Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A071306.13ON50050026710.0
KLTH0C11462g6.13ON49248119300.0
TDEL0G045806.13ON48445919250.0
Ecym_30166.13ON48946219130.0
SAKL0E00946g6.13ON49347619130.0
Kwal_56.223626.13ON49346219070.0
Kpol_1032.46.13ON46746218940.0
ACR013C6.13ON48848518930.0
CAGL0A01045g6.13ON48346518850.0
Kpol_1045.766.13ON48548418760.0
KLLA0D00902g6.13ON49245918740.0
KNAG0E027506.13ON49848018640.0
NCAS0D026206.13ON49346518480.0
KAFR0B065206.13ON49545918470.0
ZYRO0C07964g6.13ON50550018440.0
TPHA0J002706.13ON49646618360.0
YPL262W (FUM1)6.13ON48848418320.0
Smik_6.4706.13ON48845918300.0
Skud_16.166.13ON48845918250.0
Suva_16.436.13ON48845918140.0
TBLA0G010006.13ON46546018050.0
NDAI0I024706.13ON47545917840.0
SAKL0D09746g1.354ON4642401349e-08
TBLA0F034801.354ON4662271322e-07
NDAI0J019504.197ON4823231294e-07
NCAS0J012004.197ON4823331285e-07
KLLA0A08404g1.354ON4612361276e-07
YLR359W (ADE13)4.197ON4823161232e-06
KAFR0A009501.354ON4642381222e-06
Skud_12.4434.197ON4823211223e-06
Smik_12.4464.197ON4823161214e-06
ZYRO0B07964g4.197ON4823211196e-06
AEL019W1.354ON4692931171e-05
Kwal_47.180664.197ON4823301171e-05
CAGL0B02794g4.197ON4822701162e-05
Suva_10.4594.197ON4823211152e-05
Kpol_1018.1251.354ON4602411134e-05
TPHA0B010404.197ON4822961125e-05
NDAI0G059401.354ON4622381115e-05
SAKL0B04972g4.197ON4822591116e-05
KNAG0I015601.354ON4622251107e-05
KLLA0B13189g4.197ON4822601091e-04
CAGL0I08987g1.354ON4612401091e-04
Kpol_1042.164.197ON4822701081e-04
TPHA0A021901.354ON4632301081e-04
YHR018C (ARG4)1.354ON4632511081e-04
Skud_8.701.354ON4632511081e-04
ZYRO0G00748g1.354ON4622381072e-04
KLTH0A03344g4.197ON4823211063e-04
TDEL0D022201.354ON4652381053e-04
Smik_8.831.354ON4632511053e-04
Ecym_27491.354ON4702421053e-04
Suva_15.2011.354ON4632511035e-04
TDEL0E017604.197ON4822721036e-04
Kwal_27.127821.354ON4653091027e-04
KNAG0B058404.197ON4821901000.001
Ecym_24524.197ON482192990.002
KLTH0G19338g1.354ON465303970.003
TBLA0A083204.197ON482190950.005
NCAS0A090101.354ON462240940.007
KAFR0A062304.197ON482332910.014
CAGL0F06743g2.651ON80170770.97
Kwal_56.24852singletonON54363723.4
Suva_2.823.325ON102593706.8
TDEL0E013304.238ON165792698.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07130
         (500 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6...  1033   0.0  
KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {...   748   0.0  
TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {O...   746   0.0  
Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to ...   741   0.0  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...   741   0.0  
Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W ...   739   0.0  
Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..516...   734   0.0  
ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON} S...   733   0.0  
CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {...   730   0.0  
Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa] ...   727   0.0  
KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly s...   726   0.0  
KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.1...   722   0.0  
NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {O...   716   0.0  
KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6...   716   0.0  
ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {...   714   0.0  
TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13...   711   0.0  
YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumaras...   710   0.0  
Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON...   709   0.0  
Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W (...   707   0.0  
Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W (...   703   0.0  
TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.1...   699   0.0  
NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {O...   691   0.0  
SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {...    56   9e-08
TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.3...    55   2e-07
NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4....    54   4e-07
NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4....    54   5e-07
KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {...    54   6e-07
YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}  ADE13Aden...    52   2e-06
KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.3...    52   2e-06
Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359...    52   3e-06
Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359...    51   4e-06
ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {...    50   6e-06
AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic ho...    50   1e-05
Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359...    50   1e-05
CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {...    49   2e-05
Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359...    49   2e-05
Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]...    48   4e-05
TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {O...    48   5e-05
NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON} Anc_1...    47   5e-05
SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly...    47   6e-05
KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.3...    47   7e-05
KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]...    47   1e-04
CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {...    47   1e-04
Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON} (40749....    46   1e-04
TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.3...    46   1e-04
YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}  ...    46   1e-04
Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}...    46   1e-04
ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly s...    46   2e-04
KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly...    45   3e-04
TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.3...    45   3e-04
Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}...    45   3e-04
Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {O...    45   3e-04
Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {...    44   5e-04
TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {O...    44   6e-04
Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]...    44   7e-04
KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON} Anc_4...    43   0.001
Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar t...    43   0.002
KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]...    42   0.003
TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa] ...    41   0.005
NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa] ...    41   0.007
KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa] ...    40   0.014
CAGL0F06743g Chr6 (661325..663730) [2406 bp, 801 aa] {ON} simila...    34   0.97 
Kwal_56.24852 s56 complement(1171208..1172839) [1632 bp, 543 aa]...    32   3.4  
Suva_2.82 Chr2 (147251..150328) [3078 bp, 1025 aa] {ON} YBL037W ...    32   6.8  
TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4....    31   8.9  

