVVLYVLVCGKVPFDDEVSSV- 340

Query: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK-YPSIKDS 298
            L  K++ G  E P  + +S E   L+SK+L VDP++R   +++++HP + + Y  I  S
Sbjct: 341 -LHEKIKQGNVEYP--NHLSIEVLSLLSKMLVVDPERRASLKQVIEHPWMNRGYDYITPS 397

Query: 299 KTIRNLP 305
              + +P
Sbjct: 398 YLPKRIP 404

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score =  194 bits (493), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 156/283 (55%), Gaps = 28/283 (9%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           T GP+ +G TLG G  GKV+L +++S  ++ +  V  K              L+  D++P
Sbjct: 61  TFGPYIVGPTLGEGEFGKVKLGWSNSKPEEGSKNVAIK--------------LVRRDTIP 106

Query: 76  ------YGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLP 129
                   I REI  +K LNHPN++RL +V +    + +VL+YA  GE +  + ++  L 
Sbjct: 107 KHSEKEVKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLK 166

Query: 130 ENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLET 189
           E  A R F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ I DFG      ++ L++T
Sbjct: 167 EPPACRLFAQLISGVYYMHHKGLAHRDLKLENLLLDEHENLMITDFGFVNEFHKNDLMKT 226

Query: 190 SCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDE-----EDGNIRNLLL 243
           SCGSP YAAPE +++  PY   + DVWSCG+IL+A+L G LP+D+     E  +I  L  
Sbjct: 227 SCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLYH 286

Query: 244 KVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
            +     + P  + I    +DL+ +IL  +P  R+   EI  H
Sbjct: 287 YITKSALKFP--EYIKPLPRDLLRRILVSNPDTRLSVMEIKNH 327

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score =  195 bits (495), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 168/294 (57%), Gaps = 24/294 (8%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           ++G W   ET+G GS GKV+LA +  T +  AIK++++A             L  P +  
Sbjct: 97  SLGDWDFLETVGAGSMGKVKLARHHQTNEICAIKIVNRAT---KAYLHKEQSLAPPKNEN 153

Query: 76  YGIE----------------REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119
             +E                RE  + ++L HP++ RL+++    ++ YM+ EY   G+L 
Sbjct: 154 EMLERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 213

Query: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G L E+ A +F R +   + Y HA  IVHRDLK EN+++     IKI DFG++ 
Sbjct: 214 DYIIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSN 273

Query: 180 LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIR 239
           +    K L T CGS ++AAPE++   PY G E D+WS G++L+ L+ G++PFD+E+ ++ 
Sbjct: 274 VFDTRKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVLYVLVCGKVPFDDENSSV- 332

Query: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHP-LVQKY 292
            L  K++ G+ E P  + +S E   L+SK+L VDP KR    ++++HP +++ Y
Sbjct: 333 -LHEKIKQGKVEYP--NHLSIEVISLLSKMLVVDPLKRANLTKVIEHPWMIRGY 383

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score =  194 bits (494), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 103/293 (35%), Positives = 166/293 (56%), Gaps = 35/293 (11%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           ++G W   ET+G GS GKV+LA +  T +  AIK++++A             L    SLP
Sbjct: 74  SLGEWDFLETVGAGSMGKVKLAKHRYTKEVCAIKIVNRAT---------NAFLHKEQSLP 124

Query: 76  ------------YGIEREII----------IMKLLNHPNVLRLYDVWETDSNLYMVLEYA 113
                         +E+EI           + ++L HP++ RL+++    ++ YM+ EY 
Sbjct: 125 PPKKEEEILERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYV 184

Query: 114 EKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIA 173
             G+L + +++ G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IKI 
Sbjct: 185 SGGQLLDYIIQHGSLREHHARKFTRGIASALQYLHANNIVHRDLKIENIMISTSGEIKII 244

Query: 174 DFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDE 233
           DFG++ L  + K L T CGS ++AAPE++   PY G E DVWS G++L+ L+ G++PFD+
Sbjct: 245 DFGLSNLFDKSKQLHTFCGSLYFAAPELLKASPYTGPEVDVWSFGVVLYVLVCGKVPFDD 304

Query: 234 EDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
           E+ ++  L  K++ G+ E P    +S E   L+SK+L VDP +R   +++++H
Sbjct: 305 ENSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPHRRASLKQVVEH 353

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score =  194 bits (494), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 163/292 (55%), Gaps = 21/292 (7%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           ++G W   ET+G GS GKV+LA +  T +  AIK++++A             L  P +  
Sbjct: 111 SLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRAT-KSFIHKQQQQQLPPPSNEE 169

Query: 76  YGIER----------------EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119
             +ER                E  + ++L HP++ RL+++    ++ YM+ EY   G+L 
Sbjct: 170 ELMERRKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 229

Query: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++     I+I DFG++ 
Sbjct: 230 DYIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISSSGEIRIIDFGLSN 289

Query: 180 LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIR 239
           L    K L T CGS ++AAPE++   PY G E D+WS G++L+ L+ G++PFD+E+ ++ 
Sbjct: 290 LYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV- 348

Query: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
            L  K++ G+ E P    +S +   L+SK+L VDP KR   ++++ H  +QK
Sbjct: 349 -LHEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPLKRATLKQVVNHQWMQK 397

>TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.654
           YPL141C
          Length = 981

 Score =  193 bits (490), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 113/290 (38%), Positives = 158/290 (54%), Gaps = 39/290 (13%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQ-------QAAIKVISKAVFXXXXXXXXXXXLL 69
            GP+ L  TLG G  GKV+L ++ ++ Q       Q AIK+I ++               
Sbjct: 81  FGPYILSSTLGEGEFGKVKLGWSKASTQASNEIPKQVAIKLIKRSSI------------- 127

Query: 70  TPDSLPYG------IEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLV 123
               LP G      + REI  +K L HPN+++L DV +    + +VLEYA  GE +  + 
Sbjct: 128 ----LPKGSNKEIKVYREINALKQLCHPNIVKLDDVLQNSKYIGIVLEYASGGEFYKYIQ 183

Query: 124 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALET 182
            +  L E  A + F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       
Sbjct: 184 RKKRLKEINASKLFSQLISGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFFQ 243

Query: 183 EDKLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEE----DGN 237
            ++L+ T CGSP YAAPE +IS  PY   + D+WSCGIIL+A+L G LP+D++    DGN
Sbjct: 244 TNELMLTPCGSPCYAAPELVISKHPYEARKADLWSCGIILYAMLAGYLPWDDDIKNPDGN 303

Query: 238 -IRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
            I  L   + +   + P  + I    +DL+ KIL  + KKRI  R I+ H
Sbjct: 304 DIARLYYYITTTPLKFP--EYIQPLPRDLLRKILVPNYKKRINMRRIINH 351

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score =  194 bits (492), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 110/344 (31%), Positives = 184/344 (53%), Gaps = 35/344 (10%)

Query: 8   PSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXX 67
           P+ +    ++G W   ET+G GS GKV+LA +  T +  AIK++++A             
Sbjct: 172 PAKQFHRKSLGDWDFLETVGAGSMGKVKLAKHRLTHEVCAIKIVNRATKALIHKESQQPP 231

Query: 68  LLTPDSL---PYGIEREI----------IIMKLLNHPNVLRLYDVWETDSNLYMVLEYAE 114
             T + +      +E+EI           + ++L HP++ RL+++    ++ YM+ EY  
Sbjct: 232 PRTQEEVLERERKLEKEISRDKRTIRESSLGQILYHPHICRLFEMCTMSNHFYMLFEYVS 291

Query: 115 KGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIAD 174
            G+L + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++     IKI D
Sbjct: 292 GGQLLDYIIQHGSLRERSARKFARGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIID 351

Query: 175 FGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEE 234
           FG++ +    K L T CGS ++AAPE++   PY G E DVWS G++L+ L+ G++PFD+E
Sbjct: 352 FGLSNMFNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLYVLVCGKVPFDDE 411

Query: 235 DGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK--- 291
           + ++  L  K++ G+ E P    +S E   L+SK+L VDP KR   ++++ H  +Q+   
Sbjct: 412 NSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVNHQWMQRGYD 467

Query: 292 YPSIKDSKTIRNLPREDTYLNPLSDDNGDVCEIDPKILQNLVVL 335
           +P+          P    +  PL+ D      +DP ++Q +  L
Sbjct: 468 FPA----------PSYIPHRVPLTAD-----ALDPTVIQEMYRL 496

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score =  194 bits (492), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 103/304 (33%), Positives = 167/304 (54%), Gaps = 26/304 (8%)

Query: 4   LTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXX 63
           ++NKP       ++G W   ET+G GS GKV+LA +  T +  AIK++++A         
Sbjct: 85  VSNKP---FHRKSLGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAA---KSYMH 138

Query: 64  XXXXLLTPDSLPYGIE----------------REIIIMKLLNHPNVLRLYDVWETDSNLY 107
               L  P +    +E                RE  + ++L HP++ RL+++    ++ Y
Sbjct: 139 KQNQLPPPKTEEELMERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFY 198

Query: 108 MVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHK 167
           M+ EY   G+L + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++   
Sbjct: 199 MLFEYVSGGQLLDYIIQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTS 258

Query: 168 YNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTG 227
             IKI DFG++ L    K L T CGS ++AAPE++   PY G E D+WS G++++ L+ G
Sbjct: 259 GEIKIIDFGLSNLYDNKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCG 318

Query: 228 RLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHP 287
           ++PFD+E+ ++  L  K++ G+ E P    +S E   L+SK+L VDP KR   +++  H 
Sbjct: 319 KVPFDDENASV--LHEKIKKGKVEYP--QHLSIECISLLSKMLVVDPLKRASLKQVCNHQ 374

Query: 288 LVQK 291
            +Q+
Sbjct: 375 WMQR 378

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score =  193 bits (490), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 99/292 (33%), Positives = 163/292 (55%), Gaps = 21/292 (7%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           ++G W   ET+G GS GKV+LA +  T +  AIK++++A             L  P +  
Sbjct: 50  SLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRAT-KSFMHKQQLQGLPPPATEE 108

Query: 76  YGIER----------------EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119
             +ER                E  + ++L HP++ RL+++    ++ YM+ EY   G+L 
Sbjct: 109 ELLERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 168

Query: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++     I+I DFG++ 
Sbjct: 169 DYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRIIDFGLSN 228

Query: 180 LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIR 239
           +    K L T CGS ++AAPE++   PY G E D+WS G++L+ L+ G++PFD+E+ ++ 
Sbjct: 229 MYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV- 287

Query: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
            L  K++ G+ E P    +S +   L+SK+L VDP KR   ++++ H  +QK
Sbjct: 288 -LHEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPYKRATLKQVVHHQWMQK 336

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score =  190 bits (483), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 115/333 (34%), Positives = 170/333 (51%), Gaps = 42/333 (12%)

Query: 13  KGNTVGPWKLGETLGLGSTGKVQLAYNSSTG-----QQAAIKVISKAVFXXXXXXXXXXX 67
           K  T GP+ +G TLG G  GKV+L +  +       +Q AIK+I +              
Sbjct: 39  KHATFGPYIVGSTLGEGEFGKVKLGWTKAFSPNEVPKQVAIKLIRRDSIKKDADKEVK-- 96

Query: 68  LLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGP 127
                     I REI  +K L HPN++ L +V +    + +VLE+   GE +  +  +  
Sbjct: 97  ----------IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRR 146

Query: 128 LPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETED-KL 186
           L E+ A R F Q+I G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG      ED +L
Sbjct: 147 LKESSACRLFAQLISGVDYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNEL 206

Query: 187 LETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGN-----IRN 240
           + TSCGSP YAAPE ++S   Y   + DVWSCG+IL+A+L G LP+D++  N     I  
Sbjct: 207 MRTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIAR 266

Query: 241 LLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKY-------P 293
           L   +     + P  + I+   +DL+ +IL  +P++R+  R I +H  ++ +       P
Sbjct: 267 LYQYITQTPLKFP--EYITPVPRDLLRRILVPNPRRRVSVRAIQRHEWLKPHHAFLSIQP 324

Query: 294 SIKDSKTIRNLP---------REDTYLNPLSDD 317
           +  D +  +  P         R  TY +P S D
Sbjct: 325 NYWDEQLRKERPQLSTRGDVGRHTTYSSPTSPD 357

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score =  192 bits (489), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 166/292 (56%), Gaps = 23/292 (7%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           ++G W+  ET+G GS GKV+L  +  T +   IK++++A             L +P +  
Sbjct: 102 SLGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRA---SKAYLHKQHTLPSPKNEN 158

Query: 76  YGIER----------------EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119
             +ER                E  + ++L HP++ RL+++    ++ YM+ EY   G+L 
Sbjct: 159 EILERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 218

Query: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ 
Sbjct: 219 DYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSN 278

Query: 180 LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIR 239
           +    K L T CGS ++AAPE++   PY G E D+WS GI+L+ L+ G++PFD+E+ +I 
Sbjct: 279 IFDYRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI- 337

Query: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
            L  K++ G+ + P +  +S EA  L+++++ +DP KR   + ++ HP + +
Sbjct: 338 -LHEKIKKGKVDYPSH--LSIEAISLLTRMIVIDPLKRATLKNVVDHPWMNR 386

>Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W
           (REAL)
          Length = 808

 Score =  190 bits (482), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 105/292 (35%), Positives = 159/292 (54%), Gaps = 26/292 (8%)

Query: 13  KGNTVGPWKLGETLGLGSTGKVQLAYNSSTG-----QQAAIKVISKAVFXXXXXXXXXXX 67
           K  T GP+ +G TLG G  GKV+L ++ ++      +Q AIK+I +              
Sbjct: 39  KHATFGPYIVGSTLGEGEFGKVKLGWSKASSPNEVPKQVAIKLIRRDTIKKDADKEVK-- 96

Query: 68  LLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGP 127
                     I REI  +K L HPN++ L +V +    + +VLE+   GE +  +  +  
Sbjct: 97  ----------IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRR 146

Query: 128 LPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETED-KL 186
           L E+ A R F Q+I G++Y H  G+VHRDLK ENLL+D   N+ I DFG      ED +L
Sbjct: 147 LKESSACRLFAQLISGVNYMHTKGLVHRDLKLENLLMDKHENLVITDFGFVNEFFEDNEL 206

Query: 187 LETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGN-----IRN 240
           + TSCGSP YAAPE ++S   Y   + DVWSCG+IL+A+L G LP+D++  N     I  
Sbjct: 207 MRTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIAR 266

Query: 241 LLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKY 292
           L   +     + P  + I+   +DL+ +IL  +P++R+  R I +H  ++ +
Sbjct: 267 LYQYITQTPLKFP--EYITPIPRDLLRRILVPNPRRRVSLRAIQRHEWLKPH 316

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score =  192 bits (488), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 161/287 (56%), Gaps = 23/287 (8%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
            +G W   ET+G GS GKV++A +  T +  AIK+I++A             L  P +  
Sbjct: 136 ALGDWDFLETVGAGSMGKVKIAKHHYTNEICAIKIINRAT---KAFLHKEQQLPPPQNEQ 192

Query: 76  YGIE----------------REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119
             +E                RE  + + L HP++ RL+++    ++ YM+ EY   G+L 
Sbjct: 193 EALERQKKLEKEISRDKRTIREASLGQALYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 252

Query: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ 
Sbjct: 253 DYIIQHGSLREHHARKFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSN 312

Query: 180 LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIR 239
           +      L T CGS ++AAPE++   PY G E DVWS G++L+ L+ G++PFD+E+ ++ 
Sbjct: 313 MFDPRTQLHTFCGSLYFAAPELLKASPYVGPEVDVWSFGVVLYVLVCGKVPFDDENSSV- 371

Query: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
            L  K++ G+ + P    +S E   L+SK+L VDP+KR   +++++H
Sbjct: 372 -LHEKIKQGKVDYP--QHLSIEVISLLSKMLVVDPRKRASLKQVVEH 415

>Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR096W
           (REAL)
          Length = 1159

 Score =  192 bits (488), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 99/298 (33%), Positives = 167/298 (56%), Gaps = 35/298 (11%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           ++G W+  ET+G GS GKV+L  +  T +   IK++++A             L    SLP
Sbjct: 103 SLGDWEFLETVGAGSMGKVKLVKHCQTKEVCVIKIVNRA---------SKAFLHKQHSLP 153

Query: 76  ------------YGIEREII----------IMKLLNHPNVLRLYDVWETDSNLYMVLEYA 113
                         +E+EI           + ++L HP++ RL+++    ++ YM+ EY 
Sbjct: 154 PPKNENELLERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYV 213

Query: 114 EKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIA 173
             G+L + +++ G L E+ A +F R I   + Y HA  IVHRDLK EN+++ +   IKI 
Sbjct: 214 SGGQLLDYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISNSGEIKII 273

Query: 174 DFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDE 233
           DFG++ +    K L T CGS ++AAPE++   PY G E D+WS GI+L+ L+ G++PFD+
Sbjct: 274 DFGLSNIFDSKKKLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDD 333

Query: 234 EDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
           E+ +I  L  K++ G+ + P +  +S +A  L+++++ VDP KR   + +  HP + +
Sbjct: 334 ENSSI--LHEKIKKGKVDYPSH--LSIDAVSLLTRMIVVDPLKRATLKNVTDHPWMNR 387

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score =  187 bits (474), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 104/289 (35%), Positives = 154/289 (53%), Gaps = 32/289 (11%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAY-----------NSSTGQQAAIKVISKAVFXXXXXXXX 64
           T GP+ +G TLG G  GKV++ +           +  T +Q AIK+I +           
Sbjct: 46  TFGPYIVGSTLGEGEFGKVKMGWTRPVTDGNVGPSQRTPRQVAIKLIRRDTIVRNSDKET 105

Query: 65  XXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVE 124
                        I REI  +K L HPN++ L ++ +    + +VLEYA  GE +  +  
Sbjct: 106 K------------IYREINALKHLTHPNIIVLEEILQNSKYIGIVLEYASGGEFYKYIQR 153

Query: 125 RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETE 183
           +  L E  A R F Q++ G+ Y H+ G+VHRDLK ENLLLD   N+ I DFG       E
Sbjct: 154 KRRLKEVNASRLFSQLVSGVHYMHSKGLVHRDLKLENLLLDKNENLMITDFGFVNEFSNE 213

Query: 184 DKLLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGN----- 237
           + L++TSCGSP YAAPE ++S   Y G++ D+WSCG+IL+A+L G LP+D++  N     
Sbjct: 214 NVLMKTSCGSPCYAAPELVVSREAYVGVKVDIWSCGVILYAMLAGYLPWDDDPSNPNGDD 273

Query: 238 IRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
           I  L   + +   + P  D ++   +DL+ +IL  DP++R     I  H
Sbjct: 274 ISKLYSYITATPLKFP--DYVNPLPRDLLRRILVADPRRRYTLGHIENH 320

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score =  192 bits (487), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/304 (32%), Positives = 169/304 (55%), Gaps = 23/304 (7%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           ++G W+  ET+G GS GKV+L  +  T +   IK++++A             L +P +  
Sbjct: 103 SLGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRA---SKAYLHKQHSLPSPKNEN 159

Query: 76  YGIER----------------EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119
             +ER                E  + ++L HP++ RL+++    ++ YM+ EY   G+L 
Sbjct: 160 EVLERQKRLEKEIARDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 219

Query: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G L E+ A +F R I   + Y H+  IVHRDLK EN+++     IKI DFG++ 
Sbjct: 220 DYIIQHGSLKEHHARKFARGIASALQYLHSNNIVHRDLKIENIMISSSGEIKIIDFGLSN 279

Query: 180 LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIR 239
           +    K L T CGS ++AAPE++   PY G E D+WS GI+L+ L+ G++PFD+E+ +I 
Sbjct: 280 IFDYRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI- 338

Query: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSK 299
            L  K++ G+ + P +  +S EA  L++K++ VDP +R   + ++ HP + +    K   
Sbjct: 339 -LHEKIKKGKVDYPSH--LSIEAISLLTKMIVVDPLRRATLKTVVDHPWMNRGYDFKAPS 395

Query: 300 TIRN 303
            I N
Sbjct: 396 YILN 399

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score =  190 bits (482), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 105/281 (37%), Positives = 148/281 (52%), Gaps = 27/281 (9%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +K+ + +G GS GKV LA +  T Q+  +K                    T D    
Sbjct: 39  VGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLK--------------------TGDKSDP 78

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            + RE+   +  ++P + +LY+V  T++ ++M LEY    EL++ L+ +  LP  E    
Sbjct: 79  NVVREVFYHRQFDYPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAEL 138

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI   + Y H L  VHRDLK EN+LLD   N K+ DFG         +LET CG+  Y
Sbjct: 139 FAQITGAVHYAHTLNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMTKAVLETVCGTTVY 198

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
            APE+I   PY G + D+WS G+IL+ LL G LPFDE+D      LL  Q    + P  D
Sbjct: 199 MAPEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDD-----LLTKQKIINDTPVID 253

Query: 257 E--ISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSI 295
           E     EAQ+LI ++L+ DP +R  T  IL HP +Q Y ++
Sbjct: 254 ERITIPEAQNLIEQLLSKDPTERPNTSAILLHPFLQPYGTL 294

>ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL141C and YOR233W
           (KIN4)
          Length = 931

 Score =  190 bits (482), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 107/293 (36%), Positives = 161/293 (54%), Gaps = 36/293 (12%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSST----GQQAAIKVISKAVFXXXXXXXXXXXLLTP 71
           T GP+ +G TLG G  GKV+L ++ +      +  AIK+I +                  
Sbjct: 41  TFGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRR------------------ 82

Query: 72  DSLPYGIEREIII------MKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVER 125
           D++P   E+EI I      +KLL+HPN++RL +V +    + +VL+YA  GE +  + ++
Sbjct: 83  DTVPKNSEKEIKIYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKK 142

Query: 126 GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDK 185
             L E  A R F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ I DFG      ++ 
Sbjct: 143 RRLKEPPACRLFAQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHKND 202

Query: 186 LLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGN-----IR 239
           L+ TSCGSP YAAPE ++S  PY   + DVWSCG+IL+A+L G LP+D++  N     I 
Sbjct: 203 LMRTSCGSPCYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIA 262

Query: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKY 292
            L   +     + P  + I    +DL+ +IL  +P+ R+   +I +H  +Q +
Sbjct: 263 KLYQYITHTSLKFP--EYIKPIPRDLLKRILVSNPEVRLTVADIEQHAWLQPH 313

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score =  189 bits (479), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 156/286 (54%), Gaps = 26/286 (9%)

Query: 13  KGNTVGPWKLGETLGLGSTGKVQLAYNSSTG-----QQAAIKVISKAVFXXXXXXXXXXX 67
           K  T GP+ +G TLG G  GKV+L +  ++      +Q AIK+I +              
Sbjct: 39  KHATFGPYIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKKDADKEIK-- 96