>TBLA0A07130 Chr1 (1770536..1772038) [1503 bp, 500 aa] {ON} Anc_6.13
           YPL262W
          Length = 500

 Score = 1033 bits (2671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/500 (100%), Positives = 500/500 (100%)

Query: 1   MLKSAATLRQPVVSLNIFRNCQRSFSITPVSHSIADLQGTRTETDSFGEIQVPANKYWGA 60
           MLKSAATLRQPVVSLNIFRNCQRSFSITPVSHSIADLQGTRTETDSFGEIQVPANKYWGA
Sbjct: 1   MLKSAATLRQPVVSLNIFRNCQRSFSITPVSHSIADLQGTRTETDSFGEIQVPANKYWGA 60

Query: 61  QTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQ 120
           QTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQ
Sbjct: 61  QTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQ 120

Query: 121 GLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDT 180
           GLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDT
Sbjct: 121 GLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDT 180

Query: 181 FPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSG 240
           FPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSG
Sbjct: 181 FPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSG 240

Query: 241 YTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPN 300
           YTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPN
Sbjct: 241 YTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPN 300

Query: 301 KFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPG 360
           KFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPG
Sbjct: 301 KFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPG 360

Query: 361 KVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFSF 420
           KVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFSF
Sbjct: 361 KVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFSF 420

Query: 421 NLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALELD 480
           NLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALELD
Sbjct: 421 NLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALELD 480

Query: 481 ILSSKQFDEWVRPENMLGPN 500
           ILSSKQFDEWVRPENMLGPN
Sbjct: 481 ILSSKQFDEWVRPENMLGPN 500

>KLTH0C11462g Chr3 complement(942263..943741) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 492

 Score =  748 bits (1930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/481 (72%), Positives = 409/481 (85%), Gaps = 4/481 (0%)

Query: 23  RSFSITP----VSHSIADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERM 78
           +S S +P    +S S A  Q  R ETD+FGEI VPA+KYWGAQTQRS  NFKIGG RERM
Sbjct: 11  KSLSGSPKTRLISTSSAISQKCRVETDAFGEINVPADKYWGAQTQRSLENFKIGGARERM 70

Query: 79  PEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGT 138
           PEP++RAFG  KK+AAIVN SLGTLD  +   I QAA+EV  G L +HFPLVVFQTGSGT
Sbjct: 71  PEPVVRAFGILKKSAAIVNESLGTLDPKISKPIQQAADEVISGKLVDHFPLVVFQTGSGT 130

Query: 139 QSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLL 198
           QSNMNANEVISNRAIE++GG +G+K +HPNNH NQ+QSSNDTFP+VMHIAA+TEIT++LL
Sbjct: 131 QSNMNANEVISNRAIEIVGGKMGTKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLL 190

Query: 199 PNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPE 258
           P L  LR++  +K+KEFE I+KIGRTHLQDATPLTLGQEFSGY QQLTN I R+E++L  
Sbjct: 191 PELTALRDSFATKSKEFESIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEQSLIH 250

Query: 259 LQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASL 318
           L+++AQGGTAVGTGLNTK+GF E+ A Q+S +T + F T+PNKFE+LAAHDAIV    +L
Sbjct: 251 LKFLAQGGTAVGTGLNTKVGFGEKIAEQVSKETGIDFKTAPNKFEALAAHDAIVECSGAL 310

Query: 319 NTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVM 378
           NTLACSLFKI+ DIRYL SGPRCGYGELS+PENEPGSSIMPGKVNPTQNEAM Q CVQVM
Sbjct: 311 NTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVM 370

Query: 379 GNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRL 438
           GNN+ I+FAGASGQFELN +KP+MI+NLLSS RLL DA +SF +HC  GI+AN+DKI +L
Sbjct: 371 GNNAAITFAGASGQFELNVFKPVMISNLLSSVRLLGDACYSFRVHCVDGIEANRDKIAKL 430

Query: 439 LHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLG 498
           LHESLMLVT+LNPKIGYDAASKVAKNAH KGITLK+SALEL +L+S +FD+WV PENM+G
Sbjct: 431 LHESLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELKVLTSAEFDQWVVPENMVG 490

Query: 499 P 499
           P
Sbjct: 491 P 491

>TDEL0G04580 Chr7 complement(836367..837821) [1455 bp, 484 aa] {ON}
           Anc_6.13 YPL262W
          Length = 484

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/459 (74%), Positives = 401/459 (87%)

Query: 41  RTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSL 100
           R ETD+FGEI+V A++YWGAQTQRS  NF+IGG RERMPEPI+RAFG  KK+AA+VN SL
Sbjct: 24  RVETDAFGEIKVAADRYWGAQTQRSLENFRIGGPRERMPEPIVRAFGVLKKSAAVVNESL 83

Query: 101 GTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTL 160
           GTLD  + + I QAA+EV+QG L  HFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG L
Sbjct: 84  GTLDPKVAEPIKQAADEVAQGKLTAHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGEL 143

Query: 161 GSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIK 220
           GSKQ+HPNNH NQ+QSSNDTFP+VMHIAA+TEIT  LLP L  LR++LD+K+KEF  I+K
Sbjct: 144 GSKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITRHLLPELAHLRDSLDAKSKEFSDIVK 203

Query: 221 IGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFA 280
           IGRTHLQDATPLTLGQEFSGY QQ++N I R+E +L  L+Y+AQGGTAVGTGLNTKIGFA
Sbjct: 204 IGRTHLQDATPLTLGQEFSGYVQQVSNGIDRVEGSLHRLKYLAQGGTAVGTGLNTKIGFA 263

Query: 281 EQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPR 340
           E+ A Q+S +T L F T+PNKFE+LAAHDA+V    +LNT+ACSLFKI+QDIRYL SGPR
Sbjct: 264 EKIAEQVSKETGLDFKTAPNKFEALAAHDAVVEASGALNTVACSLFKIAQDIRYLGSGPR 323

Query: 341 CGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKP 400
           CGYGELS+PENEPGSSIMPGKVNPTQNEA+ Q CVQVMGNN+ I+FAGASGQFELN +KP
Sbjct: 324 CGYGELSLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGASGQFELNVFKP 383

Query: 401 LMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASK 460
           +MI+NLLSS RLL+DA +SF +HC  GI AN+D+I +L+HESLMLVT+LNPKIGYDAASK
Sbjct: 384 VMISNLLSSVRLLADASYSFRVHCVDGIIANRDRIGKLMHESLMLVTALNPKIGYDAASK 443

Query: 461 VAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499
           VAKNAH KGITLKQSAL+L +L+  +FDEWV PENM+GP
Sbjct: 444 VAKNAHKKGITLKQSALDLGVLTESEFDEWVVPENMIGP 482