Query: 68  LLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGP 127
                     I REI  +K L HPN++ L +V +    + +VLE+   GE +  +  +  
Sbjct: 97  ----------IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRR 146

Query: 128 LPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETED-KL 186
           L E+ A R F Q+I G++Y H  G+VHRDLK ENLLLD   N+ I DFG      ED +L
Sbjct: 147 LKESSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNEL 206

Query: 187 LETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGN-----IRN 240
           ++TSCGSP YAAPE ++S   Y   + DVWSCG+IL+A+L G LP+D++  N     I  
Sbjct: 207 MKTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIAR 266

Query: 241 LLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKH 286
           L   +     + P  + I+   +DL+ +IL  +P++RI  + I +H
Sbjct: 267 LYKYITQTPLKFP--EYITPIPRDLLRRILVPNPRRRINLQTIKRH 310

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score =  191 bits (484), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 96/292 (32%), Positives = 166/292 (56%), Gaps = 23/292 (7%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           ++G W+  ET+G GS GKV+L  +  T +   IK++++A             L +P +  
Sbjct: 95  SLGDWEFLETVGAGSMGKVKLVKHRQTKEICVIKIVNRA---SKAYLHKQHSLPSPKNES 151

Query: 76  YGIER----------------EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119
             +ER                E  + ++L HP++ RL+++    ++ YM+ EY   G+L 
Sbjct: 152 EILERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 211

Query: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G L E+ A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ 
Sbjct: 212 DYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSN 271

Query: 180 LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIR 239
           +    K L T CGS ++AAPE++   PY G E D+WS GI+L+ L+ G++PFD+E+ +I 
Sbjct: 272 IFDYRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI- 330

Query: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
            L  K++ G+ + P +  +S E   L+++++ VDP +R   + +++HP + +
Sbjct: 331 -LHEKIKKGKVDYPSH--LSIEVISLLTRMIVVDPLRRATLKNVVEHPWMNR 379

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score =  187 bits (474), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 157/288 (54%), Gaps = 23/288 (7%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           W   ET+G GS GKV+LA N ++ +  AIK++ +A             L  P       E
Sbjct: 67  WDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRAT---KAYMHKAQQLPPPADENEAKE 123

Query: 80  R----------------EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLV 123
           R                E  + ++L HPNV +LY++    ++ YM  E+   G+L + ++
Sbjct: 124 RQKRLNKEISRDKRTVREASLGQILFHPNVCKLYEMQTLSNHYYMFFEFISGGQLLDYII 183

Query: 124 ERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 183
           + G L EN A +  R I+  + Y HA  IVHRDLK EN++L     IK+ DFG++ +   
Sbjct: 184 QHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLSNMYDP 243

Query: 184 DKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLL 243
            K L+T CGS ++AAPE++   PY G E DVWS G++L+ L+ G++PFD+E  N   L  
Sbjct: 244 RKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDE--NSSALHE 301

Query: 244 KVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
           K++ G+   P    +S +   L+SKIL VDP+KR   ++++ H  + K
Sbjct: 302 KIKKGKVTYP--QFLSIDVISLLSKILVVDPQKRATLQQVVNHQWMLK 347

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score =  184 bits (467), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 104/297 (35%), Positives = 162/297 (54%), Gaps = 24/297 (8%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           ++G W    T+G GS GKV+LA +       A+K++++A                P S  
Sbjct: 114 SLGDWDFQTTVGAGSMGKVKLARHRYDDTVCAVKIVNRAT---KTFLYRQQSAPAPQSKA 170

Query: 76  YGIEREIIIMK----------------LLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119
              ERE ++ K                +L+H N+ +LY +    ++ YM+ EY   G+L 
Sbjct: 171 DIKERERLLAKEIARDTRTVREASLGQVLSHQNICQLYQMCTMSNHFYMMFEYVSGGQLL 230

Query: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +++ G L E  A  F R I  G++Y HA  +VHRDLK EN++L     IKI DFG++ 
Sbjct: 231 DYIIQHGSLREPLARSFARAIASGLAYLHANNVVHRDLKIENIMLTAAGEIKIIDFGLSN 290

Query: 180 LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIR 239
           L      L T CGS ++AAPE++   PY G E D+WS G+IL+ L+ G++PFD+E+ N  
Sbjct: 291 LFDPRAKLTTYCGSLYFAAPELLRAKPYIGPEIDIWSFGVILYVLVVGKVPFDDENSNA- 349

Query: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREIL-KHPLVQKYPSI 295
            L  K++ G+   P    +S E   L++K+LTV+PK+R   +EI+  H +V+ Y +I
Sbjct: 350 -LHEKIKRGKVSYPAT--LSIECISLLTKMLTVNPKRRATLKEIVTHHWMVRGYGNI 403

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score =  182 bits (461), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 96/278 (34%), Positives = 152/278 (54%), Gaps = 23/278 (8%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           +G +K+ + +G GS GKV LA +  T Q+  +K  +K                 P+    
Sbjct: 34  IGNYKIVKLIGEGSFGKVYLANHRLTHQKVVLKTGNKN---------------DPN---- 74

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            + RE+   +  + P++ +LY+V  T+S ++M LEY    EL+  L+ +  +   E+ + 
Sbjct: 75  -VVREVFYHRQFDFPHITKLYEVIVTESKVWMALEYCPGKELYEYLLMQHRISLEESGKL 133

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI+  + Y H+L  VHRDLK EN+LLD K   KI DFG         +LET CG+  Y
Sbjct: 134 FAQIVSAVYYAHSLQCVHRDLKLENILLDKKGRAKITDFGFTRECATKTMLETVCGTTVY 193

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
            APE+I    Y G + D+WS G+IL+ ++ G +PFDEED       +  +   +    +D
Sbjct: 194 MAPELIERKSYDGFKIDIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFY---NDD 250

Query: 257 EISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPS 294
            +S++A+DLIS++L  DP +R +  ++L HP +Q Y S
Sbjct: 251 VVSKDAKDLISQLLCKDPSQRPQLSQVLAHPFLQPYGS 288

>KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 909

 Score =  181 bits (459), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 107/293 (36%), Positives = 155/293 (52%), Gaps = 36/293 (12%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAY---NSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPD 72
           T GP+ +G TLG G  GKV+L +   NS   +  AIK+I +                  D
Sbjct: 52  TFGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRR------------------D 93

Query: 73  SLP------YGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERG 126
           ++P        I REI  +K L HPN++ L +V +    + +VL YA  GE +  + ++ 
Sbjct: 94  TIPKNSEKEVKIYREINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKR 153

Query: 127 PLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEDK 185
            L E  A R F Q+I G+ Y H  G+ HRDLK ENLLLD   N+ I DFG      + + 
Sbjct: 154 RLKEPAACRLFAQLISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRND 213

Query: 186 LLETSCGSPHYAAPE-IISGLPYHGLETDVWSCGIILFALLTGRL-----PFDEEDGNIR 239
           L++TSCGSP YAAPE +++   Y   + DVWSCG+IL+A+L G L     P + +  +I 
Sbjct: 214 LMKTSCGSPCYAAPELVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIA 273

Query: 240 NLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKY 292
            L   +     + P  + I+   +D++ +IL  DP KRI    ILKH  +Q +
Sbjct: 274 KLYNYITKTSLKFP--EYINPIPRDILRRILVSDPSKRITVELILKHQWLQPH 324

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score =  179 bits (455), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 111/321 (34%), Positives = 171/321 (53%), Gaps = 39/321 (12%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +K+ + +G GS GKV LA +  T  +  +K  +K+                P+    
Sbjct: 35  VGNYKILDQIGEGSFGKVYLASHRLTHCKVVLKTSNKS---------------DPN---- 75

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            I RE+   +  ++P + +LY+V  T+S ++M  EY    +L++ ++    +P +  I  
Sbjct: 76  -IVREVFYHRQFDYPYITQLYEVIVTESKVWMAQEYCPGKDLYDHVLSLQRVPSSACIEL 134

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI+  + Y H+L  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y
Sbjct: 135 FTQIVGAVYYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTSLETICGTTVY 194

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP-GN 255
            APE+I    Y G + D+WS G+IL+ +L G +PFDE+D        K+ +   EMP  N
Sbjct: 195 MAPELIKRESYDGFKIDIWSLGVILYTMLNGSMPFDEDDET--KTEWKIMN---EMPVFN 249

Query: 256 DEI-SREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPL 314
           D I S +A+DL+ K+L+ DP +R   +EIL HP +Q Y S+   KT R L ++       
Sbjct: 250 DTILSEDAKDLLIKLLSKDPNERPSMQEILHHPFLQPYGSLLLEKTDRLLRKQ------- 302

Query: 315 SDDNGDV---CEIDPKILQNL 332
              NG +    +++ K+L+NL
Sbjct: 303 --RNGTIHFHSKLERKLLKNL 321

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score =  179 bits (454), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 150/291 (51%), Gaps = 23/291 (7%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +K+ + +G GS GKV LA +  T ++  +K                    T D    
Sbjct: 34  VGNYKILKQIGEGSFGKVYLASHKPTHRKVVLK--------------------TSDKSDP 73

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            + RE+   +  + P + +LY+V  T++ ++M LEY    EL+  L+    +P +E  + 
Sbjct: 74  NLVREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGRELYEHLLMLHRIPLDECAKL 133

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI+  + Y H+L  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y
Sbjct: 134 FAQIVSAVHYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECVSKSSLETICGTTVY 193

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
            APE+I    Y G + D+WS G+IL+ ++ G +PFDE+D       +      F    ++
Sbjct: 194 MAPELIQRQAYDGFKIDIWSLGVILYTMINGTMPFDEDDETKTKWKI---VNDFPNFNDN 250

Query: 257 EISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPRE 307
            +S EA+DLI ++L   P +R    +IL HP +Q Y  I  S+T + + R+
Sbjct: 251 FVSHEAKDLIKRLLAKCPSERPTMEQILSHPFLQPYGQIMLSRTEKIIKRQ 301

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score =  179 bits (454), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 100/281 (35%), Positives = 151/281 (53%), Gaps = 27/281 (9%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +++   +G GS GKV LA++  T ++  +K  +K+                P+    
Sbjct: 34  VGNYRILRQIGEGSFGKVYLAHHLPTHRKVVLKSSAKS---------------DPN---- 74

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            + RE+   +    P + +LY++  T++ ++M LEY    EL+  L+    +P +E  R 
Sbjct: 75  -VVREVFYHRQFEFPYITKLYEIIVTETKVWMALEYCPGKELYEHLLRLHRIPVDECSRL 133

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI   + Y H+L  VHRDLK EN+LLD   N K+ DFG         +LET CG+  Y
Sbjct: 134 FAQISGAMYYAHSLNCVHRDLKLENILLDKVGNAKLTDFGFTRECASKNILETICGTTVY 193

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
            APE+I    Y G + DVWS G+IL+ LL G +PFDEE    +N   K+ +   EMP  D
Sbjct: 194 MAPELIKRERYDGFKIDVWSLGVILYTLLNGFMPFDEEQQ--KNTEWKIVN---EMPSFD 248

Query: 257 E--ISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSI 295
              +  +A DL+SK+L  DP  R   +E+L+HP +Q Y ++
Sbjct: 249 STLLGPDAVDLLSKLLAKDPIDRPSMKEVLEHPYLQPYGNV 289

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score =  177 bits (450), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 154/291 (52%), Gaps = 23/291 (7%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +K+ + +G GS GKV LA +  T  +  +K                    + D    
Sbjct: 35  VGNYKILDQIGEGSFGKVYLAQHRPTHTKVVLK--------------------SSDKNDP 74

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            I RE+   +  ++P + +LY+V  T++ ++M LEY    EL++ ++    +P +E ++ 
Sbjct: 75  NIVREVFYHRQFDYPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQL 134

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI+ G+ Y H+L  VHRDLK EN+LLD   + K+ DFG          LET CG+  Y
Sbjct: 135 FAQIVGGVHYAHSLNCVHRDLKLENILLDKSGDAKLTDFGFTRECMTKTTLETICGTTVY 194

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
            APE+I    Y G + D+WS G+IL+ ++ G +PFDE+D       +  Q+ Q      +
Sbjct: 195 MAPELIERKSYDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQL---NEN 251

Query: 257 EISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPRE 307
            ++ +A+DLI ++L  +P  R    +ILKHP +Q + S    +T + L R+
Sbjct: 252 IVTADAKDLILRLLAKNPNDRPTVEQILKHPFLQPFGSTILEETEKILVRQ 302

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score =  176 bits (445), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 148/276 (53%), Gaps = 23/276 (8%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +K+ + +G GS GKV LA +  T Q+  +K+ SK                 P+    
Sbjct: 34  VGNYKILKIVGEGSFGKVYLASHCLTHQKVVLKMGSKN---------------DPN---- 74

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            + RE+   +  ++ ++ +LY+V  T++ ++M LEY    EL+  L+ +  +P  E    
Sbjct: 75  -VVREVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSEL 133

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI+  + Y H++  VHRDLK EN+LLD K + K+ DFG         +LET CG+  Y
Sbjct: 134 FSQIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTRECATKGILETICGTTVY 193

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
            APE+I   PY G + D WS GIIL+ ++ G +PFDE D       +   +  ++   ND
Sbjct: 194 MAPELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVDEVKTKYKIVHYNPTYD---ND 250

Query: 257 EISREAQDLISKILTVDPKKRIKTREILKHPLVQKY 292
            I    ++LIS++L  DP +R    ++L+HP +Q Y
Sbjct: 251 YIDSNGKELISQLLEKDPNQRPSLTQVLQHPFLQPY 286

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score =  175 bits (444), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 90/278 (32%), Positives = 150/278 (53%), Gaps = 23/278 (8%)

Query: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSL 74
           N VG +K+ + +G GS GKV LA +  T ++  +K                    + D  
Sbjct: 34  NEVGNYKILKQIGEGSFGKVYLALHKPTHKKVVLK--------------------SSDKT 73

Query: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAI 134
              + REI   +  + P + +LY+V  T++ ++MV+EY    EL++ L+ +  +  +E+ 
Sbjct: 74  DPNVVREIFYHRQFDFPYITKLYEVIITETKVWMVIEYCPNKELYDYLLSKKRISLDESA 133

Query: 135 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSP 194
           R F QI+  + Y H+L  VHRDLK EN+LLD   N K+ DFG     +++  LET CG+ 
Sbjct: 134 RIFAQIVGAVYYAHSLSCVHRDLKLENILLDKDNNAKLTDFGFTRDFSKNTQLETICGTT 193

Query: 195 HYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPG 254
            Y APE++    Y G + D+W+ GI+L+ ++ G +PFDE+D     L +   S  ++   
Sbjct: 194 VYMAPELLRREKYDGYKIDIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYD--- 250

Query: 255 NDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKY 292
           N   + ++ DL++++L+ DP  R    +IL HP +  Y
Sbjct: 251 NKYFNDDSIDLVNRLLSKDPSMRPTIEQILMHPFLASY 288

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score =  174 bits (441), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 109/337 (32%), Positives = 167/337 (49%), Gaps = 47/337 (13%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           +G +K+ + +G GS GKV LA +  T Q+  +K  +K                 P+    
Sbjct: 34  IGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKTGNKR---------------DPN---- 74

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            + RE+   +  + P + +LY+V  T+S ++MVLEY    EL+  L++   L   E+ + 
Sbjct: 75  -VVREVFYHRQFDFPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKL 133

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI   + Y H L  VHRDLK EN+LLD   + K+ DFG          LET CG+  Y
Sbjct: 134 FSQIASAVYYAHELKCVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETICGTTVY 193

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
            APE+I    Y G + D+WS GIIL+ ++ G +PFDE+D    ++  K++    E+  N 
Sbjct: 194 MAPELIERKCYDGFKVDIWSLGIILYTMINGYMPFDEDD----DIKTKLKIVNDELDFNQ 249

Query: 257 E-ISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPLS 315
           E IS +A DLI  +L  +P +RI   ++L HP +Q +  +   KT + L         L 
Sbjct: 250 EWISDDAIDLIQGMLRKNPNERISLAQVLSHPFLQPWGVVAKEKTDKVL---------LK 300

Query: 316 DDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPG 352
              G V              +H +  K + K+LK+ G
Sbjct: 301 QRGGHVH-------------FHSKHEKRLLKRLKQCG 324

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score =  174 bits (440), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 99/278 (35%), Positives = 148/278 (53%), Gaps = 27/278 (9%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +K+ + +G GS GKV LA +  T ++  +K  SK                 P+    
Sbjct: 34  VGNYKILKQVGEGSFGKVYLAIHRPTHRKVVLKSSSKT---------------DPN---- 74

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            + RE+   +  +HP + +LY++  T++ ++M LEY    EL++ L+    +P +E  R 
Sbjct: 75  -VVREVFYHRQFDHPYITKLYEIIITETKVWMSLEYCPGKELYDYLLVMRRIPLDECSRL 133

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI+  + Y H+L  VHRDLK EN+LLD + N K+ADFG          LET CG+  Y
Sbjct: 134 FAQIVGAVYYAHSLNCVHRDLKLENILLDMQGNAKLADFGFTRECATKNQLETICGTTVY 193

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
            APE++    Y G + D+WS G+IL+ L+ G +PFDEED   R     +     E P  +
Sbjct: 194 MAPELLRRDTYDGFKIDIWSLGVILYTLINGSMPFDEED-ETRTEWKIIN----EEPDYN 248

Query: 257 E--ISREAQDLISKILTVDPKKRIKTREILKHPLVQKY 292
           E   +  + +LI  +L  DPKKR    EILKH  ++ Y
Sbjct: 249 EKIFNANSIELIKSLLIKDPKKRPSMTEILKHKFLEPY 286

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score =  174 bits (441), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 146/276 (52%), Gaps = 23/276 (8%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +K+ E +G GS GKV LA +  T ++  IK   K                 P+    
Sbjct: 43  VGNYKILEQIGEGSFGKVYLAMHRPTHRKVVIKSSVKN---------------DPN---- 83

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            I RE+   +   +  + +LY++  T+S ++M LEY    EL++ +++   +P  E I+ 
Sbjct: 84  -IVREVFYHRQFEYHYITKLYEIIVTESKVWMALEYCPGRELYDHVLQMKRIPAEECIQL 142

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI+  + Y H+L  VHRDLK EN+LLD   N K+ DFG      E   LET CG+  Y
Sbjct: 143 FSQIVGAVYYAHSLNCVHRDLKLENILLDKDGNAKLTDFGFTRECMEKVNLETICGTTVY 202

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
            APE+    PY G + D+WS G+IL+ +L+G +PFDE+D       +  +  ++    + 
Sbjct: 203 MAPELTERKPYDGFKIDIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEY---NSK 259

Query: 257 EISREAQDLISKILTVDPKKRIKTREILKHPLVQKY 292
            ++ E +DL+ K+L  D   R   REIL+H  +Q Y
Sbjct: 260 FMTAEGEDLVRKLLQKDSNLRPSVREILQHEFLQPY 295

>KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  164 bits (415), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 148/290 (51%), Gaps = 28/290 (9%)

Query: 10  LEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLL 69
           L +K  T   + +G  LG G  GKV    +  +G   A+KV+ K                
Sbjct: 103 LRIKSFTKDDFDIGLKLGKGKFGKVFCVRHKESGFICALKVMQKT--------------- 147

Query: 70  TPDSLPYGIEREII----IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVER 125
             D L Y +ER+ I    I   LNHPN+ +LY  +  +  +Y+++EY   GEL+  L   
Sbjct: 148 --DILQYKLERQFIREVEIQSSLNHPNIAKLYGYFHDEKRVYLIMEYMLYGELYKTLEIH 205

Query: 126 GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDK 185
           GP     A  +  QI   I Y H   I+HRD+KPEN+L+     +K+ DFG + +  +  
Sbjct: 206 GPFENAVATNYVYQIASAILYLHQRHIIHRDIKPENILIGPHNQLKLTDFGWSIINPKGL 265

Query: 186 LLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLL-K 244
              T CG+  Y +PEI+    Y     D+W+ GI+ + LL G  PF+E   N ++L   +
Sbjct: 266 RRRTFCGTIDYLSPEIVDYKEYDH-NVDIWALGIVAYELLVGSPPFEE---NTKDLTYER 321

Query: 245 VQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPS 294
           ++ G    P   +++ EA+D I +IL ++PKKR+  +EI+ HP + KY S
Sbjct: 322 IRRGDIVFP--KQVTPEARDFIERILVLEPKKRMTLKEIMSHPWILKYKS 369

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score =  172 bits (435), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 110/352 (31%), Positives = 177/352 (50%), Gaps = 41/352 (11%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +K+ + +G GS GKV LA +  T ++  +K                    T D    
Sbjct: 34  VGNYKIMKQIGEGSFGKVYLASHKPTHRKVVLK--------------------TSDKNDP 73

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            + RE+   +  ++  + RLY+V  T++ ++M LEY    EL+  L+    +  +E  R 
Sbjct: 74  NVVREVFYHRQFDYLYITRLYEVIVTETKVWMALEYCPGKELYEHLLALKRISLDECSRL 133

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI+  I Y H+L  VHRDLK EN+LLD K N K+ DFG          L+T CG+  Y
Sbjct: 134 FAQIVGAIYYAHSLNCVHRDLKLENILLDKKGNAKLTDFGFTRECVSKSQLDTICGTTVY 193

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP--G 254
            APE+     Y G + D+W+ G+IL+ ++ G +PFDE+D        K+ +   EMP   
Sbjct: 194 MAPELTERKSYDGFKIDIWALGVILYTMINGSMPFDEDDEA--KTKWKIVN---EMPEIN 248

Query: 255 NDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKY--PSI-KDSKTIRNLPREDTYL 311
            D +S +A+DLI ++L  DP +R    +IL HP +Q Y  P + K  K +R   R   + 
Sbjct: 249 EDLVSPDAKDLIEQLLAKDPNERPSIEKILTHPFLQPYGIPLMEKTQKILRKQRRGSVHF 308

Query: 312 NPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALL 363
           +          +++ K+L+ L  +  G D++ +   +++   +A   L+ LL
Sbjct: 309 H---------SKLERKLLKRLKQM--GFDTQSMKASVQKKKCDALSGLWLLL 349

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score =  171 bits (433), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 99/281 (35%), Positives = 150/281 (53%), Gaps = 27/281 (9%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +K+ + +G GS GKV LA +  T Q+  +K   K                 P+    
Sbjct: 34  VGNYKILKQVGEGSFGKVYLANHKLTHQKVVLKTGEKK---------------DPN---- 74

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            + RE+   +  + P + +LY+V  T+S ++M LEY    EL++ L+++  +P +E  + 
Sbjct: 75  -VVREVFYHRQFDFPFITKLYEVIVTESKVWMALEYCPGNELYDYLLQKQRIPLDETSKL 133

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI+  + Y H+L  VHRDLK EN+LLD +    + DFG          LET CG+  Y
Sbjct: 134 FAQIVGAVFYAHSLQCVHRDLKLENILLDKQGYAMLTDFGFTRECATKTQLETICGTTVY 193

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP--G 254
            APE+I    Y G + D WS GIIL+ +L G +PFDEED  +    LK+ +   EMP   
Sbjct: 194 MAPELIKRESYDGYKVDTWSLGIILYTMLHGFMPFDEEDPTLTG--LKIMN---EMPPIV 248

Query: 255 NDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSI 295
           +   +  A+DLI K+L   P +R    ++L+HP +Q Y +I
Sbjct: 249 DAYTNVHAKDLILKLLRKTPSERPSLNKVLEHPFLQPYGTI 289

>SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
          Length = 432

 Score =  164 bits (414), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 109/321 (33%), Positives = 167/321 (52%), Gaps = 34/321 (10%)

Query: 3   KLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXX 62
           KL+ +PS  V  +    +  G+TLG GS G V+ A   STG   A+K++ K         
Sbjct: 32  KLSGQPSSYVNKS---DYIFGKTLGAGSFGVVRQARKISTGDNVAVKILLKKA------- 81

Query: 63  XXXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLL 122
                L   D     +  E++I++ LNHPN+++  D +E+    Y+V + A  GELF+ +
Sbjct: 82  -----LKGNDVQLQMLYDELMILQKLNHPNIVKFKDWFESKEKFYIVTQLATGGELFDRI 136

Query: 123 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMAA 179
           +++G   E +A++   QI+  + Y H+  IVHRDLKPENLL LD   N  + + DFG+A 
Sbjct: 137 LQKGKFTEVDAVKIVVQILKAVEYLHSRNIVHRDLKPENLLYLDKSDNSQLVLGDFGIAK 196

Query: 180 -LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNI 238
            L+ +  L+  + GS  Y APE+++    HG   D+WS G+I + LL G  PF  E  ++
Sbjct: 197 ELKNDGDLIHKAAGSMGYVAPEVLTS-NGHGKPCDIWSIGVITYTLLCGYSPFIAE--SV 253

Query: 239 RNLLLKVQSGQ----FEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK--- 291
              L +  SGQ    F  P  + IS+EA+  I ++LT+ PKKR    ++L    +     
Sbjct: 254 DGFLEECTSGQYPVTFHKPYWNNISKEAKLFILRVLTISPKKRPTATDLLSDAWITSKTQ 313

Query: 292 -----YPSIKDSKTIRNLPRE 307
                 P I+     RN  RE
Sbjct: 314 QTNDLLPEIRKGFNARNKFRE 334

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score =  170 bits (430), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 156/291 (53%), Gaps = 23/291 (7%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +++ + +G GS GKV LA +  T Q+  +K+ SK                 P+    
Sbjct: 34  VGNYRILKIVGEGSFGKVYLASHRLTHQKVVLKMGSKN---------------DPN---- 74

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            + RE+   +  ++  + +LY+V  T+++++M LEY    EL+  L+ +  +P +E    
Sbjct: 75  -VVREVFYHRQFDYVYITKLYEVIVTENSVWMALEYCPGKELYEYLLIKKRIPLDECSHL 133

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI+  + Y H++  VHRDLK EN+LLD K   K+ DFG         +LET CG+  Y
Sbjct: 134 FSQIVGAVFYAHSMKCVHRDLKLENILLDKKGQAKLTDFGFTRECATKGILETVCGTTVY 193

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
            APE+I   PY G + D WS GIIL+ ++ G +PFDEED +I+     V +  F    ++
Sbjct: 194 MAPELIERKPYEGYKIDTWSLGIILYTMIHGAMPFDEED-DIKTKYRIVNNEPFY--DDN 250

Query: 257 EISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPRE 307
            I    +DLI ++L  DP +R    ++L+HP +  + S    KT + + R+
Sbjct: 251 FIDANGKDLIMQLLQKDPSQRPSLTQVLQHPFMFPHGSSILEKTDKTIKRQ 301

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score =  170 bits (431), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 151/293 (51%), Gaps = 27/293 (9%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +K+ + +G GS GKV LA +  T ++  +K                    T D    
Sbjct: 38  VGNYKILKQVGEGSFGKVYLALHRPTHRKVCLK--------------------TSDKNDP 77

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            I RE+   +  + P + +LY+V  T++ ++M LEY    EL++ L+    +   E    
Sbjct: 78  NIVREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSLHRISLLECAEL 137

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y
Sbjct: 138 FAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVY 197

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
            APE+I    Y G + D+WS G+IL+ L+TG LPFD++D  ++     V     E P  D
Sbjct: 198 MAPELIERRTYDGFKIDIWSLGVILYTLITGSLPFDDDD-EVKTKWKIVN----EEPNYD 252

Query: 257 E--ISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPRE 307
              I  +A+DLIS++L  +PK+R    ++L H  +Q Y S+   +T + L R+
Sbjct: 253 STLIPDDAKDLISRLLAKNPKERPSLPQVLHHQFLQPYGSVVLDQTEKTLSRQ 305

>KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.374
           YFR014C
          Length = 440

 Score =  163 bits (412), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 99/278 (35%), Positives = 149/278 (53%), Gaps = 23/278 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           ++ G+T+G G+ G V+ A   STG++ A+K+I K                        + 
Sbjct: 41  YEFGKTMGAGTFGVVRKATKISTGEEVAVKIILKKALEGNDIQLQM------------LY 88

Query: 80  REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 139
            E+ I++ L HPN++     +E+   +Y+V + A  GELF+ +++RG   E +A+    Q
Sbjct: 89  DELAILQQLKHPNIVEFKAWFESKDKIYIVTQLATGGELFDTILKRGKFTELDAVDIVVQ 148

Query: 140 IIIGISYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMAA-LETEDKLLETSCGSPH 195
           I+  + Y H+  +VHRDLKPEN+L      K  I IADFG+A  LE E  L+  + GS  
Sbjct: 149 ILKAVEYIHSQNVVHRDLKPENILYVDESEKSQIVIADFGIAKRLEGEGDLIFKAAGSLG 208

Query: 196 YAAPEII--SGLPYHGLETDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFE 251
           Y APE++  SG   HG   D+WS GII + LL G  PF  E  DG +  ++   +   F 
Sbjct: 209 YVAPEVLLNSG---HGKPCDIWSVGIIAYTLLCGYSPFVAEDVDGFLDEIVENEEPIAFH 265

Query: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLV 289
            P  DEIS EA+  I + +T+DP +R    E+LK P +
Sbjct: 266 SPYWDEISNEAKQFILRAVTIDPFQRPTATELLKDPWI 303

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score =  169 bits (428), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 95/281 (33%), Positives = 150/281 (53%), Gaps = 27/281 (9%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +++ + +G GS GKV LA +  T Q+  +K  +K+                P+    
Sbjct: 34  VGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKS---------------DPN---- 74

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            + RE+   +   +P + +LY+V  T++ ++M LEY    EL++ L+ +  +P +E  R 
Sbjct: 75  -VVREVFYHRQFEYPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRL 133

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI+  + Y H+L  VHRDLK EN+LLD      + DFG          LET CG+  Y
Sbjct: 134 FAQIVSAVFYAHSLQCVHRDLKLENILLDKNGYAMLTDFGFTRECATKTQLETVCGTTVY 193

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPG-- 254
            APE+I    Y G + D WS GIIL+ +L G +PFDE+D  +R  L  +     E P   
Sbjct: 194 MAPELIKREAYDGYKVDTWSLGIILYTMLHGYMPFDEDD-TVRTGLKIMH----EEPAVL 248

Query: 255 NDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSI 295
           ++  S +A+DLI ++L  +  +R    E+L+HP +Q Y ++
Sbjct: 249 DEYTSPQAKDLIVRLLDKNAAQRPNLNEVLQHPFLQPYGAL 289

>NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON}
           Anc_1.374
          Length = 437

 Score =  161 bits (408), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 100/300 (33%), Positives = 156/300 (52%), Gaps = 27/300 (9%)

Query: 22  LGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIERE 81
            G+TLG G+ G V+ A   +TG+  A+K++ K                        +  E
Sbjct: 54  FGKTLGAGTFGVVRQARKLTTGEDVAVKILLKKALKGNNVQLQM------------LYDE 101

Query: 82  IIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQII 141
           + I++ L+HPN++   D +E+    Y+V + A  GELF+ ++++G   E +A+    Q+I
Sbjct: 102 LAILQKLHHPNIVAFKDWFESKDKFYIVTQLATGGELFDRIIKKGKFSEVDAVSIMVQLI 161

Query: 142 IGISYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMAA-LETEDKLLETSCGSPHYA 197
             +SY H+  IVHRDLKPEN+L LD+  N  + IADFG+A  L++ D L+    GS  Y 
Sbjct: 162 SAVSYIHSQNIVHRDLKPENVLYLDNSDNSQLVIADFGIAKELKSNDDLIFKGAGSLGYV 221

Query: 198 APEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPGN 255
           APE+++    HG   D+WS G+I + LL+G   F  E  +G +          +F  P  
Sbjct: 222 APEVLTR-EGHGKPCDIWSLGVITYTLLSGYSAFIAESVEGFLEECTRSTYPVKFHSPYW 280

Query: 256 DEISREAQDLISKILTVDPKKRIKTREILKHPLVQK--------YPSIKDSKTIRNLPRE 307
           D IS+EA+D I + LT+DP  R    E+L+ P +           P +K   T+R   R+
Sbjct: 281 DNISQEAKDFILRALTIDPNDRPTAEELLQDPWITNKNISTTDILPDVKKGFTLRKKLRD 340

>KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and to
           YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
           CMK1 Calmodulin-dependent protein kinase
          Length = 437

 Score =  161 bits (408), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 98/278 (35%), Positives = 149/278 (53%), Gaps = 27/278 (9%)

Query: 22  LGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIERE 81
            G TLG GS G V+ A   STG+  A+K++ K              L   D     +  E
Sbjct: 48  FGRTLGAGSFGVVRQARKLSTGENVAVKILLKKA------------LKGKDVQLQMLYDE 95

Query: 82  IIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQII 141
           + I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   E +A+R   QI+
Sbjct: 96  LSILQKLDHPNIVKFKDWFESKDKFYIVTQLAMGGELFDRILKKGKFTEKDAVRIVYQIL 155

Query: 142 IGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEDKLLETSCGSPHYA 197
             + Y H+  IVHRDLKPENLL   + +   + + DFG+A  L  ED+L+  + GS  Y 
Sbjct: 156 KAVEYLHSRNIVHRDLKPENLLYLAEKDDSPLVLGDFGIAKELNNEDELIHKAAGSMGYV 215

Query: 198 APEII--SGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----FE 251
           APE++  SG   HG   D+WS G++ + LL G  PF  E  ++   L +  SG+    F 
Sbjct: 216 APEVLTTSG---HGKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTSGRYPVTFH 270

Query: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLV 289
            P    IS +A+D I + LTV P+ R    E+L H  +
Sbjct: 271 KPYWSSISDDAKDFILQALTVTPRYRPSATELLNHKWI 308

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score =  168 bits (426), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 97/291 (33%), Positives = 151/291 (51%), Gaps = 23/291 (7%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +K+ + +G GS GKV LA +  T ++  +K                    T D    
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLK--------------------TSDKNDP 77

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            I RE+   +  + P + +LY+V  T+S ++M LEY    EL++ L+    +   E    
Sbjct: 78  NIVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECGEL 137

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y
Sbjct: 138 FAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVY 197

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
            APE+I    Y G + D+WS G+IL+ L+TG LPFD++D       +  +  +++     
Sbjct: 198 MAPELIERRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYDA---K 254

Query: 257 EISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPRE 307
            I  +A+DLIS++L  +P +R    ++L+HP +Q Y S+   +T + L R+
Sbjct: 255 VIPDDARDLISRLLAKNPGERPSLSQVLRHPFLQPYGSVVLDQTQKILCRQ 305

>YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}
           CMK1Calmodulin-dependent protein kinase; may play a role
           in stress response, many Ca++/calmodulin dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk2p and mammalian Cam Kinase
           II
          Length = 446

 Score =  160 bits (406), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 152/278 (54%), Gaps = 23/278 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           +  G+TLG G+ G V+ A N+ TG+  A+K++ K                        + 
Sbjct: 37  YVFGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLE------------ALY 84

Query: 80  REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 139
            E+ I++ L+HPN++   D +E+    Y++ + A+ GELF+ ++++G   E +A+R   +
Sbjct: 85  DELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVE 144

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEDKLLETSCGSPH 195
           I+  + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++++LL    GS  
Sbjct: 145 ILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLG 204

Query: 196 YAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----FE 251
           Y APE+++    HG   D+WS G+I + LL G   F  E   +++ L +  +G+    F 
Sbjct: 205 YVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFRAE--RVQDFLDECTTGEYPVKFH 261

Query: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLV 289
            P  D +S +A+  I K L +DP KR    E+L+ P +
Sbjct: 262 RPYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWI 299

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  166 bits (419), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 139/229 (60%), Gaps = 7/229 (3%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-Q 139
           EI I K + H N+++  D +E D+N+Y++LE    G L +LL  R  L E E +RFF  Q
Sbjct: 126 EIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPE-VRFFTTQ 184

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 198
           I+  + Y H+  ++HRDLK  N+  D  YN+K+ DFG+AA+   D+  + T CG+P+Y A
Sbjct: 185 IVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIA 244

Query: 199 PEIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           PE+++G    H  E D+WSCG++++ALL G+ PF  ++ NI  +  +++ G F  P +  
Sbjct: 245 PEVLTGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDFVFPKDKF 302

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKHPLVQK-YPSIKDSKTIRNLP 305
           IS EA  LI  IL++DP +R    EI+ +   +  +PS  D+  + + P
Sbjct: 303 ISPEALVLIKDILSIDPLERPSLDEIIDYVWFRGLFPSRIDASVLTSAP 351

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score =  167 bits (424), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 102/293 (34%), Positives = 152/293 (51%), Gaps = 27/293 (9%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +K+ + +G GS GKV LA +  T ++  +K                    T D    
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLK--------------------TSDKNDP 77

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            I RE+   +  + P + +LY+V  T+S ++M LEY    EL++ L+    L   E    
Sbjct: 78  NIVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRLSLLECGEL 137

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y
Sbjct: 138 FAQISGAVYYAHSMHCVHRDLKLENILLDRNGNAKLTDFGFTRECMTKTTLETVCGTTVY 197

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
            APE+I    Y G + D+WS G+IL+ L+TG LPFD++D  ++     V     E P  D
Sbjct: 198 MAPELIERKTYDGFKIDIWSLGVILYTLITGYLPFDDDD-EVKTKWKIVN----EEPKYD 252

Query: 257 E--ISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPRE 307
              I  +A+DLIS++L  +P +R    ++L+HP +Q Y S+   +T + L R+
Sbjct: 253 SKFIPDDAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSVVLDQTEKILCRQ 305

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score =  167 bits (423), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 102/298 (34%), Positives = 150/298 (50%), Gaps = 37/298 (12%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +K+ + +G GS GKV LA +  T ++  +K                    T D    
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLK--------------------TSDKNDP 77

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            I RE+   +  + P + +LY+V  T+S ++M LEY    EL++ L+    +   E    
Sbjct: 78  NIVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLHRISLLECGEL 137

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI   + Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  Y
Sbjct: 138 FAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVY 197

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEED-----GNIRNLLLKVQSGQFE 251
            APE+I    Y G + D WS G+IL+ L+TG LPFD++D       I N          E
Sbjct: 198 MAPELIGRKTYDGFKIDTWSLGVILYTLITGSLPFDDDDEAKTKWKIVN----------E 247

Query: 252 MPGNDE--ISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPRE 307
            P  D   I  +A+DLIS++L  +P +R    ++L+HP +Q Y S+   +T + L R+
Sbjct: 248 EPKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSVVLDQTEKILCRQ 305

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score =  166 bits (419), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 82/207 (39%), Positives = 130/207 (62%), Gaps = 6/207 (2%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-Q 139
           EI I K + HPN++   D +E D+N+Y++LE    G L +L+ +R  L E E +RFF  Q
Sbjct: 139 EIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPE-VRFFTTQ 197

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 198
           I   + Y H+  ++HRDLK  N+  D  YN+K+ DFG+AA+   ++  + T CG+P+Y A
Sbjct: 198 ICGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIA 257

Query: 199 PEIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           PE++ G    H  E D+WS G++++ALL G+ PF  +D N+  +  ++++ Q+  P +  
Sbjct: 258 PEVLMGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYDRIKACQYGYPKDKY 315

Query: 258 ISREAQDLISKILTVDPKKRIKTREIL 284
           +S EA+ LI+ IL VDP +R   REI+
Sbjct: 316 VSSEAKTLIADILCVDPVERPSIREII 342

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  165 bits (417), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/229 (37%), Positives = 139/229 (60%), Gaps = 7/229 (3%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-Q 139
           EI I K + H N+++  D +E D+N+Y++LE    G L +LL  R  L E E +RFF  Q
Sbjct: 126 EIQIHKSMRHFNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRKVLTEPE-VRFFTTQ 184

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 198
           I+  + Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 185 IVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 244

Query: 199 PEIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           PE+++G    H  E D+WSCG++++ALL G+ PF  ++ NI  +  +++ G +  P +  
Sbjct: 245 PEVLTGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDYVFPRDKC 302

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKHPLVQK-YPSIKDSKTIRNLP 305
           IS+EA  LI  IL++DP +R    EI+ +   +  +P   D+  + + P
Sbjct: 303 ISQEALTLIRDILSIDPLERPSLDEIIDYVWFRGIFPPRIDASVLSSAP 351

>KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and uniprot|P27466
           Saccharomyces cerevisiae YFR014C CMK1
          Length = 427

 Score =  159 bits (402), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 96/283 (33%), Positives = 153/283 (54%), Gaps = 26/283 (9%)

Query: 3   KLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXX 62
           K+T +PS  V  +    +  G+TLG G+ G V+ A   S+G+  A+K++ K         
Sbjct: 32  KVTGQPSSYVNKSD---YIFGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQ 88

Query: 63  XXXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLL 122
                          +  E+ I++ LNHPN++R  D +E+    Y+V + A  GELF+ +
Sbjct: 89  LQM------------LYDELSILQQLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRI 136

Query: 123 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA 179
           +E+G   E +A+   +QI+ G+ Y H   IVHRDLKPEN+L  +K +   + I DFG+A 
Sbjct: 137 LEKGKFCEVDAVFIVKQILQGVQYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAK 196

Query: 180 -LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNI 238
            L+ +++L+  + GS  Y APE+++    HG   D+WS G+I + LL G  PF  E  + 
Sbjct: 197 ELKDDNELIHKAAGSMGYVAPEVLTS-SGHGKPCDIWSIGVITYTLLCGYSPFLAESAD- 254

Query: 239 RNLLLKVQSGQ----FEMPGNDEISREAQDLISKILTVDPKKR 277
              + +  SGQ    F  P  + +S+ A++ I   LTV PK+R
Sbjct: 255 -GFIEECTSGQYPVVFHKPYWNNVSKTAKEFILWALTVSPKRR 296

>NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {ON}
           Anc_1.374
          Length = 427

 Score =  159 bits (402), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 158/292 (54%), Gaps = 30/292 (10%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           ++ G+TLG GS G V+ A   S  ++ AIK++ K                        + 
Sbjct: 27  YEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQM------------LY 74

Query: 80  REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 139
            E+ I+K L+HPN++   + +ETD  +Y+V + A  GELF+ ++++G   E++A++   Q
Sbjct: 75  DELTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILIQ 134

Query: 140 IIIGISYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMAA-LETEDKLLETSCGSPH 195
           I+  + Y H+  IVHRDLKPENLL L  K +  + IADFG+A  L+  ++L+  + GS  
Sbjct: 135 ILSAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSLG 194

Query: 196 YAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSG----QFE 251
           Y APE+++ +  HG   D+WS G+I + LL+G   F  E   +   L +  SG    +F 
Sbjct: 195 YVAPEVLT-VDGHGKPCDIWSIGVITYTLLSGYAAFVAE--TVEGFLDECTSGDYPVKFH 251

Query: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRN 303
            P  D IS +A++ I K L ++P+KR    E+L  P +        SK  RN
Sbjct: 252 KPYWDNISDDAKNFILKALDLNPQKRPTATELLDDPWIT-------SKVCRN 296

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score =  165 bits (418), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 150/278 (53%), Gaps = 31/278 (11%)

Query: 26  LGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREIIIM 85
           +G G+   V+ A   STG+  A+K+I K                       G++RE+ ++
Sbjct: 198 VGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFD---------------GVKRELDVL 242

Query: 86  KLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGIS 145
           + LNHP +++L D +E + N YM++E+   G+L + +   G + E+      RQ++  + 
Sbjct: 243 QKLNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAVK 302

Query: 146 YCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIIS 203
           Y H  GI HRDLKP+N+++  D    IKI DFG+A ++ ++  L T CG+  Y APE+I 
Sbjct: 303 YMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAKVQNQNTFLNTFCGTLAYVAPEVID 362

Query: 204 GL---------PYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQF-EMP 253
           G           Y  L  D+WS G +++ +LTG LPF  +  N   L  +++ G + E P
Sbjct: 363 GKNAEDKTNRDLYSSL-VDMWSIGCLVYVILTGHLPFSGQSQN--ELFKQIKRGSYHEGP 419

Query: 254 GND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
             D  IS EA++ I  +L VDPK+R+   + L+HP ++
Sbjct: 420 LKDYRISEEARNFIDCLLNVDPKERMNAGKALQHPWMK 457

>Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C
           (REAL)
          Length = 445

 Score =  159 bits (402), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 153/278 (55%), Gaps = 23/278 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           +  G+TLG G+ G V+ A NS TG+  A+K++ K                        + 
Sbjct: 37  YVFGKTLGAGTFGVVRQARNSETGEDVAVKILIKKALKGNKIQLE------------ALY 84

Query: 80  REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 139
            E+ I++ L+HPN++   D +E++   Y++ + A+ GELF+ ++++G   E +A+R   +
Sbjct: 85  DELDILQRLHHPNIVAFKDWFESNDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVE 144

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEDKLLETSCGSPH 195
           I+  + Y H+  IVHRDLKPENLL   K +   + IADFG+A  L+++++L+  + GS  
Sbjct: 145 ILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVIADFGIAKRLKSDEELIYKAAGSLG 204

Query: 196 YAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----FE 251
           Y APE+++    HG   D+WS G+I + LL G   F  E   + + L +  +G+    F 
Sbjct: 205 YVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFKAE--RVLDFLDECTTGKYPVTFH 261

Query: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLV 289
            P  D +S +A+  I K L ++P KR    E+L+ P +
Sbjct: 262 RPYWDSVSDKAKRFILKALDLNPAKRPTAAELLEDPWI 299

>Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON}
           YFR014C (REAL)
          Length = 446

 Score =  159 bits (402), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 89/278 (32%), Positives = 152/278 (54%), Gaps = 23/278 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           +  G+TLG G+ G V+ A N+ TG+  A+K++ K                        + 
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGNKIQLE------------ALY 84

Query: 80  REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 139
            E+ I++ L+HPN++   D +E+    Y++ + A+ GELF+ ++++G   E +A+R   +
Sbjct: 85  DELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVE 144

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEDKLLETSCGSPH 195
           I+  + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++++L+    GS  
Sbjct: 145 ILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELIYKPAGSLG 204

Query: 196 YAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----FE 251
           Y APE+++    HG   D+WS G+I + LL G   F  E   +++ L +  +G+    F 
Sbjct: 205 YVAPEVLTQ-DGHGKPCDIWSLGVITYTLLCGYSAFKAE--RVQDFLDECTTGEYPVRFH 261

Query: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLV 289
            P  D +S +A+  I K L +DP KR    ++L+ P +
Sbjct: 262 RPYWDSVSDKAKQFILKALNLDPSKRPTAAQLLEDPWI 299

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score =  165 bits (417), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 150/290 (51%), Gaps = 37/290 (12%)

Query: 22  LGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIERE 81
           + E +G G+   V+ A   +TG+  A+K+ISK                       G+ RE
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMD---------------GVTRE 244

Query: 82  IIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQII 141
           + +++ LNHP ++RL   +E   + YMV+E+   G+L + +   G + E+      RQI+
Sbjct: 245 LEVLQKLNHPRIVRLKGFYEDADSYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQIL 304

Query: 142 IGISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAP 199
             + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y AP
Sbjct: 305 TAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAP 364

Query: 200 EIISGL-------------PYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-V 245
           E+I G               Y  L  D+WS G +++ +LTG LPF    G+ ++ L K +
Sbjct: 365 EVIRGKDSSASPDEYEERNEYSSL-VDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQI 420

Query: 246 QSGQF-EMPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQKYP 293
             G + E P  D  IS EA+D I  +L VDP  R+   + L HP ++  P
Sbjct: 421 GRGSYHEGPLKDFRISEEARDFIDSLLQVDPSNRLTAAKALDHPWIKMGP 470

>YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON}
           RAD53Protein kinase, required for cell-cycle arrest in
           response to DNA damage; activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p; also interacts with ARS1 and
           plays a role in initiation of DNA replication
          Length = 821

 Score =  164 bits (416), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 101/312 (32%), Positives = 158/312 (50%), Gaps = 41/312 (13%)

Query: 4   LTNKPSLEVKGNTVGPWK----LGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXX 59
           LT+  +  +  N  G +K    + E +G G+   V+ A   +TG+  A+K+ISK      
Sbjct: 178 LTSSTASSMVANKTGIFKDFSIIDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGN 237

Query: 60  XXXXXXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELF 119
                            G+ RE+ +++ LNHP ++RL   +E   + YMV+E+   G+L 
Sbjct: 238 MD---------------GVTRELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLM 282

Query: 120 NLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGM 177
           + +   G + E+      RQI+  I Y H++GI HRDLKP+N+L+  D    +KI DFG+
Sbjct: 283 DFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGL 342

Query: 178 AALETEDKLLETSCGSPHYAAPEIISGL-------------PYHGLETDVWSCGIILFAL 224
           A ++     ++T CG+  Y APE+I G               Y  L  D+WS G +++ +
Sbjct: 343 AKVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSL-VDMWSMGCLVYVI 401

Query: 225 LTGRLPFDEEDGNIRNLLLK-VQSGQF-EMPGND-EISREAQDLISKILTVDPKKRIKTR 281
           LTG LPF    G+ ++ L K +  G + E P  D  IS EA+D I  +L VDP  R    
Sbjct: 402 LTGHLPF---SGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAA 458

Query: 282 EILKHPLVQKYP 293
           + L HP ++  P
Sbjct: 459 KALNHPWIKMSP 470

>Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {ON}
           complement(27223..28506) [1284 nt, 428 aa]
          Length = 427

 Score =  158 bits (399), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 96/278 (34%), Positives = 149/278 (53%), Gaps = 23/278 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           +  G+TLG GS G V+ A   STG+  A+K++ K                        + 
Sbjct: 38  YVFGKTLGAGSFGVVRQARRISTGENVAVKILLKKALKGNCVQIEM------------LY 85

Query: 80  REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 139
            E+ I++ L+HPN++     +E+    Y+  + A  GELF+ ++ RG   E +A+R   Q
Sbjct: 86  DELSILQKLHHPNIVDFKAWFESKDKFYIATQLATGGELFDRILARGKFTEVDAVRIIVQ 145

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMA-ALETEDKLLETSCGSPH 195
           ++ GI Y H+  IVHRDLKPEN+L   K +   + IADFG+A  L++ D L+  + GS  
Sbjct: 146 LLQGIKYIHSKDIVHRDLKPENVLYIDKSDDSPLVIADFGIAKQLKSGDDLIFKAAGSLG 205

Query: 196 YAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSG----QFE 251
           Y APE+++ +  HG   D+WS G+I + LL G  PF  E  ++   L +  SG    +F 
Sbjct: 206 YVAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSPFIAE--SVEGFLDECTSGKYPVKFH 262

Query: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLV 289
            P  D IS EA++ I + L ++P KR    E+L+ P +
Sbjct: 263 RPYWDTISDEAKEFILRALILEPSKRPTASELLEDPWI 300

>Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {ON}
           YPL153C (REAL)
          Length = 827

 Score =  164 bits (415), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 95/288 (32%), Positives = 149/288 (51%), Gaps = 37/288 (12%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A   +TG+  A+K+ISK                       G+ RE+ 
Sbjct: 202 EVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMD---------------GVTRELE 246

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           +++ LNHP ++RL   +E   + YMV+E+   G+L + +   G + E+      RQI+  
Sbjct: 247 VLQKLNHPRIVRLKGFYEDAESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILAA 306

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE+
Sbjct: 307 VKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEV 366

Query: 202 ISGL-------------PYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQS 247
           I G               Y  L  D+WS G +++ +LTG LPF    G+ ++ L K +  
Sbjct: 367 IRGKDSSVSPDECEERNEYSSL-VDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGR 422

Query: 248 GQF-EMPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQKYP 293
           G + E P  D  IS EA+D I  +L VDP  R+   + L HP ++  P
Sbjct: 423 GSYHEGPLKDFRISEEARDFIDLLLQVDPNNRLTAAKALDHPWIKMNP 470

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score =  162 bits (411), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 142/252 (56%), Gaps = 5/252 (1%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           EI I K + HPN+++  D +E D+N+Y++LE    G L +LL +R  L E E   F  QI
Sbjct: 124 EIQIHKSMKHPNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKVLTEPEVRYFTTQI 183

Query: 141 IIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 199
           +  I Y H   ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y AP
Sbjct: 184 VGAIKYMHNRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 243

Query: 200 EIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEI 258
           E+++G    H  E D+WS G++++ALL G+ PF  ++ NI  +  +++SG +  P     
Sbjct: 244 EVLAGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKEVNI--IYERIKSGDYIFPREKPT 301

Query: 259 SREAQDLISKILTVDPKKRIKTREILKHPLVQK-YPSIKDSKTIRNLPREDTYLNPLSDD 317
           S+E   LI  IL++DP +R    EI+ +   +  +P+  +   + ++P  D      S  
Sbjct: 302 SKEVMVLIQDILSIDPIERPSLDEIMDYVWFRGIFPARINGDVLTSVPVYDNLDMDQSLA 361

Query: 318 NGDVCEIDPKIL 329
           N   C I   IL
Sbjct: 362 NFKNCMIQSGIL 373

>Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON}
           YOL016C (CMK2) - Calmodulin-dependent protein kinase
           [contig 76] FULL
          Length = 427

 Score =  157 bits (396), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 154/294 (52%), Gaps = 31/294 (10%)

Query: 22  LGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIERE 81
            G+TLG GS G V+ A   S+G+  AIK++ K              L   D     +  E
Sbjct: 48  FGKTLGAGSFGVVRQARQVSSGENVAIKILLK------------KALKGKDVELQMLYDE 95

Query: 82  IIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQII 141
           + I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   E +A+R   QI+
Sbjct: 96  LSILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQIL 155

Query: 142 IGISYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMAA-LETEDKLLETSCGSPHYA 197
             + Y H+  IVHRDLKPENLL         + + DFG+A  L+ +D+L+  + GS  Y 
Sbjct: 156 KAVEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGYV 215

Query: 198 APEII--SGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----FE 251
           APE++  SG   HG   D+WS G++ + LL G  PF  E  ++   L +   G+    F 
Sbjct: 216 APEVVTTSG---HGKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTIGRTPVTFH 270

Query: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLP 305
            P    IS EA+D I + LTV+P  R    E+L+   +      K +KT   LP
Sbjct: 271 KPYWSNISNEAKDFILRALTVNPHDRPTATELLQDAWIIS----KTTKTANLLP 320

>NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON}
           Anc_1.374
          Length = 422

 Score =  157 bits (396), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 100/300 (33%), Positives = 156/300 (52%), Gaps = 27/300 (9%)

Query: 22  LGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIERE 81
            G+TLG G+ G V+ A   S+ +  A+K++ K              L   D     +  E
Sbjct: 40  FGKTLGAGTFGVVRQARQLSSQEDVAVKILLK------------NALKGNDVQLQMLYDE 87

Query: 82  IIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQII 141
           + I++ L+HPN++   D +E+    Y+V + A  GELF+ ++++G   E +A+    Q++
Sbjct: 88  LSILQRLHHPNIVAFKDWFESRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQLL 147

Query: 142 IGISYCHALGIVHRDLKPENLL-LD--HKYNIKIADFGMAA-LETEDKLLETSCGSPHYA 197
             + Y H+  IVHRDLKPEN+L LD   +  + IADFG+A  L++ D L+    GS  Y 
Sbjct: 148 DAVKYIHSQNIVHRDLKPENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYV 207

Query: 198 APEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPGN 255
           APE+++    HG   D+WS G+I + LL+G  PF  E  +G +          QF  P  
Sbjct: 208 APEVLTK-EGHGKPCDIWSLGVITYTLLSGYSPFIAESVEGFLEECTRSRYPVQFHKPYW 266

Query: 256 DEISREAQDLISKILTVDPKKRIKTREILKHPLVQK--------YPSIKDSKTIRNLPRE 307
           D IS EA+D I K LT+DP++R    E++  P +           P +K   T+R   R+
Sbjct: 267 DSISDEAKDFILKALTIDPEERPSAEELMNDPWITSKHINTTNILPDVKKGFTLRKKLRD 326

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score =  163 bits (413), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 115/187 (61%), Gaps = 4/187 (2%)

Query: 105 NLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL 164
           + YM+ EY   G+L + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++
Sbjct: 7   HFYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMI 66

Query: 165 DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFAL 224
                IKI DFG++ +    K L T CGS ++AAPE++   PY G E DVWS G++LF L
Sbjct: 67  STSGEIKIIDFGLSNMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLFVL 126

Query: 225 LTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREIL 284
           + G++PFD+E+ ++  L  K++ G+ E P    +S E   L+SK+L VDP KR   ++++
Sbjct: 127 VCGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPTKRASLKQVV 182

Query: 285 KHPLVQK 291
            H  +Q+
Sbjct: 183 NHQWMQR 189

>TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {ON}
           Anc_1.374 YFR014C
          Length = 429

 Score =  157 bits (396), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 89/274 (32%), Positives = 145/274 (52%), Gaps = 19/274 (6%)

Query: 22  LGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIERE 81
            G+TLG GS G V+ A   STG+  A+K++ K                        +  E
Sbjct: 40  FGKTLGAGSFGVVRQARRISTGEDVAVKILLKKALQGNEVHLQM------------LYDE 87

Query: 82  IIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQII 141
           + I++ L+HP+++   D +E+    Y+V + A  GELF+ ++ RG   EN+A++   Q++
Sbjct: 88  LSILQRLHHPHIVAFKDWFESKDKFYIVTQLATGGELFDRILARGKFTENDAVKIIYQLL 147

Query: 142 IGISYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMA-ALETEDKLLETSCGSPHYA 197
             + Y H+  +VHRDLKPEN+L        ++ IADFG+A  L+  D ++  + GS  Y 
Sbjct: 148 DAVKYIHSQNVVHRDLKPENILYVNNSDNSDLVIADFGIAKQLKNNDDMIFKAAGSLGYV 207

Query: 198 APEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPGN 255
           APE+++ +  HG   D+WS G+I + LL+G   F  E  +G +           F  P  
Sbjct: 208 APEVLT-VNGHGKACDIWSLGVITYTLLSGYSAFIAESVEGFLEECTSSTYPVTFHRPYW 266

Query: 256 DEISREAQDLISKILTVDPKKRIKTREILKHPLV 289
           D+IS EA+  I   LT++P++R    ++L HP +
Sbjct: 267 DKISDEAKKFILSALTIEPEERPTAEQLLSHPWI 300

>CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa]
           {ON} highly similar to uniprot|P22216 Saccharomyces
           cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase
          Length = 767

 Score =  162 bits (410), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 96/297 (32%), Positives = 154/297 (51%), Gaps = 38/297 (12%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A   +TG+  A+K+I+K                       G+ RE+ 
Sbjct: 192 EVVGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMD---------------GVSRELE 236

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           +++ LNHP ++ L   +E ++N YMV+E+   G+L + +   G + E       RQI+  
Sbjct: 237 VLQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILEA 296

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           I Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++    +++T CG+  Y APE+
Sbjct: 297 IQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSIMKTFCGTLAYVAPEV 356

Query: 202 ISGLP--------------YHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLL-KVQ 246
           I G                Y  L  D+WS G ++F +LTG LPF    G+ +  L  +++
Sbjct: 357 IGGFTGATGEEETEEERIEYSSL-VDMWSMGCLVFVILTGHLPF---SGSTQEQLYEQIR 412

Query: 247 SGQF-EMPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTI 301
            G + E P  D  IS EA+D I  +L VD  KR+   + L HP +++  S  D+ ++
Sbjct: 413 KGSYHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIKQCSSQFDANSM 469

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score =  162 bits (411), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 95/293 (32%), Positives = 151/293 (51%), Gaps = 37/293 (12%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A   +TG+  A+K+ISK                       G+ RE+ 
Sbjct: 202 EVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMD---------------GVTRELE 246

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           +++ L+HP ++RL   +E   + YMV+E+   G+L + +   G + E+      RQI+  
Sbjct: 247 VLQKLHHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILEA 306

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE+
Sbjct: 307 VKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEV 366

Query: 202 ISGL-------------PYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQS 247
           I G               Y  L  D+WS G +++ +LTG LPF    G+ ++ L K +  
Sbjct: 367 IRGKDSSVSPDEYEERNEYSSL-VDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGR 422

Query: 248 GQF-EMPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDS 298
           G + E P  D  IS EA+D I  +L VDP  R+   + L HP ++  P +  S
Sbjct: 423 GSYHEGPLKDFRISEEARDFIDSLLQVDPNNRLTAAKALCHPWIKMNPLVSQS 475

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score =  161 bits (408), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 131/209 (62%), Gaps = 6/209 (2%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-Q 139
           EI I K + HPN+++  D +E D+N+Y++LE    G L +LL +R  L E E +RFF  Q
Sbjct: 120 EIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQ 178

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 198
           I+  I Y H+  I+HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 179 IVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIA 238

Query: 199 PEIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           PE+++G    H  E D+WS G++++ALL G+ PF  ++ N   +  +++   F  P +  
Sbjct: 239 PEVLTGKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFSFPKDKP 296

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKH 286
           IS EA+ LI  IL++DP +R    EI+++
Sbjct: 297 ISSEAKVLIKDILSLDPLERPSLAEIMEY 325

>Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C
           (REAL)
          Length = 446

 Score =  156 bits (395), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 88/278 (31%), Positives = 151/278 (54%), Gaps = 23/278 (8%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           +  G+TLG G+ G V+ A N+ TG+  A+K++ K                        + 
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGNKIQLE------------ALY 84

Query: 80  REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 139
            E+ I++ L+HPN++   D +E+    Y++ + A+ GELF+ ++++G   E +A+R   +
Sbjct: 85  DELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVE 144

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEDKLLETSCGSPH 195
           I+  + Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++++L+    GS  
Sbjct: 145 ILSAVKYMHSQNIVHRDLKPENLLYVDKSDESPLVVADFGIAKRLKSDEELIYKPAGSLG 204

Query: 196 YAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQ----FE 251
           Y APE+++    HG   D+WS G+I + LL G   F  E   +++ L +  +G+    F 
Sbjct: 205 YVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFKAE--RVQDFLDECTTGEHPVRFH 261

Query: 252 MPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLV 289
            P  D +S +A+  I K L +DP +R    ++L  P +
Sbjct: 262 RPYWDSVSGKAKQFILKALNLDPAERPTAAQLLDDPWI 299

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score =  162 bits (409), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 85/209 (40%), Positives = 131/209 (62%), Gaps = 6/209 (2%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-Q 139
           EI I K + HPN+++  D +E D+N+Y++LE    G L +LL +R  L E E +RFF  Q
Sbjct: 120 EIQIHKSMRHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQ 178

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 198
           I+  I Y H+  I+HRDLK  N+  D  +N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 179 IVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIA 238

Query: 199 PEIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           PE+++G    H  E DVWS G++++ALL G+ PF  ++ N   +  +++   F  P +  
Sbjct: 239 PEVLTGKHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFNFPRDKP 296

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKH 286
           IS EA+ LI  IL++DP +R    EI+++
Sbjct: 297 ISSEAKVLIKDILSLDPLERPSLTEIMEY 325

>KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON} 
          Length = 820

 Score =  162 bits (410), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 88/284 (30%), Positives = 149/284 (52%), Gaps = 34/284 (11%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A  ++TG+  A+K+I+K                       G+ RE+ 
Sbjct: 206 EVVGQGAFATVKKAIETATGRTYAVKIINKRKVMGNLD---------------GVTRELT 250

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           +++ L+HP+++ L   +E   N YMV+E+   G+L + +   GP+ E+      RQI+  
Sbjct: 251 VLQKLDHPSIVTLKGFYEDKDNYYMVMEFVSGGDLMDFVAAHGPVGEDAGREITRQILEA 310

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     + T CG+  Y APE+
Sbjct: 311 VKYIHSVGISHRDLKPDNILIKQDDPVLVKITDFGLAKMQEHGAFMNTFCGTLAYVAPEV 370

Query: 202 ISG--------LP-----YHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSG 248
           ++G        +P     ++    D+WS G +++ +LTG LPF       + L  ++   
Sbjct: 371 VNGRQQTSEPAVPKGERSHYSSLVDMWSMGCLVYVILTGHLPF--SGSTPQQLYEQIGKA 428

Query: 249 QF-EMPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
            + E+P  D  IS +A+D I  +L VDP  R+     L+HP +Q
Sbjct: 429 SYHEVPLKDCRISDQARDFIDCLLQVDPNNRLSAARALEHPWIQ 472

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score =  162 bits (410), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 148/280 (52%), Gaps = 32/280 (11%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A    TG+  A+K+I+K                       G+ RE+ 
Sbjct: 192 EVVGQGAFATVKKAIERRTGKTHAVKIINKRKVMGNMD---------------GVTRELE 236

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           +++ LNHP ++ L   +E   + Y+V+E+   G+L + +   G + E+      RQ++  
Sbjct: 237 VLRRLNHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEA 296

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           + Y HA+GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE+
Sbjct: 297 VKYIHAMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPEV 356

Query: 202 ISGL--------PYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF-E 251
           ISG          Y  L  D+WS G +++ +LTG LPF    G+ +  L K + +G + E
Sbjct: 357 ISGKNSEEKEGNKYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQQELYKQISAGSYHE 412

Query: 252 MPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
            P  D  IS +A+D I   L V+P+ R+   + LKHP ++
Sbjct: 413 GPLKDYRISDDARDFIESFLQVNPRDRMTAEQALKHPWIR 452

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score =  162 bits (410), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 149/282 (52%), Gaps = 34/282 (12%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A    TG+  A+K+ISK                       G+ RE+ 
Sbjct: 192 EVVGQGAFAIVKKAVERKTGKTFAVKIISKRKVMGNID---------------GVTRELE 236

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           +++ LNHP ++RL   +E D + Y+++E+   G+L + +   G + E+      +Q++  
Sbjct: 237 VLRRLNHPRIVRLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITKQVLEA 296

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           + Y H +GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE+
Sbjct: 297 VKYIHGMGISHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEV 356

Query: 202 ISGL----------PYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF 250
           ISG            Y  L  D+WS G +++ +LTG LPF    G+ ++ L K +  G +
Sbjct: 357 ISGKNSEDKSQNKNKYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQDQLYKQISRGSY 412

Query: 251 -EMPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
            E P  D  IS EA++ I  +L V+PK R+   + L HP ++
Sbjct: 413 HEGPLKDFRISDEARNFIDSLLQVNPKDRLTAEKALDHPWIK 454

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score =  162 bits (409), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 92/280 (32%), Positives = 149/280 (53%), Gaps = 32/280 (11%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A    TG+  A+K+ISK                       G+ RE+ 
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISKRKVVGVMD---------------GVARELE 236

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           +++ L+HP ++ L   +E   + Y+V+E+   G+L + +   G + E+      RQI+  
Sbjct: 237 VLQRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEA 296

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE+
Sbjct: 297 VKYIHSMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEV 356

Query: 202 ISGL--------PYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF-E 251
           ISG          Y  L  D+WS G +++ +LTG LPF    G+ +N L K + +G + E
Sbjct: 357 ISGKNSGEKEGNTYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQNDLYKQITAGSYHE 412

Query: 252 MPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
            P  D  IS +A+D I   L VDP+ R+   + L+HP ++
Sbjct: 413 GPLKDYRISDDARDFIESFLQVDPRNRMTAEQALRHPWIK 452

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score =  162 bits (411), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 148/288 (51%), Gaps = 39/288 (13%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A   STG+  A+K+ISK                       G+ RE+ 
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGSNMD--------------GVSRELE 251

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           +++ L+HP ++RL   +E   N YM++E+   G+L + +   G + E+      RQI+  
Sbjct: 252 VLQRLDHPRIVRLKGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAGREISRQILEA 311

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           I Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APEI
Sbjct: 312 IKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQDNGTFMKTFCGTLAYVAPEI 371

Query: 202 ISGL----------------PYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK- 244
           ISG                  Y  L  D+WS G +++ +LTG LPF    G+ +  L K 
Sbjct: 372 ISGKNDGELRENADANSERNEYSSL-VDMWSMGCLVYVILTGHLPF---SGSTQKQLYKQ 427