>Ecym_3016 Chr3 (30897..32366) [1470 bp, 489 aa] {ON} similar to
           Ashbya gossypii ACR013C
          Length = 489

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/462 (74%), Positives = 401/462 (86%)

Query: 38  QGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVN 97
           Q  R ETD+FGEI+VPANKYWGAQTQRS  NFKIGG RERMPEPII+AFG  KK+AAIVN
Sbjct: 26  QKFRIETDAFGEIKVPANKYWGAQTQRSLENFKIGGPRERMPEPIIKAFGILKKSAAIVN 85

Query: 98  NSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 157
            SLGTLD  +   I QAA+EV +G L +HFPLVVFQTGSGTQSNMNANEVISNRAIEL+G
Sbjct: 86  ESLGTLDPKISKPIQQAADEVIEGKLLDHFPLVVFQTGSGTQSNMNANEVISNRAIELIG 145

Query: 158 GTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEK 217
           G LG+KQ+HPNNH NQ+QSSNDTFP+VMHIAA+TEITNTLLP L  LR++   K +EF  
Sbjct: 146 GELGTKQIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNTLLPELTALRDSFQKKTEEFSH 205

Query: 218 IIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKI 277
           I+KIGRTHLQDATPLTLGQEF GYTQQ+TN I R+E++L  L+++AQGGTAVGTGLNTK+
Sbjct: 206 IVKIGRTHLQDATPLTLGQEFGGYTQQITNGITRVEQSLHHLKFLAQGGTAVGTGLNTKV 265

Query: 278 GFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLAS 337
           GFAE+ A Q+S +TN+ F T+PNKFE+LAAHDA+V    +LNT+ACSLFKI+ DIRYL S
Sbjct: 266 GFAEKIAEQVSKETNIEFKTAPNKFEALAAHDAVVECSGALNTVACSLFKIANDIRYLGS 325

Query: 338 GPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNT 397
           GPRCGYGELS+PENEPGSSIMPGKVNPTQNEAM QACVQVMGNNSTI+FAGASGQFELN 
Sbjct: 326 GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQACVQVMGNNSTITFAGASGQFELNV 385

Query: 398 YKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDA 457
           +KP+MI+NLL+S RLL+DA +SF +HC  GI+AN+DKI ++LHESLMLVT+LNPKIGYD+
Sbjct: 386 FKPVMISNLLNSIRLLADASYSFRVHCVDGIKANEDKIAKILHESLMLVTALNPKIGYDS 445

Query: 458 ASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499
           A KVAKNAH K ITLK+SALEL +LS ++F EWV PE M+GP
Sbjct: 446 ACKVAKNAHKKNITLKESALELGVLSEEEFSEWVVPEKMIGP 487

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score =  741 bits (1913), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/476 (72%), Positives = 406/476 (85%), Gaps = 1/476 (0%)

Query: 24  SFSITPVSHSIADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPII 83
           S  +   S S+A  Q  R ETD+FGEI+VPA+KYWGAQTQRSF NFKIGG RERMPE ++
Sbjct: 17  SIRMLSTSSSLAQ-QKYRIETDAFGEIKVPADKYWGAQTQRSFENFKIGGARERMPEAVV 75

Query: 84  RAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMN 143
           RAFG  KK+AAIVN SLGTLD  +   I +AA+EV QG L +HFPLVVFQTGSGTQSNMN
Sbjct: 76  RAFGVLKKSAAIVNESLGTLDPEISKPIQKAADEVIQGKLMDHFPLVVFQTGSGTQSNMN 135

Query: 144 ANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIV 203
           ANEVISNRAIE++GG  GSKQVHPNNH NQ+QSSNDTFP+VMHIAA+TEIT++LLP L  
Sbjct: 136 ANEVISNRAIEIIGGEKGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEITHSLLPELTA 195

Query: 204 LRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIA 263
           LR++   K+ EF  I+KIGRTHLQDATPLTLGQEFSGY QQLTN I R+E++L  L+++A
Sbjct: 196 LRDSFQKKSDEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIARVEQSLHHLKFLA 255

Query: 264 QGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLAC 323
           QGGTAVGTGLNTK+GFAE+ A Q+S +T + F T+PNKFE+LAAHDA+V    +LNTLAC
Sbjct: 256 QGGTAVGTGLNTKVGFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLAC 315

Query: 324 SLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNST 383
           SLFKI+ DIRYL SGPRCGYGELS+PENEPGSSIMPGKVNPTQNEAM Q CVQVMGNN+ 
Sbjct: 316 SLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAA 375

Query: 384 ISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESL 443
           I+FAGASGQFELN +KP+MI+NLLSS RLL+DA +SF +HC  GI+AN+D+I +LLHESL
Sbjct: 376 ITFAGASGQFELNVFKPVMISNLLSSVRLLADASYSFRVHCVDGIKANEDRISKLLHESL 435

Query: 444 MLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499
           MLVT+LNPKIGYDAASKVAKNAH KGITLK+SAL+L +L+ K+FDEWV PE M+GP
Sbjct: 436 MLVTALNPKIGYDAASKVAKNAHKKGITLKESALQLGVLNEKEFDEWVIPEKMIGP 491

>Kwal_56.22362 s56 (65537..67018) [1482 bp, 493 aa] {ON} YPL262W
           (FUM1) - mitochondrial and cytoplasmic fumarase
           (fumarate hydralase) [contig 186] FULL
          Length = 493

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/462 (74%), Positives = 397/462 (85%)

Query: 38  QGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVN 97
           Q  R ETD+FGEI+VP +K WGAQTQRS  NFKIGG+RERMPEPI++AFG  KK+AAIVN
Sbjct: 30  QKYRVETDAFGEIKVPTDKLWGAQTQRSLENFKIGGQRERMPEPIVKAFGILKKSAAIVN 89

Query: 98  NSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLG 157
            SLGTLD  +   I  AA+EV  G L +HFPLVVFQTGSGTQSNMNANEVISNRAI+L+G
Sbjct: 90  ESLGTLDPKVSKPIQDAADEVISGKLIDHFPLVVFQTGSGTQSNMNANEVISNRAIQLVG 149

Query: 158 GTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEK 217
           G +GSK +HPNNH NQ+QSSNDTFP+VMHIAA+TE+T+ LLP LI LR+    KA+EF+ 
Sbjct: 150 GEVGSKSIHPNNHCNQAQSSNDTFPSVMHIAAVTEVTHLLLPELIALRDAFAKKAQEFDS 209

Query: 218 IIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKI 277
           I+KIGRTHLQDATPLTLGQEFSGY QQLTN I R+E +L  L+++AQGGTAVGTGLNTK+
Sbjct: 210 IVKIGRTHLQDATPLTLGQEFSGYVQQLTNGISRVEHSLHNLKFLAQGGTAVGTGLNTKV 269

Query: 278 GFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLAS 337
           GFAE+ A Q+S +T + F T+PNKFE+LAAHDA+V    +LNTLACSLFKI+ DIRYL S
Sbjct: 270 GFAEKIAEQVSKETGIDFKTAPNKFEALAAHDAVVECSGALNTLACSLFKIANDIRYLGS 329

Query: 338 GPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNT 397
           GPRCGYGELS+PENEPGSSIMPGKVNPTQNEAM Q CVQVMGNN+ I+FAGASGQFELN 
Sbjct: 330 GPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNV 389

Query: 398 YKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDA 457
           +KP+MI+NLLSS RLL DA +SF +HC  GIQAN+DKI +LLHESLMLVT+LNPKIGYDA
Sbjct: 390 FKPVMISNLLSSIRLLGDACYSFRVHCVEGIQANEDKIAKLLHESLMLVTALNPKIGYDA 449

Query: 458 ASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499
           ASKVAKNAH KGITLK+SALEL +LSS +FDEWV PENM+GP
Sbjct: 450 ASKVAKNAHKKGITLKESALELGVLSSAEFDEWVVPENMVGP 491

>Kpol_1032.4 s1032 (3761..5164) [1404 bp, 467 aa] {ON} (3761..5164)
           [1404 nt, 468 aa]
          Length = 467

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/462 (74%), Positives = 397/462 (85%)