Query: 245 VQSGQF-EMPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
           +  G + E P  D  IS EA+D I  +L V P  R+   + L+HP ++
Sbjct: 428 ISRGSYHEGPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIK 475

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  161 bits (407), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 136/242 (56%), Gaps = 13/242 (5%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-Q 139
           EI I K + HPN+++  D +E DSN+Y++LE    G L  LL  R  L E E +RFF  Q
Sbjct: 129 EIQIHKSMAHPNIVQFVDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQ 187

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEDKLLETSCGSPHYAA 198
           I   I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 199 PEIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           PE++ G    H  E D+WS G++L+ALL G+ PF   D N   +  +++   F  P +  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKP 305

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKHPLVQKY--PSI-----KDSKTIRNLPREDTY 310
           IS E + LI  IL++DP +R    EI+ +   +    PSI      ++    N+P E + 
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEASNFDNIPEEQSL 365

Query: 311 LN 312
           +N
Sbjct: 366 IN 367

>NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON} 
          Length = 458

 Score =  156 bits (395), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 156/288 (54%), Gaps = 23/288 (7%)

Query: 8   PSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXX 67
           PSL  K +    ++ G+TLG GS G V+ A   S+ ++ A+K++ K              
Sbjct: 23  PSLVTKKD----YEFGKTLGAGSFGIVRQAKRISSNEEVAVKILLKQALRENAIQLRM-- 76

Query: 68  LLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGP 127
                     + +E+ I+K L+H N++   + +ETD  LY+V + A  GELF+ ++  G 
Sbjct: 77  ----------LYQELSILKKLHHRNIVEFKNWFETDDKLYIVTQLATGGELFDRIIMEGK 126

Query: 128 LPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMAA-LETE 183
             E++A++   QI+  + Y H+  IVHRDLKPENLL    +    + IADFG+A  L++ 
Sbjct: 127 FTEDDAVKIIVQILSAVEYIHSKNIVHRDLKPENLLYLTKEKDSQLVIADFGIAKELKSG 186

Query: 184 DKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEE--DGNIRNL 241
           ++L+  + GS  Y APE+++ +  HG   D+WS G+I + LL G   F  E  +G +   
Sbjct: 187 EELIFKAAGSLGYVAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSAFKAETVEGFLDEC 245

Query: 242 LLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLV 289
           +   Q  QF+ P  D IS+ A++ I K L + P++R    E+LK   +
Sbjct: 246 IANDQPVQFQKPYWDNISQSAKNFILKCLDLTPEQRPTATELLKEDWI 293

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score =  161 bits (408), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 89/237 (37%), Positives = 136/237 (57%), Gaps = 7/237 (2%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-Q 139
           EI I K + H N+++  D +E   N+Y++L     G L  LL +R  L E E +RFF  Q
Sbjct: 189 EIQIHKSMKHQNIVQFVDCFEDHINVYILLGMCPNGSLMELLKKRKILTEPE-VRFFTVQ 247

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 198
           I   I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 248 ICGAIKYMHSRRVIHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 307

Query: 199 PEIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           PE++ G    H  E D+WS G+++FALL G+ PF  +D N   +  ++++ ++  P N  
Sbjct: 308 PEVLLGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVN--TIYSRIKNSEYTFPINKS 365

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKHPLVQ-KYPSIKDSKTIRNLPREDTYLNP 313
           IS+EA+ LI  IL  DP  R    EI+++   +  +PS+  +     +P  D +L P
Sbjct: 366 ISQEAKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMTSNTVFTEIPEYDQFLTP 422

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score =  161 bits (408), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 93/282 (32%), Positives = 150/282 (53%), Gaps = 34/282 (12%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A   STG+  A K+ISK                       G+ RE+ 
Sbjct: 197 EVVGQGAFATVKKAVERSTGKTFAAKIISKRKVMGNMD---------------GVTRELE 241

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           +++ LNHP ++RL   +E D   Y+++E+   G+L + +   G + E+      RQ++ G
Sbjct: 242 VLRKLNHPKIVRLKGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEG 301

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           + Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE+
Sbjct: 302 VKYIHSQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEV 361

Query: 202 ISGLP----------YHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF 250
           I+G            Y  L  D+WS G +++ +LTG LPF    G+ +  L K +++G +
Sbjct: 362 IAGKANAEENEKRNEYSSL-VDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQIKNGSY 417

Query: 251 -EMPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
            E P  D  IS EA+D I  +L V+P  R   ++ L+HP ++
Sbjct: 418 HEGPLKDFRISDEARDFIDSLLQVNPNARPTAKKALEHPWIK 459

>CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016c CMK2
           Ca2+/calmodulin-dependent ser/thr protein kinase type II
          Length = 442

 Score =  155 bits (392), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 105/320 (32%), Positives = 160/320 (50%), Gaps = 32/320 (10%)

Query: 3   KLTNKPSLEV-KGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXX 61
           KL  +P   V K N V     G+TLG G+ G V+ A  S T +  A+K++ K        
Sbjct: 31  KLNGQPESYVSKSNYV----FGKTLGAGTFGVVRQARYSPTNEDVAVKILLK-------- 78

Query: 62  XXXXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNL 121
                 L   D     +  E+ I+++L HPN++   D +E+    Y+V + A  GELF+ 
Sbjct: 79  ----KALKGNDVQLQMLYDELSILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDR 134

Query: 122 LVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMA 178
           ++ +G   E +A+    QI+  + Y H+  +VHRDLKPEN+L   K +   + IADFG+A
Sbjct: 135 ILAKGKFTERDAVSITMQILSAVDYMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIA 194

Query: 179 -ALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEE--D 235
             L+  D L+  + GS  Y APE+++    HG   D+WS G+I++ LL G   F  E  D
Sbjct: 195 KQLQDNDDLIFKAAGSLGYVAPEVLTN-NGHGKPCDIWSIGVIVYTLLCGYSAFVAETVD 253

Query: 236 GNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK---- 291
           G +           F  P  D IS EA++ I + LT+DP +R    E++K P +      
Sbjct: 254 GFLEECTQNKYPVTFHKPYWDNISDEAKNFILRALTLDPAERPTAAELMKDPWITNTRPE 313

Query: 292 ----YPSIKDSKTIRNLPRE 307
               YP I+    +R   R+
Sbjct: 314 TANIYPEIRKGFDLRKKLRD 333

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  160 bits (404), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 90/235 (38%), Positives = 136/235 (57%), Gaps = 7/235 (2%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-Q 139
           EI I K + H NV++  D +E D+N+Y++LE    G L +LL +R  L E E +RFF  Q
Sbjct: 129 EIQIHKSMKHQNVVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKLLTEPE-VRFFTTQ 187

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 198
           I   I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 247

Query: 199 PEIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           PE++ G    H  E D+WS G++L+ALL G+ PF  +D N   +  +++   F  P    
Sbjct: 248 PEVLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFSFPKEKH 305

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKHPLVQK-YPSIKDSKTIRNLPREDTYL 311
           IS EA+ LI  +L++DP +R    EI+ +   +  +P   +S  +  +P  D  L
Sbjct: 306 ISNEAKVLIQDLLSLDPLERPSISEIMDYVWFRGIFPPYIESTVMTEVPNYDKTL 360

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  160 bits (404), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 124/209 (59%), Gaps = 6/209 (2%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-Q 139
           EI I K ++HPN+++  D +E DSN+Y++LE    G L  LL  R  L E E +RFF  Q
Sbjct: 129 EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQ 187

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEDKLLETSCGSPHYAA 198
           I   I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 199 PEIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           PE++ G    H  E D+WS G++L+ALL G+ PF   D N   +  +++   F  P +  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKP 305

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKH 286
           IS E + LI  IL++DP +R    EI+ +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDY 334

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score =  153 bits (386), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 90/284 (31%), Positives = 147/284 (51%), Gaps = 21/284 (7%)

Query: 8   PSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXX 67
           P +++K N    +++G  LG G  GKV    +  +G   A+KV++K              
Sbjct: 109 PMVDLKLND---FEIGRKLGKGKFGKVYCVRHKPSGLICALKVMNKMEIVNFNVQKQ--- 162

Query: 68  LLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGP 127
                      +REI I   LNH N+ +LY  +    N+Y+V+EY   GEL+ LL + GP
Sbjct: 163 ----------FKREIDIQYHLNHKNLTKLYAFFHDSKNVYLVMEYLIGGELYKLLKKNGP 212

Query: 128 LPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLL 187
           + +  A  +  Q+   ++Y H   I+HRDLKPEN+L+     IK+ DFG +     ++  
Sbjct: 213 MNDITASNYVYQMTDALNYMHKRKIIHRDLKPENILIGFNNQIKLTDFGWSIYNPNNQKR 272

Query: 188 ETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQS 247
           +T CG+  Y +PE+IS   Y     DVW+ GI+ + L+ G  PF+E+         ++  
Sbjct: 273 KTLCGTIDYLSPELISSREYDE-NVDVWALGILTYELVVGAPPFEEDTK--EQTYKRIAK 329

Query: 248 GQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
              + P N  +S EA+DLI+ +L V P +R   ++++ HP ++K
Sbjct: 330 SDLKFPPN--VSSEARDLITNLLKVVPSERFNLQQVMNHPWIEK 371

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  159 bits (403), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 123/209 (58%), Gaps = 6/209 (2%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-Q 139
           EI I K + HPN+++  D +E DSN+Y++LE    G L  LL  R  L E E +RFF  Q
Sbjct: 129 EIQIHKSMAHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLSEPE-VRFFTTQ 187

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEDKLLETSCGSPHYAA 198
           I   I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 199 PEIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           PE++ G    H  E D+WS G++L+ALL G+ PF   D N   +  +++   F  P +  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKP 305

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKH 286
           IS E + LI  IL++DP +R    EI+ +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDY 334

>AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL016C (CMK2) and
           YFR014C (CMK1)
          Length = 453

 Score =  155 bits (391), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 98/292 (33%), Positives = 155/292 (53%), Gaps = 32/292 (10%)

Query: 3   KLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXX 62
           K+T +P+  V       +  G+TLG G+ G V+ A NS   Q  AIK++ K         
Sbjct: 42  KVTGQPASYVNK---ADYIFGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQ 98

Query: 63  XXXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLL 122
                          +  E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ +
Sbjct: 99  M--------------LYDELSILQKLDHPNIVKFKDWFESREKFYIVTQLATGGELFDRI 144

Query: 123 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLL-LD--HKYNIKIADFGMA- 178
           +++G   E +A++   Q++  + Y H+  +VHRDLKPEN+L LD   +  + I+DFG+A 
Sbjct: 145 LKKGKFTETDAVKIVVQMLTAVEYMHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAK 204

Query: 179 ALETEDKLLETSCGSPHYAAPEII--SGLPYHGLETDVWSCGIILFALLTGRLPFDEEDG 236
            L +E +L+  + GS  Y APE++  SG   HG   D+WS G+I + LL G  PF  E  
Sbjct: 205 QLSSESQLIHRAAGSMGYVAPEVLTTSG---HGKPCDIWSLGVITYTLLCGYSPFIAE-- 259

Query: 237 NIRNLLLKVQSGQ----FEMPGNDEISREAQDLISKILTVDPKKRIKTREIL 284
           +    L +V SG     F  P  + IS+EA+  I + LT+ P +R    E+L
Sbjct: 260 STEGFLEEVFSGSDPVTFHSPYWNNISKEAKQFILRALTLTPARRPTAAELL 311

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 124/209 (59%), Gaps = 6/209 (2%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-Q 139
           EI I K ++HPN+++  D +E DSN+Y++LE    G L  LL  R  L E E +RFF  Q
Sbjct: 129 EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQ 187

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEDKLLETSCGSPHYAA 198
           I   I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 199 PEIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           PE++ G    H  E D+WS G++L+ALL G+ PF   D N   +  +++   F  P +  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPRDKP 305

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKH 286
           IS E + LI  IL++DP +R    EI+ +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDY 334

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/293 (34%), Positives = 156/293 (53%), Gaps = 21/293 (7%)

Query: 23  GETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREI 82
           G  LG G   +    +N  +G+  A K ++K              LL+          EI
Sbjct: 86  GHFLGEGGFARC-FQFNDDSGKIFAAKTVAKL---SIKSEKTRRKLLS----------EI 131

Query: 83  IIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-QII 141
            I K + + N+++  D +E D+N+Y++LE    G L +LL +R  L E E +RFF  QI 
Sbjct: 132 QIHKSMKNVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQIC 190

Query: 142 IGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAPE 200
             I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y APE
Sbjct: 191 GAIKYMHSRRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPE 250

Query: 201 IISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEIS 259
           ++ G    H  E D+WS G++L+ALL G+ PF  +D N   +  +++   F  P +  IS
Sbjct: 251 VLMGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFTFPKDKYIS 308

Query: 260 REAQDLISKILTVDPKKRIKTREILKHPLVQK-YPSIKDSKTIRNLPREDTYL 311
            EA+ LI  +L++DP +R    EI+ +   +  +P   +S  + N+P  D  L
Sbjct: 309 PEAKILIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTNIPNYDNQL 361

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 134/226 (59%), Gaps = 8/226 (3%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-Q 139
           EI I K + H N+++  D +E D+N+Y++LE    G L +LL +R  L E E +RFF  Q
Sbjct: 142 EIQIHKSMKHVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQ 200

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 198
           I   I Y H+  ++HRDLK  N+  D KYN+KI DFG+AA    D+  + T CG+P+Y A
Sbjct: 201 ICGAIKYMHSRKVIHRDLKLGNIFFDRKYNLKIGDFGLAATLANDRERKYTVCGTPNYIA 260

Query: 199 PEIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           PE++ G    H  E D+WS G++++AL+ GR PF  +D N   +  +++   F  P +  
Sbjct: 261 PEVLMGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVN--TIYERIKCRDFSFPKDKL 318

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKHPLVQKY--PSIKDSKTI 301
           IS EA+ LI  IL++DP +R    EI+ +   +    PS K+S  +
Sbjct: 319 ISSEAKILIQDILSLDPLERPSVNEIMDYIWFRGCFPPSTKESVMV 364

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score =  159 bits (403), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 146/282 (51%), Gaps = 33/282 (11%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A   +TG+  A+K+I+K                       G+ RE+ 
Sbjct: 191 EVVGQGAFATVKKAVERTTGKTYAVKIINKRKVMGNLD---------------GVTRELE 235

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           ++K LNHP ++ L   +E + + YMV+E+   G+L + +   G + E+      RQI+  
Sbjct: 236 VLKRLNHPRIVSLKGFYEDNESYYMVMEFVSGGDLMDFVAAHGAVGEDAGKEISRQILEA 295

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE+
Sbjct: 296 VKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEV 355

Query: 202 ISGLPYHGLE----------TDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF 250
           I     +  E           D+WS G +++ +LTG LPF    G+ +  L K +  G +
Sbjct: 356 IGSSSKYNEEDEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSY 412

Query: 251 -EMPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
            E P  D  IS EA+D I  +L VDP  R+     L+HP ++
Sbjct: 413 HEGPLKDYRISDEARDFIDSLLQVDPSNRLTAARALEHPWIK 454

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score =  154 bits (388), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 149/272 (54%), Gaps = 25/272 (9%)

Query: 22  LGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIERE 81
            G+TLG G+ G V+ A NS+  +  A+K++ K               L  D L   +  E
Sbjct: 56  FGKTLGAGAFGVVRQARNSNNDEDVAVKILLKRA-------------LKGDELNM-LYDE 101

Query: 82  IIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQII 141
           ++I++ L+HP++++  D +E+    Y+V + A  GELF+ ++++G   E +A++   Q++
Sbjct: 102 LMILQKLDHPHIVKFKDWFESKDKFYIVTQLATGGELFDRILKKGRFTETDAVKIVVQML 161

Query: 142 IGISYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMA-ALETEDKLLETSCGSPHYA 197
             I Y H+  +VHRDLKPEN+L         + I+DFG+A  L +ED L+  + GS  Y 
Sbjct: 162 EAIEYMHSKNVVHRDLKPENVLYLNPSDDSELVISDFGIAKQLSSEDHLIHRAAGSMGYV 221

Query: 198 APEII--SGLPYHGLETDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMP 253
           APE++  SG   HG   D+WS G+I + LL G  PF  E  +G +  +        F  P
Sbjct: 222 APEVLTTSG---HGKPCDIWSLGVITYTLLCGYSPFVAESSEGFLEEVTRSKYPVTFHKP 278

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILK 285
             + IS EA++ I K LT+DP +R    E+L+
Sbjct: 279 YWNSISVEAKEFILKALTLDPSERPTATELLQ 310

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score =  158 bits (400), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 89/242 (36%), Positives = 137/242 (56%), Gaps = 12/242 (4%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           EI I K + H NV++  D +E D+N+Y++LE    G L  LL +R  + E E   F  QI
Sbjct: 138 EIQIHKSMRHFNVVQFIDCFEDDTNVYILLEICPNGSLMELLKKRRTVTEPEVRYFMTQI 197

Query: 141 IIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 199
              I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y AP
Sbjct: 198 CGAIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 257

Query: 200 EIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEI 258
           E++ G    H  E D+WS G++++ALL G+ PF  +D N+  +  ++++  F  P +  I
Sbjct: 258 EVLMGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNM--IYERIKNRDFAFPKDKYI 315

Query: 259 SREAQDLISKILTVDPKKRIKTREILKHPLVQK-YPSIKDSKTIRNLPR-------EDTY 310
           S EA+ LI  IL+ DP +R    EI+ +   +  +PS   S  +   P        E++Y
Sbjct: 316 SNEAKTLIHDILSTDPLERPSIEEIIDYVWFRGIFPSCTLSTVMSEDPNYEQIISAEESY 375

Query: 311 LN 312
           +N
Sbjct: 376 IN 377

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score =  152 bits (383), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 76/214 (35%), Positives = 124/214 (57%), Gaps = 5/214 (2%)

Query: 78  IEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 137
             RE+ I   LNHPN+ +LY  +  D  +Y+++EY   GEL+ LL   GP  +  A RF 
Sbjct: 199 FRREVEIQTSLNHPNLTKLYGHFYDDKRVYLIMEYLVYGELYKLLRSHGPFNDIIASRFV 258

Query: 138 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 197
            QI   +++ H  GI+HRDLKPEN+L+     +K+ DFG + +  +    +T CG+  Y 
Sbjct: 259 YQIADALNHLHEKGIIHRDLKPENILIGFNNVLKLTDFGWSIINPKGVKRKTLCGTIDYL 318

Query: 198 APEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           +PE+I    Y     DVW+ G++ + L+ G  PF+E+   +     ++  G+   PG   
Sbjct: 319 SPEMIRSREYDD-TVDVWALGVLTYELVAGDPPFEEDSKEL--TYKRILKGEIRFPGT-- 373

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
           +S++ +DLIS++L  DPK+RI  +E++ HP + +
Sbjct: 374 VSQDVRDLISRLLKNDPKERILLKEVMVHPWIMR 407

>KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.374
           YFR014C
          Length = 435

 Score =  152 bits (384), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 103/320 (32%), Positives = 161/320 (50%), Gaps = 27/320 (8%)

Query: 11  EVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLT 70
           +V  N    +  G+TLG G+ G V+ A   ST +  A+K++ K                 
Sbjct: 23  KVASNAKTDYIFGKTLGAGTFGVVRQARKLSTNEDVAVKILLKKALEGNSVQLQM----- 77

Query: 71  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPE 130
                  +  E+ I++ LNHPN++   D +ET    ++V + A  GELF+ +V++G   E
Sbjct: 78  -------LYDELSILQRLNHPNIVEFKDWFETKEKFFIVTQLATGGELFDRIVKKGKFTE 130

Query: 131 NEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEDKL 186
            +AI+   QI+  + Y H+  IVHRDLKPENLL   + +   + +ADFG+A  L++ D+L
Sbjct: 131 EDAIKILVQILGAVEYIHSRNIVHRDLKPENLLYIDEADTSPLVLADFGIAKELKSGDEL 190

Query: 187 LETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLK 244
           +  + GS  Y APE+++    HG   D+WS G+I + LL G   F  E  +G +      
Sbjct: 191 IFKAAGSLGYVAPEVLTS-DGHGKPCDIWSIGVITYTLLCGYSAFAAESVEGFLDECTQN 249

Query: 245 VQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPL-----VQK---YPSIK 296
            +   F  P  D +S +A+  I + LT+DP KR     +L+ P      VQK    P++K
Sbjct: 250 DKPVVFHKPYWDNVSEDARKFILRALTLDPTKRPTATALLEDPWILGRNVQKNDLLPALK 309

Query: 297 DSKTIRNLPREDTYLNPLSD 316
                R   RE   L  L++
Sbjct: 310 KGFDARKKFREAVELVKLNN 329

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score =  157 bits (397), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 148/282 (52%), Gaps = 34/282 (12%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A   STG+  A+K+I+K                       G+ RE+ 
Sbjct: 197 EVVGQGAFAIVKKAVERSTGKTFAVKIINKRKVMGNMD---------------GVTRELD 241

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           +++ L+HP ++RL   +E + + Y+++E+   G+L + +   G + E+      RQI+  
Sbjct: 242 VLRKLDHPRIVRLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEA 301

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           + Y H  GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE+
Sbjct: 302 VKYIHLQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEV 361

Query: 202 ISG----------LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF 250
           I G          + Y  L  D+WS G +++ +LTG LPF    G+ ++ L K +  G +
Sbjct: 362 IGGKNSAEENEDRIEYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQDQLYKQICRGSY 417

Query: 251 -EMPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
            E P  D  IS EA+D I  +L V P KR+   + L HP ++
Sbjct: 418 HEGPLKDFRISDEARDFIDSLLQVSPNKRLTAIKALNHPWIK 459

>CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa]
           {ON} similar to uniprot|P27466 Saccharomyces cerevisiae
           YFR014c CMK1 Ca2+/calmodulin-dependent ser/thr protein
           kinase type I
          Length = 446

 Score =  152 bits (383), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 98/278 (35%), Positives = 148/278 (53%), Gaps = 20/278 (7%)

Query: 25  TLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREIII 84
           TLG GS G V+ A    + +  A+K++ K               L P      I  E+ I
Sbjct: 70  TLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGG-------LEP------IYDELNI 116

Query: 85  MKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 144
           ++ L+HPN+++  D +ET+S  Y+V + A  GELF+ ++  G   E +A+    QI+  +
Sbjct: 117 IQHLDHPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKAV 176

Query: 145 SYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMA-ALETEDKLLETSCGSPHYAAPE 200
            Y H+  I+HRDLKPENLL LD   +  I +ADFG+A  LE +D ++    GS  Y APE
Sbjct: 177 EYLHSQNIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPE 236

Query: 201 IISGLPYHGLETDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPGNDEI 258
           + +    HG  +D+WS G+I + LL G  PF  E  DG +  +       +F+ P  D I
Sbjct: 237 VFTS-DGHGKPSDIWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDGI 295

Query: 259 SREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIK 296
           S  A++ I +IL +DP  R    E+L  P +Q   S++
Sbjct: 296 SELAKNFILRILDLDPACRPSATELLNDPWIQSKCSLR 333

>TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa]
           {ON} Anc_1.374 YFR014C
          Length = 434

 Score =  151 bits (382), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 156/294 (53%), Gaps = 22/294 (7%)

Query: 3   KLTNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXX 62
           KL+ +PS  +  +    +  G+TLG GS G V+ A   ST +  A+K+I K         
Sbjct: 33  KLSGQPSSYINKSD---YVFGKTLGAGSFGVVRQAKKLSTDENVAVKIILK--------- 80

Query: 63  XXXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLL 122
                L   D     +  E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ +
Sbjct: 81  ---KALKGNDVQLQMLYDELSILQRLHHPNIVQFKDWFESKEKFYIVTQLATGGELFDRI 137

Query: 123 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMAA 179
           ++RG   E +A++   Q++  I Y H+  IVHRDLKPEN+L         + IADFG+A 
Sbjct: 138 LKRGKFTEVDAVKIIIQMLKAIEYIHSQNIVHRDLKPENVLYIDPSDDSQLVIADFGIAK 197

Query: 180 -LETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEE--DG 236
            L+  D L+  + GS  Y APE+++    HG   D+WS G+I + LL G   F  E  +G
Sbjct: 198 ELKDGDDLIFKAAGSLGYVAPEVLTT-NGHGKPCDIWSLGVITYTLLCGYSAFIAETVEG 256

Query: 237 NIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
            +      +   +F  P  + +SREA++ I K LT++P +R    E+L  P ++
Sbjct: 257 FLEECTSNIYPVKFHEPYWNNVSREAKEFILKALTLNPDERPTATELLNDPWIK 310

>TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {ON}
           Anc_8.676 YPL153C
          Length = 858

 Score =  157 bits (397), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 147/281 (52%), Gaps = 32/281 (11%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A   STG+  A+K+I+K                       G+ RE+ 
Sbjct: 201 EVVGQGAFATVKKAVERSTGRTFAVKIINKRKVMGNLS---------------GVTRELE 245

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           I++ L+HP ++RL   +E + + Y+V+E+   G+L + +   G + E+      RQI+  
Sbjct: 246 ILRKLDHPRIVRLKGFYEDEESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEA 305

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           ++Y H  GI HRD+KP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE+
Sbjct: 306 VAYMHEKGISHRDIKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEV 365

Query: 202 ISG----------LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQF- 250
           ISG          + Y  L  D+WS G +++ +LT  LPF       + L  ++  G + 
Sbjct: 366 ISGKNAATENDDRIEYSSL-VDMWSIGCLVYVILTAHLPF--SGSTQQELYEQINRGSYH 422

Query: 251 EMPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
           E P  D  +S EA+D I  ++ VDP  R+  ++ LKH  ++
Sbjct: 423 EGPLKDYRVSEEARDFIESLIQVDPNNRLTAKDALKHEWIK 463

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score =  156 bits (394), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 133/229 (58%), Gaps = 7/229 (3%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-Q 139
           EI I K + H N+++  D +E ++N+Y++LE    G L  LL +R  L E E +RFF  Q
Sbjct: 148 EIQIHKSMRHANIVQFIDCFEDETNVYILLEICPNGSLMELLKKRKTLTEPE-VRFFTTQ 206

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 198
           I  GI Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 207 ICGGIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 266

Query: 199 PEIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           PE++ G    H  E D+WS G++++ALL G+ PF  +D N   +  +++   F  P    
Sbjct: 267 PEVLMGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVN--TIYERIKCCDFVFPKEKY 324

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKHPLVQK-YPSIKDSKTIRNLP 305
           IS EA+ L+  +L++DP +R    E+L +   +  +P    S  +  +P
Sbjct: 325 ISSEARILVQDLLSLDPLERPSIMEVLDYVWFRGIFPPYIQSDVMTEVP 373

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score =  156 bits (395), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 86/229 (37%), Positives = 132/229 (57%), Gaps = 7/229 (3%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-Q 139
           EI I K + H N+++  D +E D+N+Y++LE    G L  LL +R  L E E +RFF  Q
Sbjct: 192 EIQIHKSMKHQNIVQFIDCFEDDTNVYILLEICPNGSLMELLKKRKQLTEPE-VRFFTTQ 250

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 198
           I   I Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 251 ICGAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKFTVCGTPNYIA 310

Query: 199 PEIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           PE++ G    H  E DVWS G++++ALL G+ PF  +D N   +  +++   F  P    
Sbjct: 311 PEVLMGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVN--TIYERIKCCDFIFPKEKP 368

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKHPLVQK-YPSIKDSKTIRNLP 305
           IS EA+ L+  +L++DP +R    EI+ +   +  +P    S  +  +P
Sbjct: 369 ISHEAKVLVQDLLSLDPLERPSISEIMDYVWFRGIFPPYIQSNVMTEVP 417

>KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.214
           YPL203W
          Length = 373

 Score =  149 bits (376), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 96/277 (34%), Positives = 147/277 (53%), Gaps = 25/277 (9%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           T+  +++  TLG GS G+V L  +   G+  AIKV+ K                T D   
Sbjct: 59  TLNDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIVKMKQIEH-----TND--- 110

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 135
              ER +  +KL+ HP ++R++  ++  +NL+MV++Y E GELF+LL +    P   A  
Sbjct: 111 ---ERRM--LKLVEHPFLIRMWGTFQDSNNLFMVMDYIEGGELFSLLRKSQRFPNPVAKF 165

Query: 136 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 195
           +  ++++ + Y H   I++RDLKPEN+LLD   +IKI DFG A   T   +  T CG+P 
Sbjct: 166 YAAEVVLALEYLHFNNIIYRDLKPENILLDRNGHIKITDFGFAKEVT--TVTWTLCGTPD 223

Query: 196 YAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGN 255
           Y APE+I+  PY+    D WS GI+++ +L G  PF   D        K+  G+   P  
Sbjct: 224 YIAPEVIATKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGRVTYPSF 280

Query: 256 DEISREAQDLISKILTVDPKKRI-----KTREILKHP 287
              + +  DL+SK++T D  +RI      T+EI  HP
Sbjct: 281 --FNSDVVDLLSKLITADLTRRIGNLQNGTQEIKSHP 315

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score =  156 bits (394), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 79/200 (39%), Positives = 126/200 (63%), Gaps = 6/200 (3%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFR-Q 139
           EI I K + H N+++  D +E D+N+Y++LE    G L +LL +R  L E E +RFF  Q
Sbjct: 142 EIQIHKSMKHSNIVQFIDCFEDDANVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQ 200

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAA 198
           I   I Y H+  I+HRDLK  N+  D  YN+K+ DFG+AA+   D+  + T CG+P+Y A
Sbjct: 201 ICGAIKYLHSRRIIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANDRERKYTVCGTPNYIA 260

Query: 199 PEIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           PE++ G    H  E D+WS G++++ALL G+ PF  +D N+  +  +++  ++  P +  
Sbjct: 261 PEVLMGKHSGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYERIKLCKYGYPKDKY 318

Query: 258 ISREAQDLISKILTVDPKKR 277
           +S+EA+ LI  IL+++P +R
Sbjct: 319 VSKEAEILIHDILSLNPLQR 338

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score =  149 bits (376), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 85/254 (33%), Positives = 135/254 (53%), Gaps = 26/254 (10%)

Query: 42  TGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIER----EIIIMKLLNHPNVLRLY 97
           TG   AIK++ K+                 + L Y + +    EI I   LNH N+ +LY
Sbjct: 148 TGFICAIKIMDKS-----------------EILTYNVTKQFRNEIEIQSNLNHENLTKLY 190

Query: 98  DVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDL 157
             +     +Y+++EY   GEL+++L + GP  +  A  F  Q+   I Y H   I+HRDL
Sbjct: 191 GFFHDSKRVYLIMEYIYNGELYSILKKNGPFNDIVASNFVFQLTNAIRYLHKKRIIHRDL 250

Query: 158 KPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSC 217
           KPEN+L+D    IKI DFG +         +T CG+  Y +PE+I+   Y GL  DVW+ 
Sbjct: 251 KPENILIDFNNVIKITDFGWSVYNEAGNKRKTLCGTIDYLSPELINSKEYDGL-IDVWAL 309

Query: 218 GIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKR 277
           GII + L+ G  PF+E+   +     ++++     P    +S++A++LIS +L ++P +R
Sbjct: 310 GIIAYELIVGTPPFEEDTKELT--YKRIKNCDLNFPA--HVSQDAKNLISSLLKLNPSER 365

Query: 278 IKTREILKHPLVQK 291
           I   ++LKHP + K
Sbjct: 366 ITLTDVLKHPWINK 379

>TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON}
           Anc_1.374 YFR014C
          Length = 444

 Score =  150 bits (379), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 92/288 (31%), Positives = 152/288 (52%), Gaps = 27/288 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           +  G+TLG G+ G V+ A   ST +  A+K++ K                        + 
Sbjct: 40  YVFGKTLGAGTFGVVRQARKISTRENVAVKILLKKALKGNDVQLQL------------LY 87

Query: 80  REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 139
            E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++ +G   E +A++   Q
Sbjct: 88  DELKILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILSKGKFTEIDAVKIVTQ 147

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEDKLLETSCGSPH 195
           I+  + Y H+  IVHRDLKPEN+L     +   + +ADFG+A  L++ D+L+  + GS  
Sbjct: 148 ILSAVQYIHSKNIVHRDLKPENILYIDPSDDSPLVLADFGIAKELKSGDELIFKAAGSLG 207

Query: 196 YAAPEII--SGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSG----Q 249
           Y APE++  SG   HG   D+WS G++ + LL+G  PF  E  ++   L +   G    +
Sbjct: 208 YVAPEVLTTSG---HGKPCDIWSLGVVTYTLLSGYSPFIAE--SVEGFLEECTEGSKPVK 262

Query: 250 FEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKD 297
           F  P  D IS +A++ I + L + P KR    E+L+ P +    S K+
Sbjct: 263 FHKPYWDGISDDAKNFILRALVLSPSKRPTATELLEDPWITCCTSCKN 310

>NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {ON}
           Anc_8.676
          Length = 799

 Score =  155 bits (393), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 92/280 (32%), Positives = 144/280 (51%), Gaps = 32/280 (11%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A   STG+  A+K+ISK                       G+ RE+ 
Sbjct: 199 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNME---------------GVSRELE 243

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           +++ L+HP ++RL   +E   + YMV+E+   G+L + +   G + E       RQI+  
Sbjct: 244 VLQQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILEA 303

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           + Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE+
Sbjct: 304 VKYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEV 363

Query: 202 ISGL--------PYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF-E 251
           I G          Y  L  D+WS G +++ +LTG LPF    G+ +  L K +  G + E
Sbjct: 364 IGGKGETNEERNEYSSL-VDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYHE 419

Query: 252 MPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
            P  D  IS EA+  I  +L V+P  R+     L+HP ++
Sbjct: 420 GPLKDFRISDEARSFIDSLLQVNPGNRLTAARALEHPWIK 459

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score =  155 bits (392), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 127/208 (61%), Gaps = 4/208 (1%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           EI I K ++H N+++  D +E + N+Y++LE    G L  L+ +R  + E E   F  QI
Sbjct: 128 EIQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQI 187

Query: 141 IIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 199
             GI Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   D+  + T CG+P+Y AP
Sbjct: 188 CGGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAP 247

Query: 200 EIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEI 258
           E++ G    H  E D+WS G++L+ALL G+ PF  +D N   +  +++   F  P + +I
Sbjct: 248 EVLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVN--TIYERIKQRNFAYPKDKKI 305

Query: 259 SREAQDLISKILTVDPKKRIKTREILKH 286
           S++A+ LI  IL+++P +R   +EI+ +
Sbjct: 306 SQDAKYLIDDILSLNPMERPSIQEIMDY 333

>TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {ON}
           Anc_8.676 YPL153C
          Length = 845

 Score =  156 bits (394), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 92/282 (32%), Positives = 149/282 (52%), Gaps = 34/282 (12%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A   STG+  A+K+ISK                       G+ RE+ 
Sbjct: 201 EVVGQGAFAIVKKAVERSTGKTFAVKIISKRKVMGNMD---------------GVTRELE 245

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           +++ L+HP ++RL   +E + + Y+++E+   G+L + +   G + E+      RQI+  
Sbjct: 246 VLRKLDHPRIVRLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEA 305

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           + Y H+  I HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APEI
Sbjct: 306 VKYIHSKCISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEI 365

Query: 202 ISG----------LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF 250
           ISG            Y  L  D+WS G +++ +LTG LPF    G+ +  L K V++G +
Sbjct: 366 ISGSNNLEENEERNEYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQVRNGSY 421

Query: 251 -EMPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
            E P  D  IS EA++ I  +L V+P  R+     L+HP ++
Sbjct: 422 HEGPLKDFRISDEARNFIDSLLQVNPNDRLSAERALQHPWIK 463

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score =  154 bits (390), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 84/231 (36%), Positives = 134/231 (58%), Gaps = 5/231 (2%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQI 140
           EI I K + HPN+++  D +E D+N+Y++LE    G +  LL +R  L E E      QI
Sbjct: 137 EIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQI 196

Query: 141 IIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 199
           I  I Y H+  ++HRDLK  N+  D +YN+KI DFG+AA+   DK  + T CG+P+Y AP
Sbjct: 197 IGAIRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAP 256

Query: 200 EIISG-LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEI 258
           E+++G    H  E D+WS G++L+ALL G+ PF  ++  +  +  +++   F  P +  +
Sbjct: 257 EVLTGKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKE--VETIYERIKCRDFIFPADKPV 314

Query: 259 SREAQDLISKILTVDPKKRIKTREILKHPLVQK-YPSIKDSKTIRNLPRED 308
           S +A++LIS +L ++P  R    EI  +   +  +PS   S   + +P  D
Sbjct: 315 SSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFPSRLPSTITKEIPNFD 365

>KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 353

 Score =  147 bits (371), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 90/254 (35%), Positives = 135/254 (53%), Gaps = 20/254 (7%)

Query: 25  TLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREIII 84
           TLG GS G+V L  +   G+  AIKV+ K                         ER   +
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTND-----------ERR--M 94

Query: 85  MKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 144
           +KL++HP ++R++  ++   NL+MV++Y E GELF+LL +    P   A  +  ++I+ +
Sbjct: 95  LKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILAL 154

Query: 145 SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISG 204
            Y HA  I++RDLKPEN+LLD   +IKI DFG A  +  D +  T CG+P Y APE+I+ 
Sbjct: 155 EYLHAHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIAT 212

Query: 205 LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQD 264
            PY+    D WS GI++F +L G  PF   D        K+  G+   P       +  D
Sbjct: 213 KPYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYP--PFFHPDVVD 267

Query: 265 LISKILTVDPKKRI 278
           L+SK++T D  +R+
Sbjct: 268 LLSKLITADLTRRL 281

>Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {ON}
           YOL016C (REAL)
          Length = 449

 Score =  149 bits (377), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 141/276 (51%), Gaps = 19/276 (6%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           +  G TLG GS G V+ A   ST +  AIK++ K                        + 
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQM------------LY 94

Query: 80  REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 139
            E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    Q
Sbjct: 95  EELSILQKLSHPNIVAFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQ 154

Query: 140 IIIGISYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMA-ALETEDKLLETSCGSPH 195
           I+  + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ ++ L+  + GS  
Sbjct: 155 ILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLG 214

Query: 196 YAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMP 253
           Y APE+++    HG   D+WS G+I + LL G  PF  E  +G +           F MP
Sbjct: 215 YVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTAYRYPVTFHMP 273

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILKHPLV 289
             D IS +A+  I K L +DP  R    E+L  P +
Sbjct: 274 YWDSISVDAKHFILKALRLDPADRPTATELLDDPWI 309

>TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {ON}
           Anc_6.214 YPL203W
          Length = 403

 Score =  148 bits (374), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 99/311 (31%), Positives = 159/311 (51%), Gaps = 29/311 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           +++  TLG GS G+V L  +   G+  AIKV+ K                T D      E
Sbjct: 93  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIIKMKQIEH-----TND------E 141

Query: 80  REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 139
           R +  +KL+ HP ++RL+  ++   NL+MV++Y E GELF+LL +    P   A  +  +
Sbjct: 142 RRM--LKLVEHPFIIRLWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAE 199

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAP 199
           +++ + Y HA  I++RDLKPEN+LLD   +IK+ADFG A  +    +  T CG+P Y AP
Sbjct: 200 VVLALEYLHANNIIYRDLKPENILLDRNGHIKVADFGFA--KEVSSVTWTLCGTPDYIAP 257

Query: 200 EIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEIS 259
           E+I+  PY+    D WS G++++ +L G  PF   D        K+  G+   P      
Sbjct: 258 EVIATKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDVTPMKTYEKILQGKINFPQG--FH 312

Query: 260 REAQDLISKILTVDPKKRI-----KTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPL 314
            +  DL+++++T D  KR+      +R++  HP   +   I +    R++  E  Y  P+
Sbjct: 313 PDVIDLLTRLITSDLTKRLGNLQNGSRDVKNHPWFSE--VIWEKLLARDI--ETPYEPPI 368

Query: 315 SDDNGDVCEID 325
           +   GD    D
Sbjct: 369 TAGVGDTSLFD 379

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score =  155 bits (391), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 98/361 (27%), Positives = 163/361 (45%), Gaps = 69/361 (19%)

Query: 17  VGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPY 76
           VG +++ + +G GS GKV LA +  T ++  +K                    T D    
Sbjct: 38  VGNYRILKQIGEGSFGKVYLALHRPTHRKVVLK--------------------TSDKNDP 77

Query: 77  GIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRF 136
            I RE+   +  ++P + ++Y++  T++ ++M LEY    EL++ L+    +P  E    
Sbjct: 78  NIVREVFYHRQFDYPYITKVYEIIVTETKVWMALEYCPGKELYDHLLFSKRIPIAECTEL 137

Query: 137 FRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHY 196
           F QI+  + Y H+L  VHRDLK EN+LLD     K+ DFG          LET CG+  Y
Sbjct: 138 FAQIVGAVYYAHSLNCVHRDLKLENILLDKHGRAKLTDFGFTRECMTRSTLETVCGTTVY 197

Query: 197 AAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGND 256
            APE+I    Y G + D+W+ G+IL+ ++ G +PFDE+D               E+    
Sbjct: 198 MAPELIERKSYDGFKIDIWALGVILYTMIYGAMPFDEDD---------------EVKTKW 242

Query: 257 EISREAQDLISKILTVD------------PKKRIKTREILKHPLVQKYPSIKDSKTIRNL 304
           +I  E  D  + I + D            P +R   REILKH  ++ Y      KT + +
Sbjct: 243 KIVNEDPDFTNNISSNDVKDLIKKLLKKDPTERPTIREILKHDFLKPYGFTILEKTDKII 302

Query: 305 PREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLD 364
            R+                      +N  + +H +  K + K+LK  G + +   ++++ 
Sbjct: 303 QRQ----------------------RNDSIHFHSKIEKRLLKRLKRSGFDTQSIKHSIMK 340

Query: 365 R 365
           +
Sbjct: 341 K 341

>CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} similar
           to uniprot|P39009 Saccharomyces cerevisiae YDL101c DUN1
           protein kinase
          Length = 506

 Score =  150 bits (378), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/311 (30%), Positives = 151/311 (48%), Gaps = 41/311 (13%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           + LG+ LG G    V+ A N +TG+  A+K+                            E
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFR------------E 240

Query: 80  REIIIMKLLNHPNVLRLYD-----VWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAI 134
              I+MK+ +HPN++ L D     + +T    Y+VLE  + GELF+ +V++  LP+ E+ 
Sbjct: 241 ETTILMKI-HHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEESK 299

Query: 135 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHK-------------------YNIKIADF 175
             F+QI+ G+ Y H+  I+HRD+KPEN+LL+ +                     +KIADF
Sbjct: 300 AIFKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADF 359

Query: 176 GMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEED 235
           G+A    E +   T CG+P Y APE++    Y   + D+WS G+IL+  L G  PF ++ 
Sbjct: 360 GLAKFTGEMQFTNTLCGTPSYVAPEVLVKKGYTS-KVDLWSAGVILYVCLCGFPPFSDQL 418

Query: 236 G--NIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYP 293
           G  +++  ++  +   F  P  DEI   A  LIS +L +DP+ R        HP +    
Sbjct: 419 GPPSLKEQIMSAKYA-FYSPYWDEIDDAALHLISNLLVLDPENRYDVDAAAAHPWLDSVS 477

Query: 294 SIKDSKTIRNL 304
            +  S  ++ L
Sbjct: 478 HLDVSHNLKRL 488

>Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {ON}
           YOL016C (REAL)
          Length = 452

 Score =  148 bits (374), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 92/276 (33%), Positives = 140/276 (50%), Gaps = 19/276 (6%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           +  G TLG GS G V+ A   ST +  AIK++ K                        + 
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNIQLQM------------LY 94

Query: 80  REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 139
            E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    Q
Sbjct: 95  EELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEIDAVEIIVQ 154

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMA-ALETEDKLLETSCGSPH 195
           I+  + Y H+  +VHRDLKPEN+L   K +   + IADFG+A  L+ ++ L+  + GS  
Sbjct: 155 ILGAVEYIHSKNVVHRDLKPENVLYVDKSDNSPLVIADFGIAKQLKGKEDLIYKAAGSLG 214

Query: 196 YAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMP 253
           Y APE+++    HG   D+WS G+I + LL G  PF  E  +G +           F MP
Sbjct: 215 YVAPEVLTQ-DGHGKPCDIWSVGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMP 273

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILKHPLV 289
             D IS +A+  I K L ++P  R    E+L  P +
Sbjct: 274 YWDNISVDAKRFILKALILNPADRPTATELLDDPWI 309

>Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  147 bits (371), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 154/306 (50%), Gaps = 29/306 (9%)

Query: 25  TLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREIII 84
           TLG GS G+V L  +   G+  A+KV+ K +                         E ++
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTND-------------ERLM 138

Query: 85  MKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 144
           + ++ HP ++R++  ++    ++M+++Y E GELF+LL +    P   A  +  ++ + +
Sbjct: 139 LSIVTHPFIIRMWGTFQDSQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLAL 198

Query: 145 SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISG 204
            Y H+  I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y APE++S 
Sbjct: 199 EYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVST 256

Query: 205 LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQD 264
            PY+    D WS GI+++ +L G  PF   D N      K+ + +   P     + + +D
Sbjct: 257 KPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFPPF--FNEDVKD 311

Query: 265 LISKILTVDPKKRI-----KTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPLSDDNG 319
           L+S+++T D  +R+      T ++  HP  ++   + +    RN+  E  Y  P+    G
Sbjct: 312 LLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE--VVWEKLLSRNI--ETPYEPPIQQGQG 367