Query: 39  GTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNN 98
           G R ETD FGEI+VPA+KYWGAQTQRS+ NFKIGG RERMPEP+++AFG  KK+AAIVN 
Sbjct: 6   GFRLETDGFGEIKVPADKYWGAQTQRSYENFKIGGPRERMPEPVVKAFGVLKKSAAIVNE 65

Query: 99  SLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGG 158
             G LD  +   I QAA+EV +G LNEHFPLVVFQTGSGTQSNMNANEVISNRAIEL GG
Sbjct: 66  EFGILDAGISKLIQQAADEVIEGKLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELKGG 125

Query: 159 TLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKI 218
            +GSK++HPNNH N +QSSNDTFPTVMHIAA+TEIT+ L+P +  L++ L +K+KEFE I
Sbjct: 126 IMGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTEITHHLIPKMTELKDALANKSKEFEHI 185

Query: 219 IKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIG 278
           +KIGRTHLQDATPLTLGQEFSGY QQL N I RIE +L  L+++AQGGTAVGTGLNTKIG
Sbjct: 186 VKIGRTHLQDATPLTLGQEFSGYVQQLINGIARIEHSLINLKFLAQGGTAVGTGLNTKIG 245

Query: 279 FAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASG 338
           FAE+ A Q+S +T + F T+PNKFE+LAAHDAIV    +LNT+ACSLFKI+QDIRYL SG
Sbjct: 246 FAERIAEQVSKETGIEFKTAPNKFEALAAHDAIVESSGALNTVACSLFKIAQDIRYLGSG 305

Query: 339 PRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTY 398
           PRCGYGELS+PENEPGSSIMPGKVNPTQNEAM Q CVQVMGNN+ I+FAGASGQFELN +
Sbjct: 306 PRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAITFAGASGQFELNVF 365

Query: 399 KPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAA 458
           KP+MI+NLLSS RLL DA  SF +HC  GIQAN+DKI++LLHESLMLVT+LNPKIGYD+A
Sbjct: 366 KPVMISNLLSSIRLLGDACHSFTIHCVEGIQANEDKINKLLHESLMLVTALNPKIGYDSA 425

Query: 459 SKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGPN 500
           +KVAKNAH KGITLK+SALEL +L+  +FDEWV PE MLGP+
Sbjct: 426 TKVAKNAHKKGITLKESALELGVLTEDEFDEWVVPEKMLGPS 467

>ACR013C Chr3 complement(381119..382585) [1467 bp, 488 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL262W
           (FUM1)
          Length = 488

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/485 (71%), Positives = 399/485 (82%)

Query: 15  LNIFRNCQRSFSITPVSHSIADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGE 74
           L + R C  S +   +  +    Q  R ETD+FGEI+VPA+KYWGAQTQRS  NF+IGG 
Sbjct: 2   LRLSRGCVGSSAARRLMSTAGAPQQFRVETDAFGEIRVPADKYWGAQTQRSLENFRIGGA 61

Query: 75  RERMPEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQT 134
           RERMPEP++RAFG  KK+AA+VN  LGTL+  +  AI QAA+EV+QG L EHFPLVVFQT
Sbjct: 62  RERMPEPVVRAFGVLKKSAAVVNEQLGTLEPGIAKAIQQAADEVAQGQLMEHFPLVVFQT 121

Query: 135 GSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEIT 194
           GSGTQSNMNANEVISNRAIELLGG LGSKQVHPNNH NQ+QSSNDTFP+VMHIAA+TEIT
Sbjct: 122 GSGTQSNMNANEVISNRAIELLGGELGSKQVHPNNHCNQAQSSNDTFPSVMHIAAVTEIT 181

Query: 195 NTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEK 254
            +LLP L  LR +   K  EF  I+KIGRTHLQDATPLTLGQEFSGYTQQ+ N I R+E 
Sbjct: 182 RSLLPELEALRVSFQRKTDEFAHIVKIGRTHLQDATPLTLGQEFSGYTQQIANGIARVEH 241

Query: 255 NLPELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNV 314
               L+++AQGGTAVGTGLNT+ GFAEQ A Q+S +T L F T+PNKFE+LAAHDA+V  
Sbjct: 242 AQESLRFLAQGGTAVGTGLNTRRGFAEQIAAQVSRETGLEFRTAPNKFEALAAHDAVVEA 301