Query: 320 DVCEID 325
           D  + D
Sbjct: 368 DTSQFD 373

>YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON}
           TPK1cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; inhibited by regulatory
           subunit Bcy1p in the absence of cAMP; partially
           redundant with Tpk2p and Tpk3p
          Length = 397

 Score =  147 bits (370), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 91/306 (29%), Positives = 156/306 (50%), Gaps = 29/306 (9%)

Query: 25  TLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREIII 84
           TLG GS G+V L  +   G+  A+KV+ K +              T D        E ++
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEH-----TND--------ERLM 138

Query: 85  MKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 144
           + ++ HP ++R++  ++    ++M+++Y E GELF+LL +    P   A  +  ++ + +
Sbjct: 139 LSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLAL 198

Query: 145 SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISG 204
            Y H+  I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y APE++S 
Sbjct: 199 EYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVST 256

Query: 205 LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQD 264
            PY+    D WS GI+++ +L G  PF   D N      K+ + +   P     + + +D
Sbjct: 257 KPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFPPF--FNEDVKD 311

Query: 265 LISKILTVDPKKRI-----KTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPLSDDNG 319
           L+S+++T D  +R+      T ++  HP  ++   + +    RN+  E  Y  P+    G
Sbjct: 312 LLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE--VVWEKLLSRNI--ETPYEPPIQQGQG 367

Query: 320 DVCEID 325
           D  + D
Sbjct: 368 DTSQFD 373

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score =  146 bits (369), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 120/214 (56%), Gaps = 5/214 (2%)

Query: 78  IEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 137
             RE+ I   L HPN+ RLY  +  +  +Y+++EY   GEL+  L   GP  +  A  F 
Sbjct: 168 FRREVEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFV 227

Query: 138 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 197
            Q+   ++Y H+  I+HRD+KPEN+LL  +  +K+ DFG +     +   +T CG+  Y 
Sbjct: 228 HQMADALNYMHSKNILHRDIKPENILLGFQNTLKLTDFGWSVSNVGNSKRKTLCGTMDYL 287

Query: 198 APEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           +PE+I    Y   + DVW+ G++ + LL G  PF+E+   +     ++       P  D+
Sbjct: 288 SPELIKSREYDN-KVDVWALGVLTYELLVGSPPFEEDTKEL--TYKRIIKRDLRFP--DQ 342

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
           +S  A+DLIS++L  DP+ RI  +++ +HP ++K
Sbjct: 343 VSPHARDLISRLLEYDPQNRIPLKDVKRHPWIKK 376

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  147 bits (371), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 81/273 (29%), Positives = 143/273 (52%), Gaps = 19/273 (6%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           +++G  LG G  GKV    +  +G  +A+KV+ K                         +
Sbjct: 175 FEIGRGLGKGKFGKVYCVKHKQSGFISALKVMKKKEIVSYNAEKQ-------------FK 221

Query: 80  REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVER-GPLPENEAIRFFR 138
           RE+ +   LNHPN+++++  ++ +  +Y+++EY   GEL+  L    GP  +  A  +  
Sbjct: 222 REVEVQNSLNHPNIVKIFGFFQDEIFVYLIMEYLINGELYKSLKNNNGPFNDILASNYIY 281

Query: 139 QIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAA 198
           QI   + Y H+  I+HRD+KPEN++L     IK+ADFG +     +   +T CG+  Y A
Sbjct: 282 QIADALKYMHSKHIIHRDIKPENIVLGFNNKIKLADFGWSICTPPNLRRKTICGTIDYLA 341

Query: 199 PEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEI 258
           PE+++   Y     D+W+ GI+ + L+ G  PF+EE  ++     ++ +     P    +
Sbjct: 342 PELVTFKEY-DYNVDIWALGILTYELIVGNPPFEEETKDLT--YKRIINVDLNFP--QTV 396

Query: 259 SREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
           S +A+DLI+++L  DP KR+   +++KHP + K
Sbjct: 397 SMDARDLITRLLRFDPSKRMPLVDVMKHPWITK 429

>KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON} 
          Length = 395

 Score =  146 bits (368), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 94/279 (33%), Positives = 145/279 (51%), Gaps = 25/279 (8%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           T+  +++  TLG GS G+V L  +   G+  AIKV+ K                      
Sbjct: 80  TLNDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKTQVVRMKQIEHTND-------- 131

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 135
              ER +  +KL+ HP ++R++  ++   NL+MV++Y E GELF+LL +    P   A  
Sbjct: 132 ---ERRM--LKLVEHPFLIRMWGTFQDAHNLFMVMDYIEGGELFSLLRKSQRFPNPVAKF 186

Query: 136 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 195
           +  ++++ + Y H   I++RDLKPEN+LLD   +IKI DFG A  E E  +  T CG+P 
Sbjct: 187 YAAEVVLALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVES-VTWTLCGTPD 244

Query: 196 YAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGN 255
           Y APE+I+  PY+    D WS GI++F +L G  PF   D        K+  G+   P  
Sbjct: 245 YIAPEVIATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDSTPMKTYEKILQGKVIYP-- 299

Query: 256 DEISREAQDLISKILTVDPKKRI-----KTREILKHPLV 289
                +  DL+SK++T D  +RI      +++I +HP  
Sbjct: 300 PFFHPDVVDLLSKLITADLTRRIGNLQSGSQDIKQHPWF 338

>KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {ON}
           highly similar to uniprot|P05986 Saccharomyces
           cerevisiae YKL166C TPK3 and highly similar to
           uniprot|P06244 Saccharomyces cerevisiae YJL164C TPK1
          Length = 381

 Score =  145 bits (367), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 101/335 (30%), Positives = 166/335 (49%), Gaps = 35/335 (10%)

Query: 2   VKLTNKPSLEVKG-NTVGPWKLGE-----TLGLGSTGKVQLAYNSSTGQQAAIKVISKAV 55
           V+  N    E++G  T G + L +     TLG GS G+V L  ++  G+  A+KV+ K  
Sbjct: 47  VEAKNAQKTELQGRQTSGKYTLNDFHILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKRT 106

Query: 56  FXXXXXXXXXXXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEK 115
                         T D      ER +  + +++HP ++R++  ++    ++M+++Y E 
Sbjct: 107 IVKLKQVEH-----TND------ERRM--LSIVSHPFIIRMWGTFQDAEQVFMIMDYIEG 153

Query: 116 GELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADF 175
           GELF+LL +    P   A  +  ++ + + Y HA  I++RDLKPEN+LLD   ++KI DF
Sbjct: 154 GELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHAHEIIYRDLKPENVLLDKNGHVKITDF 213

Query: 176 GMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEED 235
           G A    +     T CG+P Y APE++S  PY+    D WS GI++F +L G  PF   D
Sbjct: 214 GFAKYVPDVTF--TLCGTPDYIAPEVVSTKPYNK-SVDWWSFGILIFEMLAGYTPF--YD 268

Query: 236 GNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRI-----KTREILKHPLVQ 290
            N       + + Q + P       + QDL+S+++T D  KR+      + ++  HP   
Sbjct: 269 SNTMKTYENILNAQLQFP--PFFHADVQDLLSQLITRDLSKRLGNLQNGSEDVKNHPWFS 326

Query: 291 KYPSIKDSKTIRNLPREDTYLNPLSDDNGDVCEID 325
           +   + +    RN+  E  Y  P+    GD  + D
Sbjct: 327 E--VVWEKLLCRNI--ETPYEPPVHAGQGDTSQYD 357

>YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON}
           CMK2Calmodulin-dependent protein kinase; may play a role
           in stress response, many CA++/calmodulan dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk1p and mammalian Cam Kinase
           II
          Length = 447

 Score =  147 bits (371), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 93/276 (33%), Positives = 140/276 (50%), Gaps = 19/276 (6%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           +  G TLG GS G V+ A   ST +  AIK++ K                        + 
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQM------------LY 94

Query: 80  REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 139
            E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    Q
Sbjct: 95  EELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQ 154

Query: 140 IIIGISYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMA-ALETEDKLLETSCGSPH 195
           I+  + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ E+ L+  + GS  
Sbjct: 155 ILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLG 214

Query: 196 YAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMP 253
           Y APE+++    HG   D+WS G+I + LL G  PF  E  +G +           F MP
Sbjct: 215 YVAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMP 273

Query: 254 GNDEISREAQDLISKILTVDPKKRIKTREILKHPLV 289
             D IS + +  I K L ++P  R    E+L  P +
Sbjct: 274 YWDNISIDVKRFILKALRLNPADRPTATELLDDPWI 309

>Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  145 bits (367), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 89/306 (29%), Positives = 154/306 (50%), Gaps = 29/306 (9%)

Query: 25  TLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREIII 84
           TLG GS G+V L  +   G+  A+KV+ K +                         E ++
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTND-------------ERLM 138

Query: 85  MKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 144
           + ++ HP ++R++  ++    ++M+++Y E GELF+LL +    P   A  +  ++ + +
Sbjct: 139 LSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLAL 198

Query: 145 SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISG 204
            Y H+  I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y APE++S 
Sbjct: 199 EYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVST 256

Query: 205 LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQD 264
            PY+    D WS GI+++ +L G  PF   D N      K+ + +   P     + + +D
Sbjct: 257 KPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFPPF--FNEDVKD 311

Query: 265 LISKILTVDPKKRI-----KTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPLSDDNG 319
           L+S+++T D  +R+      T ++  HP  ++   + +    RN+  E  Y  P+    G
Sbjct: 312 LLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE--VVWEKLLSRNI--ETPYEPPIQQGQG 367

Query: 320 DVCEID 325
           D  + D
Sbjct: 368 DTSQFD 373

>KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {ON}
           Anc_1.182 YJL164C
          Length = 424

 Score =  146 bits (369), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 90/311 (28%), Positives = 158/311 (50%), Gaps = 29/311 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           +++  TLG GS G+V L  ++  G+  A+K++ K +                        
Sbjct: 114 FQILRTLGTGSFGRVHLIRSNHNGRFYALKILKKRLIVKLKQVEHTND------------ 161

Query: 80  REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 139
            E +++ L++HP ++R++  ++   +LYMV++Y E GELF+LL +    P   A  +  +
Sbjct: 162 -ERLMLSLVSHPFIVRMWGTFQDSVHLYMVMDYVEGGELFSLLRKSQRFPNPVAKFYAAE 220

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAP 199
           + + + Y H+  I++RDLKPEN+LLD   +IK+ DFG A    +  +  T CG+P Y AP
Sbjct: 221 VCLSLEYLHSKDIIYRDLKPENILLDKNGHIKLTDFGFAKYVPD--VTYTLCGTPDYIAP 278

Query: 200 EIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEIS 259
           E++S  PY+    D WS GI+++ +L G  PF   D N       + + + + P      
Sbjct: 279 EVVSTKPYNK-SVDWWSFGILIYEMLAGHTPF--YDSNTVKTYENILNAKLKFPAF--FH 333

Query: 260 REAQDLISKILTVDPKKRI-----KTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPL 314
            + +DL+S+++T D   R+      + ++ +HP   +   I D    +N+  E  Y  P+
Sbjct: 334 PDVRDLLSQLITKDLSNRLGNLQNGSEDVKRHPWFSE--VIWDKLLSKNI--ETPYEPPI 389

Query: 315 SDDNGDVCEID 325
               GD  + D
Sbjct: 390 QQGQGDTSQFD 400

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score =  145 bits (365), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 121/214 (56%), Gaps = 5/214 (2%)

Query: 78  IEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 137
             RE+ I   LNH N+ +LY  +  D  +Y+++EY   GEL+ LL  +GPL +  A  + 
Sbjct: 154 FRREVEIQSSLNHQNLTKLYGYFHDDKRVYLLMEYLVNGELYKLLRAKGPLDDIFASHYV 213

Query: 138 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 197
            Q+   + Y H   I+HRD+KPEN+L+     +K+ DFG + +       +T CG+  Y 
Sbjct: 214 YQMADALDYMHQRNIIHRDVKPENILIGFDNTVKLTDFGWSIINPRGTKRKTMCGTLDYL 273

Query: 198 APEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           +PE+I+   Y   + DVW+ G++ F L+    PF+E+   + +   ++  G  + P  + 
Sbjct: 274 SPELIASKEYDD-KVDVWALGVLTFELVVNSPPFEEDSKELTS--KRIVRGDLKFP--NH 328

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
           IS +AQDLI+K+L  + K RI  RE+ +HP + K
Sbjct: 329 ISSDAQDLITKLLRHNSKDRISLREVKQHPWITK 362

>Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {ON}
           YPL203W (TPK2) - cAMP-dependent protein kinase catalytic
           subunit [contig 166] FULL
          Length = 353

 Score =  144 bits (363), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 88/254 (34%), Positives = 134/254 (52%), Gaps = 20/254 (7%)

Query: 25  TLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREIII 84
           TLG GS G+V L  +   G+  AIKV+ K                         ER   +
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTND-----------ERR--M 94

Query: 85  MKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 144
           +KL++HP ++R++  ++   NL+MV++Y E GELF+LL +    P   A  +  ++I+ +
Sbjct: 95  LKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILAL 154

Query: 145 SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISG 204
            Y H+  I++RDLKPEN+LLD   +IKI DFG A  +  D +  T CG+P Y APE+I+ 
Sbjct: 155 EYLHSHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIAT 212

Query: 205 LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQD 264
            PY+    D WS GI++F +L G  PF   D        K+  G+   P       +  D
Sbjct: 213 KPYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYP--PFFHPDVVD 267

Query: 265 LISKILTVDPKKRI 278
           L+ K++T D  +R+
Sbjct: 268 LLCKLITSDLTRRL 281

>Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}
           similar to Ashbya gossypii ACR142W
          Length = 872

 Score =  152 bits (384), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 90/282 (31%), Positives = 145/282 (51%), Gaps = 34/282 (12%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A    TG+  A+K+ISK                       G+ RE+ 
Sbjct: 194 EVVGQGAFATVKKAVERKTGKTFAVKIISKRKVMGNVE---------------GVTRELE 238

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           ++  LNHP ++ L   +E + + Y+++E+   G+L + +   G + E+      RQI+  
Sbjct: 239 VLHRLNHPRIVSLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEA 298

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           + Y H   I HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE+
Sbjct: 299 VKYIHQQEISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPEV 358

Query: 202 ISGLP----------YHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLL-KVQSGQF 250
           I G            Y  L  D+WS G +++ +LTG LPF    G+ +  L  ++  G +
Sbjct: 359 IDGKSLEEKSVNKNLYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQEQLYEQISRGSY 414

Query: 251 -EMPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
            E P  D +IS EA+D I  +L V+P+ R+   + LKHP +Q
Sbjct: 415 HEGPLKDFKISDEARDFIDALLQVNPRDRLTAAKALKHPWIQ 456

>Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {ON}
           YPL209C (REAL)
          Length = 367

 Score =  144 bits (364), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 84/257 (32%), Positives = 133/257 (51%), Gaps = 20/257 (7%)

Query: 34  VQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREIIIMKLLNHPNV 93
           V    + STG   A+KV+ K                   +L     RE+ I   LNHPN+
Sbjct: 118 VYCVRHKSTGYICALKVMEKEEIIRY-------------NLQRQFRREVEIQMSLNHPNL 164

Query: 94  LRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIV 153
            + Y  +  +  +Y+++EY   GE++ LL   GP  +  A  +  QI   + Y H   I+
Sbjct: 165 TKSYGYFHDEKRVYLLMEYLVNGEMYKLLRSHGPFNDILASDYIYQIANALDYMHKKNII 224

Query: 154 HRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISGLPY-HGLET 212
           HRD+KPEN+L+     IK+ DFG + +   +   +T CG+  Y +PE+I    Y H +  
Sbjct: 225 HRDIKPENILIGFNNTIKLTDFGWSIINPPESRRKTVCGTIDYLSPEMIESREYDHTI-- 282

Query: 213 DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTV 272
           D W+ GI+ F LLTG  PF+EE  +      ++ +   ++P N  +S++AQDLI K+L  
Sbjct: 283 DAWALGILAFELLTGAPPFEEEMKD--TTYKRIAALDIKIPSN--VSQDAQDLILKLLKY 338

Query: 273 DPKKRIKTREILKHPLV 289
           DPK R++  ++  HP +
Sbjct: 339 DPKDRMRLEDVKMHPWI 355

>SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {ON}
           similar to uniprot|P05986 Saccharomyces cerevisiae
           YKL166C TPK3 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 418

 Score =  146 bits (368), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 91/306 (29%), Positives = 154/306 (50%), Gaps = 29/306 (9%)

Query: 25  TLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREIII 84
           TLG GS G+V L  ++  G+  A+KV+ K                         ER +  
Sbjct: 113 TLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTND-----------ERRM-- 159

Query: 85  MKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 144
           + +++HP  +R++  ++    ++M+++Y E GELF+LL +    P   A  +  ++ + +
Sbjct: 160 LSVVSHPFTIRMWGTFQDAQQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLAL 219

Query: 145 SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISG 204
            Y H++ I++RDLKPEN+LLD   +IK+ DFG A    +  +  T CG+P Y APE++S 
Sbjct: 220 EYLHSMDIIYRDLKPENILLDKNGHIKLTDFGFAKYVPD--VTYTLCGTPDYIAPEVVST 277

Query: 205 LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQD 264
            PY+    D WS GI++F +L G  PF   D N       + + + + P       +AQD
Sbjct: 278 KPYNK-SVDWWSFGILIFEMLAGYTPF--YDSNTMKTYENILNAELQFP--SIFHPDAQD 332

Query: 265 LISKILTVDPKKRI-----KTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPLSDDNG 319
           L+ +++T D  KR+      + ++ +HP   +   + D    RN+  E  Y  P+    G
Sbjct: 333 LLCRLITRDLSKRLGNLQNGSEDVKRHPWFSE--VVWDKLLCRNI--ETPYEPPIQPGQG 388

Query: 320 DVCEID 325
           D  + D
Sbjct: 389 DTSQFD 394

>Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C
           (REAL)
          Length = 394

 Score =  145 bits (366), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 90/308 (29%), Positives = 156/308 (50%), Gaps = 33/308 (10%)

Query: 25  TLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREIII 84
           TLG GS G+V L  +   G+  A+KV+ K +                         E ++
Sbjct: 89  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTND-------------ERLM 135

Query: 85  MKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 144
           + ++ HP ++R++  ++    ++M+++Y E GELF+LL +    P   A  +  ++ + +
Sbjct: 136 LSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLAL 195

Query: 145 SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISG 204
            Y H+  I++RDLKPEN+LLD   ++KI DFG A    +  +  T CG+P Y APE++S 
Sbjct: 196 EYLHSKDIIYRDLKPENILLDKNGHVKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVST 253

Query: 205 LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP--GNDEISREA 262
            PY+    D WS GI+++ +L G  PF   D N      K+ + +   P   ND++    
Sbjct: 254 KPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFPPFFNDDV---- 306

Query: 263 QDLISKILTVDPKKRI-----KTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPLSDD 317
           +DL+S+++T D  +R+      T ++  HP  ++   + +    RN+  E  Y  P+   
Sbjct: 307 KDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE--VVWEKLLSRNI--ETPYEPPIQQG 362

Query: 318 NGDVCEID 325
            GD  + D
Sbjct: 363 QGDTSQFD 370

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score =  152 bits (383), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 91/287 (31%), Positives = 147/287 (51%), Gaps = 34/287 (11%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A   +TG+  A+K+I+K                       G+ RE+ 
Sbjct: 221 EVVGQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVD---------------GVTRELE 265

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           +++ LNHP ++ L   +E D + Y+++E+   G+L + +   G + E+      RQI+  
Sbjct: 266 VLRRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEA 325

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           + Y H  GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE+
Sbjct: 326 VRYIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNTTFMKTFCGTLAYVAPEV 385

Query: 202 ISGL----------PYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK-VQSGQF 250
           I G            Y  L  D+WS G +++ +LTG LPF    G+ +  L K + +G +
Sbjct: 386 IGGKNPEGNGANGNLYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQIANGSY 441

Query: 251 -EMPGNDE-ISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSI 295
            E P  D  IS EA+D I  +L ++P  R+     L+HP +    SI
Sbjct: 442 HEGPLKDYWISDEARDFIDSLLQINPVDRLTAERALQHPWLHPCTSI 488

>ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 762

 Score =  151 bits (382), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 87/280 (31%), Positives = 143/280 (51%), Gaps = 31/280 (11%)

Query: 24  ETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREII 83
           E +G G+   V+ A   STG+  A K+ISK                       G++RE+ 
Sbjct: 190 EVVGQGAFAVVKKAVERSTGKTFAAKIISKRKLMGNWD---------------GVDRELA 234

Query: 84  IMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIG 143
           +++ L+HP ++RL   +E     Y+++E+   G+L + +   G + E+      RQ++  
Sbjct: 235 VLRKLHHPRIVRLKGFYEDKECYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEA 294

Query: 144 ISYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEI 201
           ++Y H+ GI HRDLKP+N+L+  D    +K+ DFG+A ++     ++T CG+  Y APE+
Sbjct: 295 VAYIHSRGISHRDLKPDNILIEQDDPVLVKVTDFGLAKVQGNGTFMKTFCGTLAYVAPEV 354

Query: 202 ISGL---------PYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQF-E 251
           I G           Y  L  D+WS G +++ +LTG LPF         L  ++  G + E
Sbjct: 355 IGGKNDNTEEEKNEYSSL-VDMWSMGCLVYVILTGHLPF--SGSTQEQLYEQISRGSYHE 411

Query: 252 MPGND-EISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290
            P  D  IS EA+D I  +L V+P  R    + L+HP ++
Sbjct: 412 GPLKDFRISDEARDFIDSLLQVNPNLRTTAEKALQHPWIR 451

>Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C
           (REAL)
          Length = 367

 Score =  144 bits (363), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 133/257 (51%), Gaps = 20/257 (7%)

Query: 34  VQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREIIIMKLLNHPNV 93
           V    + STG   A+KV+ K                   +L     RE+ I   LNHPN+
Sbjct: 118 VYCVRHRSTGFICALKVMEKEEIIKY-------------NLQRQFRREVEIQTSLNHPNL 164

Query: 94  LRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIV 153
            + Y  +  +  +Y+++EY   GE++ LL   GP  +  A  +  QI   + Y H   I+
Sbjct: 165 TKSYGYFHDEKRVYLLMEYLVNGEMYKLLRSHGPFNDILASDYVYQIANALDYMHKKNII 224

Query: 154 HRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISGLPY-HGLET 212
           HRD+KPEN+L+     IK+ DFG + +   D   +T CG+  Y +PE+I    Y H +  
Sbjct: 225 HRDIKPENILIGFNNIIKLTDFGWSIINPPDSRRKTVCGTIDYLSPEMIESREYDHTI-- 282

Query: 213 DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTV 272
           D W+ G++ F LLTG  PF+EE  +      ++ +   ++P N  IS++AQDLI K+L  
Sbjct: 283 DAWALGVLAFELLTGAPPFEEEMKD--TTYKRIAALDIKIPSN--ISQDAQDLILKLLKY 338

Query: 273 DPKKRIKTREILKHPLV 289
           DPK R++  ++  HP +
Sbjct: 339 DPKDRMRLEDVKMHPWI 355

>KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 398

 Score =  145 bits (365), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 117/214 (54%), Gaps = 5/214 (2%)

Query: 78  IEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 137
             RE+ I   L HPN+ RLY  +  +  +Y+++EY   GEL+  L   GP  +  A  F 
Sbjct: 185 FRREVEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDIVASHFV 244

Query: 138 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 197
            Q+   + Y H+  I+HRD+KPEN+LL  +  +K+ DFG +     +    T CG+  Y 
Sbjct: 245 YQMADALDYMHSKHIIHRDIKPENILLGFQNTLKLTDFGWSVTNLNNSRRRTLCGTMDYL 304

Query: 198 APEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           +PE+I    Y   + DVW+ G++ + LL G  PF E+   +    +K +  +F     D 
Sbjct: 305 SPELIKSREYDN-KVDVWALGVLTYELLVGTPPFLEDSKEMTYKRIKRRDLKFP----DH 359

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
           IS +A+D+ISK+L  +P  RI  R++ KHP + K
Sbjct: 360 ISSQARDIISKLLEYEPNARIALRDVKKHPWILK 393

>CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203w TPK2 cAMP-dependent protein kinase 2 catalytic
           chain
          Length = 361

 Score =  144 bits (363), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 140/268 (52%), Gaps = 25/268 (9%)

Query: 25  TLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREIII 84
           TLG GS G+V L  +   G+  AIKV+ KA               T D      ER +  
Sbjct: 56  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVVKMKQIEH-----TND------ERRM-- 102

Query: 85  MKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGI 144
           +KL+ HP ++R++  ++   NL+MV++Y E GELF LL +    P   A  +  ++ + +
Sbjct: 103 LKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLAL 162

Query: 145 SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISG 204
            Y H   I++RDLKPEN+LLD   +IKI DFG A  E E  +  T CG+P Y APE+I+ 
Sbjct: 163 EYLHFHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVE-TVTWTLCGTPDYIAPEVIAT 220

Query: 205 LPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQD 264
            PY+    D WS G++++ +L G  PF   D        K+  G+   P     + +  D
Sbjct: 221 KPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILHGKVVYP--QFFNSDVID 275

Query: 265 LISKILTVDPKKRI-----KTREILKHP 287
           L+SK+LT D  +RI       ++I  HP
Sbjct: 276 LLSKLLTADLTRRIGNLQKGAQDIKSHP 303

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score =  144 bits (362), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 83/256 (32%), Positives = 134/256 (52%), Gaps = 18/256 (7%)

Query: 34  VQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREIIIMKLLNHPNV 93
           V    +  TG   A+KV+ KA              +   +L     RE+ I   LNHPN+
Sbjct: 105 VYCVRHKETGFICALKVMDKAE-------------IVQYNLQKQFRREVEIQTSLNHPNL 151

Query: 94  LRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIV 153
            +LY  +  +  +Y+++EY   GEL+ LL   GP  +  A RF  QI   ++Y H   I+
Sbjct: 152 TKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALNYLHDKQII 211

Query: 154 HRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETD 213
           HRDLKPEN+L+     IK+ DFG + +       +T CG+  Y +PE+I    Y   + D
Sbjct: 212 HRDLKPENILIGFNNVIKLTDFGWSIINPRGVKRKTLCGTIDYLSPEMIRSREYDD-KVD 270

Query: 214 VWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVD 273
           VW+ G++ + L+ G  PF+E+   +     ++     + P  + +S + +DLISK+L  +
Sbjct: 271 VWALGVLTYELIVGSPPFEEDTKELT--YKRILKNDIKFP--ETVSHDVKDLISKLLKYN 326

Query: 274 PKKRIKTREILKHPLV 289
           P +RI  R+++KHP +
Sbjct: 327 PSERISMRDVMKHPWI 342

>Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {ON}
           YOL016C (REAL)
          Length = 442

 Score =  145 bits (367), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 92/274 (33%), Positives = 141/274 (51%), Gaps = 19/274 (6%)

Query: 22  LGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIERE 81
            G TLG GS G V+ A   ST +  AIK++ K                        +  E
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQM------------LYEE 96

Query: 82  IIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQII 141
           + I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    QI+
Sbjct: 97  LSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQIL 156

Query: 142 IGISYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMA-ALETEDKLLETSCGSPHYA 197
             + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ ++ L+  + GS  Y 
Sbjct: 157 GAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGYV 216

Query: 198 APEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEE--DGNIRNLLLKVQSGQFEMPGN 255
           APE+++    HG   D+WS G+I + LL G  PF  E  +G +           F +P  
Sbjct: 217 APEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHIPYW 275

Query: 256 DEISREAQDLISKILTVDPKKRIKTREILKHPLV 289
           D IS +A+  I K L ++P +R    E+L  P +
Sbjct: 276 DNISIDAKRFILKALRLNPTERPTATELLDDPWI 309

>KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON}
           Anc_6.222 YPL209C
          Length = 360

 Score =  143 bits (361), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 121/214 (56%), Gaps = 5/214 (2%)

Query: 78  IEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 137
           + REI I  +LNHPN+ +LY  +  +  +Y+V+EY  +GEL+ LL   GP  +  A  + 
Sbjct: 147 VRREIEIQTILNHPNLTKLYSFFHDEKRIYIVMEYLIQGELYKLLQSHGPFNDVLASNYV 206

Query: 138 RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYA 197
            QI   + Y H   I+HRD+KPEN+L+     +K+ DFG + +  +    +T CG+  Y 
Sbjct: 207 YQIADALDYLHQKHIIHRDIKPENILIGFNNTVKLTDFGWSIINPKGIRRKTLCGTIDYL 266

Query: 198 APEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDE 257
           +PEII+   Y     D+W+ G++ + L+ G   F+EE   +     ++  G+ + P  + 
Sbjct: 267 SPEIITSKEYDH-TVDIWALGVLAYELVVGSPAFEEETKEMT--YKRIVKGELKFP--EH 321

Query: 258 ISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
           +    +DLI +IL ++P KR+  +EI +HP + K
Sbjct: 322 LPNIVRDLIQRILVIEPSKRMSLKEIKRHPWILK 355

>YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}
           TPK2cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; partially redundant with
           Tpk1p and Tpk3p; localizes to P-bodies during stationary
           phase
          Length = 380

 Score =  144 bits (363), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 96/287 (33%), Positives = 149/287 (51%), Gaps = 26/287 (9%)

Query: 7   KPSLEVKGN-TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXX 65
           + SL  KG  T+  +++  TLG GS G+V L  +   G+  AIKV+ K            
Sbjct: 56  QKSLVSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHT 115

Query: 66  XXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVER 125
                        ER   ++KL+ HP ++R++  ++   N++MV++Y E GELF+LL + 
Sbjct: 116 ND-----------ERR--MLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKS 162

Query: 126 GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDK 185
              P   A  +  ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    
Sbjct: 163 QRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQT 220

Query: 186 LLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKV 245
           +  T CG+P Y APE+I+  PY+    D WS G++++ +L G  PF   D        K+
Sbjct: 221 VTWTLCGTPDYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKI 277

Query: 246 QSGQFEMPGNDEISREAQDLISKILTVDPKKRI-----KTREILKHP 287
             G+   P       +  DL+SK++T D  +RI      +R+I  HP
Sbjct: 278 LQGKVVYP--PYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHP 322

>TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.182
           YJL164C
          Length = 411

 Score =  145 bits (365), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 100/321 (31%), Positives = 161/321 (50%), Gaps = 34/321 (10%)

Query: 15  NTVGPWKLGE-----TLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLL 69
           NT G + L +     TLG GS G+V L  ++  G+  A+KV+ K                
Sbjct: 91  NTSGKYCLTDFQILRTLGTGSFGRVHLVRSNHNGRFYALKVLKKQTIVKLKQVEH----- 145

Query: 70  TPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLP 129
           T D      ER +  + +++HP ++R++  ++    ++MV++Y E GELF+LL +    P
Sbjct: 146 TND------ERRM--LSVVSHPFLIRMWGTFQDAEQVFMVMDYIEGGELFSLLRKSQRFP 197

Query: 130 ENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLET 189
              A  +  ++ + + Y HA  I++RDLKPEN+LLD   +IKI DFG A    +  +  T
Sbjct: 198 NPVAKFYAAEVCLALEYLHANEIIYRDLKPENILLDRNGHIKITDFGFAKYVPD--VTYT 255

Query: 190 SCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQ 249
            CG+P Y APE+IS  PY+    D WS GI ++ +L G  PF   D N       + + +
Sbjct: 256 LCGTPDYIAPEVISTKPYNK-SVDWWSFGIYIYEMLAGYTPF--YDANAMKTYENILNAE 312

Query: 250 FEMPGNDEISREAQDLISKILTVDPKKRI-----KTREILKHPLVQKYPSIKDSKTIRNL 304
            + P     + +AQDL+SK++  D  KR+      + ++  HP   +   + +    RN+
Sbjct: 313 LKFPPF--FNADAQDLLSKLIERDLSKRLGNLQNGSEDVKNHPWFSE--VVWEKLLSRNI 368

Query: 305 PREDTYLNPLSDDNGDVCEID 325
             E  Y  P+    GD  + D
Sbjct: 369 --ETPYEPPIQQGQGDTSQFD 387

>Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W
           (REAL)
          Length = 382

 Score =  144 bits (362), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 96/287 (33%), Positives = 149/287 (51%), Gaps = 26/287 (9%)

Query: 7   KPSLEVKGN-TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXX 65
           + SL  KG  T+  +++  TLG GS G+V L  +   G+  AIKV+ K            
Sbjct: 58  QKSLVSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHT 117

Query: 66  XXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVER 125
                        ER   ++KL+ HP ++R++  ++   N++MV++Y E GELF+LL + 
Sbjct: 118 ND-----------ERR--MLKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKS 164

Query: 126 GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDK 185
              P   A  +  ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    
Sbjct: 165 QRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQT 222

Query: 186 LLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKV 245
           +  T CG+P Y APE+I+  PY+    D WS G++++ +L G  PF   D        K+
Sbjct: 223 VTWTLCGTPDYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKI 279

Query: 246 QSGQFEMPGNDEISREAQDLISKILTVDPKKRI-----KTREILKHP 287
             G+   P       +  DL+SK++T D  +RI      +R+I  HP
Sbjct: 280 LQGKVIYP--PYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHP 324

>Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON}
           YPL203W (REAL)
          Length = 381

 Score =  144 bits (362), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 96/287 (33%), Positives = 149/287 (51%), Gaps = 26/287 (9%)

Query: 7   KPSLEVKGN-TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXX 65
           + SL  KG  T+  +++  TLG GS G+V L  +   G+  AIKV+ K            
Sbjct: 57  QKSLVSKGKYTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHT 116

Query: 66  XXLLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVER 125
                        ER   ++KL+ HP ++R++  ++   N++MV++Y E GELF+LL + 
Sbjct: 117 ND-----------ERR--MLKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKS 163

Query: 126 GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDK 185
              P   A  +  ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    
Sbjct: 164 QRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQT 221

Query: 186 LLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKV 245
           +  T CG+P Y APE+I+  PY+    D WS G++++ +L G  PF   D        K+
Sbjct: 222 VTWTLCGTPDYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKI 278

Query: 246 QSGQFEMPGNDEISREAQDLISKILTVDPKKRI-----KTREILKHP 287
             G+   P       +  DL+SK++T D  +RI      +R+I  HP
Sbjct: 279 LQGKVIYP--PYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHP 323

>YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON}
           IPL1Aurora kinase subunit of the conserved chromosomal
           passenger complex (CPC; Ipl1p-Sli15p-Bir1p-Nbl1p),
           involved in regulating kinetochore-microtubule
           attachments; helps maintain condensed chromosomes during
           anaphase and early telophase; required for SPB cohesion
           and prevention of multipolar spindle formation
          Length = 367

 Score =  143 bits (361), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 84/257 (32%), Positives = 133/257 (51%), Gaps = 20/257 (7%)

Query: 34  VQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIEREIIIMKLLNHPNV 93
           V    + STG   A+KV+ K                   +L     RE+ I   LNHPN+
Sbjct: 118 VYCVRHRSTGYICALKVMEKEEIIKY-------------NLQKQFRREVEIQTSLNHPNL 164

Query: 94  LRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIIIGISYCHALGIV 153
            + Y  +  +  +Y+++EY   GE++ LL   GP  +  A  +  QI   + Y H   I+
Sbjct: 165 TKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFNDILASDYIYQIANALDYMHKKNII 224

Query: 154 HRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAPEIISGLPY-HGLET 212
           HRD+KPEN+L+     IK+ DFG + +   +   +T CG+  Y +PE++    Y H +  
Sbjct: 225 HRDIKPENILIGFNNVIKLTDFGWSIINPPENRRKTVCGTIDYLSPEMVESREYDHTI-- 282

Query: 213 DVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTV 272
           D W+ G++ F LLTG  PF+EE  +      ++ +   +MP N  IS++AQDLI K+L  
Sbjct: 283 DAWALGVLAFELLTGAPPFEEEMKD--TTYKRIAALDIKMPSN--ISQDAQDLILKLLKY 338

Query: 273 DPKKRIKTREILKHPLV 289
           DPK R++  ++  HP +
Sbjct: 339 DPKDRMRLGDVKMHPWI 355

>NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {ON}
           Anc_1.182
          Length = 408

 Score =  144 bits (363), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 137/259 (52%), Gaps = 20/259 (7%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           +++  TLG GS G+V L  +   G+  A+KVI K                         E
Sbjct: 98  FQIMRTLGTGSFGRVHLVRSIHNGRFYALKVIKKNTVVRLKQIEHTND-----------E 146

Query: 80  REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 139
           R +  + ++NHP ++R++  ++    ++M+++Y E GELF+LL      P   A  +  +
Sbjct: 147 RRM--LSVVNHPFLVRMWGTFQDSEQIFMIMDYIEGGELFSLLRRSQKFPNPVAKFYAAE 204

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAP 199
           + + + Y H+L I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y AP
Sbjct: 205 VCLALEYLHSLDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAP 262

Query: 200 EIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEIS 259
           E++S  PY+    D WS GI+++ +L+GR PF   D +       + S     P    + 
Sbjct: 263 EVVSSKPYNK-SVDWWSFGILIYEMLSGRTPF--YDRSTIKTYENILSAPLTFPS--YLH 317

Query: 260 REAQDLISKILTVDPKKRI 278
            + QDL+++++T D  KR+
Sbjct: 318 EDVQDLLNRLITRDLSKRL 336

>NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON} 
          Length = 354

 Score =  142 bits (359), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 92/277 (33%), Positives = 143/277 (51%), Gaps = 25/277 (9%)

Query: 16  TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLP 75
           T+  +++  TLG GS G+V L  +   G+  AIKV+ K                      
Sbjct: 40  TLHDFQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVRMKQIEHTND-------- 91

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 135
              ER   ++KL+ HP ++R++  ++   NL+MV++Y E GELF+LL +    P   A  
Sbjct: 92  ---ERR--MLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKF 146

Query: 136 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 195
           +  ++ +G+ Y H+  I++RDLKPEN+LLD   +IKI DFG A  +  D +  T CG P 
Sbjct: 147 YAAEVTLGLEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGPPD 204

Query: 196 YAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGN 255
           Y APE+I+  PY+    D WS G+++F +L G  PF   D        K+  G+   P  
Sbjct: 205 YIAPEVIATKPYNK-SVDWWSLGVLIFEMLAGYTPF--YDTTPMKTYEKILQGKVVYP-- 259

Query: 256 DEISREAQDLISKILTVDPKKRI-----KTREILKHP 287
                +  DL+ K++T D  +RI      +++I  HP
Sbjct: 260 TFFHPDVVDLLGKLITADLTRRIGNLQSGSKDIKCHP 296

>NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214
          Length = 367

 Score =  142 bits (358), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 96/285 (33%), Positives = 147/285 (51%), Gaps = 26/285 (9%)

Query: 9   SLEVKGN-TVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXX 67
           SLE KG  T+  +++  TLG GS G+V L  +   G+  AIKV+ K              
Sbjct: 45  SLESKGKYTLQDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKHQIVRMKQIEHTND 104

Query: 68  LLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGP 127
                      ER   ++KL+ HP ++R++  ++   N++MV++Y E GELF+LL +   
Sbjct: 105 -----------ERR--MLKLVEHPFLIRMWGTFQDSRNIFMVMDYIEGGELFSLLRKSQR 151

Query: 128 LPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLL 187
            P   A  +  ++ + + Y H   I++RDLKPEN+LLD   +IKI DFG A  E E  + 
Sbjct: 152 FPNPVAKFYAAEVTLALEYLHHHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVE-TVT 209

Query: 188 ETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQS 247
            T CG+P Y APE+I+  PY+    D WS GI++F +L G  PF   D        K+  
Sbjct: 210 WTLCGTPDYIAPEVIATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDSTPMKTYEKILQ 266

Query: 248 GQFEMPGNDEISREAQDLISKILTVDPKKRI-----KTREILKHP 287
           G+   P       +  DL+ +++T D  +RI      +++I  HP
Sbjct: 267 GKVIFP--TFFHPDVVDLLGQLITADLTRRIGNLQSGSKDIKCHP 309

>YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}
           DUN1Cell-cycle checkpoint serine-threonine kinase
           required for DNA damage-induced transcription of certain
           target genes, phosphorylation of Rad55p and Sml1p, and
           transient G2/M arrest after DNA damage; also regulates
           postreplicative DNA repair
          Length = 513

 Score =  145 bits (367), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 90/294 (30%), Positives = 141/294 (47%), Gaps = 41/294 (13%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           + LG+ LG G    V+ A N  TGQQ A+K+                             
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQ-------------FR 246

Query: 80  REIIIMKLLNHPNVLRLYD-----VWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAI 134
            E  I+  + HPN++ L D     + ++    Y+VLE  + GELF  +V +  L ++E+ 
Sbjct: 247 EETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESK 306

Query: 135 RFFRQIIIGISYCHALGIVHRDLKPENLLL-------------------DHKYNIKIADF 175
             F+Q++ G+ Y H   I+HRD+KPEN+LL                   +    +KIADF
Sbjct: 307 ALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADF 366

Query: 176 GMAALETEDKLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEED 235
           G+A    E +   T CG+P Y APE+++   Y   + D+WS G+IL+  L G  PF ++ 
Sbjct: 367 GLAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTS-KVDLWSAGVILYVCLCGFPPFSDQL 425

Query: 236 G--NIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHP 287
           G  +++  +L+ +   F  P  D+I      LIS +L ++P +R    E L HP
Sbjct: 426 GPPSLKEQILQAKYA-FYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHP 478

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score =  142 bits (358), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 86/283 (30%), Positives = 140/283 (49%), Gaps = 40/283 (14%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           +++G+ LG G  G+V    +  +G   A+K + K                  D + Y IE
Sbjct: 109 FEIGKVLGKGKFGRVYCVRHIESGFVCALKAMEKK-----------------DIIQYNIE 151

Query: 80  ----REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIR 135
               RE+ I   L HPN+ +LY  +  +  +Y+++EY   GEL+  L  R    +  A  
Sbjct: 152 KQFRREVEIQSSLRHPNLTQLYGYFHDEKRVYLLMEYLVNGELYKHLKGRSHFNDVVASY 211

Query: 136 FFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPH 195
           +  Q+   + Y H   I+HRD+KPEN+++     IK+ DFG + +  +    +T CG+  
Sbjct: 212 YVYQMADALDYMHERNILHRDIKPENIIIGFNNTIKLTDFGWSVITPKGSKRKTLCGTVD 271

Query: 196 YAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNI-------RNLLLKVQSG 248
           Y +PE+I    Y+  + DVW+ G++ + LL G  PF+EE   +       RNL+      
Sbjct: 272 YLSPELIRSREYNE-KVDVWALGVLTYELLVGSPPFEEESKELTYKRILKRNLIFP---- 326

Query: 249 QFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQK 291
                  D +  EA+ LIS++L  DP  RI  +E+ KHP ++K
Sbjct: 327 -------DHVDTEARHLISRLLEYDPGDRIPLKEVKKHPWIEK 362

>KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {ON}
           similar to uniprot|P05986 Saccharomyces cerevisiae
           YKL166C TPK3 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit and to YJL164C uniprot|P06244 Saccharomyces
           cerevisiae YJL164C TPK1 putative catalytic subunit of
           cAMP- dependent protein kinase
          Length = 455

 Score =  144 bits (364), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 91/311 (29%), Positives = 156/311 (50%), Gaps = 29/311 (9%)

Query: 20  WKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFXXXXXXXXXXXLLTPDSLPYGIE 79
           +++  TLG GS G+V L  ++  G+  A+KV+ K                         E
Sbjct: 145 FQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTND-----------E 193

Query: 80  REIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQ 139
           R +  + +++HP ++R++  ++    L+M+++Y E GELF+LL +    P   A  +  +
Sbjct: 194 RNM--LSIVSHPFIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAE 251

Query: 140 IIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAAP 199
           + + + Y H+ GI++RDLKPEN+LLD   +IK+ DFG A    +  +  T CG+P Y AP
Sbjct: 252 VCLALEYLHSKGIIYRDLKPENILLDKNGHIKLTDFGFAKYVPD--VTYTLCGTPDYIAP 309

Query: 200 EIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPGNDEIS 259
           E++S  PY+    D WS G++++ +L G  PF   D N       + +     P      
Sbjct: 310 EVVSTKPYNK-SVDWWSFGVLIYEMLAGYTPF--YDSNTIKTYENILNAPVRFP--PFFH 364

Query: 260 REAQDLISKILTVDPKKRI-----KTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPL 314
            +AQDLISK++T D  +R+      + ++  HP   +   + +    +N+  E  Y  P+
Sbjct: 365 SDAQDLISKLITRDLSQRLGNLQNGSEDVKNHPWFSE--VVWEKLLCKNI--ETPYEPPI 420

Query: 315 SDDNGDVCEID 325
               GD  + D
Sbjct: 421 QAGQGDTSQYD 431

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.127    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 140,372,284
Number of extensions: 6310417
Number of successful extensions: 38608
Number of sequences better than 10.0: 2867
Number of HSP's gapped: 35669
Number of HSP's successfully gapped: 3428
Length of query: 1391
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1269
Effective length of database: 39,492,147
Effective search space: 50115534543
Effective search space used: 50115534543
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 72 (32.3 bits)