Query: 315 HASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQAC 374
             +LNTLACSLFKI+ DIRYL SGPRCGYGELS+PENEPGSSIMPGKVNPTQNEA+ QAC
Sbjct: 302 SGALNTLACSLFKIANDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEALTQAC 361

Query: 375 VQVMGNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDK 434
           VQVMGNN+ I+FAGASGQFELN +KP+MIANLLSS RLL+DA  SF +HC  GIQ N+D+
Sbjct: 362 VQVMGNNAAITFAGASGQFELNVFKPVMIANLLSSVRLLADAARSFRVHCVDGIQDNEDR 421

Query: 435 IDRLLHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPE 494
           I +LLHESLMLVT+LNPKIGYDAAS VAKNAH KGITL+ SALEL +L+  +FDEWV PE
Sbjct: 422 IAKLLHESLMLVTALNPKIGYDAASAVAKNAHKKGITLRASALELGVLTDAEFDEWVVPE 481

Query: 495 NMLGP 499
            M+GP
Sbjct: 482 KMIGP 486

>CAGL0A01045g Chr1 complement(104865..106316) [1452 bp, 483 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262w FUM1 fumarate hydratase
          Length = 483

 Score =  730 bits (1885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/465 (73%), Positives = 397/465 (85%)

Query: 35  ADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAA 94
           A +   R ETD+FGEI+VPA+KYWGAQTQRSF NFKIGG RERMPEPI+RAFG  KK+AA
Sbjct: 17  ARMMHYRVETDTFGEIKVPADKYWGAQTQRSFQNFKIGGARERMPEPIVRAFGVLKKSAA 76

Query: 95  IVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIE 154
           IVN  LGTLD  +   I QAA+EV++G LN+HFPLVVFQTGSGTQSNMNANEVISNRAIE
Sbjct: 77  IVNEKLGTLDSEIAGPIQQAADEVAKGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIE 136

Query: 155 LLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKE 214
           L+GG LGSK++HPNNH NQ+QSSNDTFP+VMHIAA+TEITN+LLP +  L++ L  KA+E
Sbjct: 137 LIGGELGSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITNSLLPEITQLKDALHKKAEE 196

Query: 215 FEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLN 274
           F+ I+KIGRTHLQDATPLTLGQEFSGY QQL N I RIE  LP L+Y+AQGGTAVGTGLN
Sbjct: 197 FQDIVKIGRTHLQDATPLTLGQEFSGYVQQLVNGIARIENTLPHLKYLAQGGTAVGTGLN 256

Query: 275 TKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRY 334
           TK GF +  A Q+S +T + F T+PNKFE+LAAHDAIV    +LNT+ACSLFKI+QDIRY
Sbjct: 257 TKEGFDKLIAEQISKETGIDFKTAPNKFEALAAHDAIVEASGALNTVACSLFKIAQDIRY 316

Query: 335 LASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFE 394
           L SGPRCGYGEL +PENEPGSSIMPGKVNPTQNEAM Q CVQVMGNN+ ++FAGA+GQFE
Sbjct: 317 LGSGPRCGYGELHLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNNAAVTFAGANGQFE 376

Query: 395 LNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIG 454
           LN +KP+MI+NLLSS RLL+DA  SF +HC  GI+AN++KI+  LH SLMLVT+LNPKIG
Sbjct: 377 LNVFKPVMISNLLSSIRLLADACHSFRVHCVEGIEANREKINHNLHNSLMLVTALNPKIG 436

Query: 455 YDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499
           YDAASK+AKNA  K ITLK+SALEL  L+S++FDEWV PENM+GP
Sbjct: 437 YDAASKIAKNAFKKNITLKESALELKYLTSEEFDEWVIPENMVGP 481

>Kpol_1045.76 s1045 complement(177447..178904) [1458 bp, 485 aa]
           {ON} complement(177449..178906) [1458 nt, 486 aa]
          Length = 485

 Score =  727 bits (1876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/484 (70%), Positives = 403/484 (83%)

Query: 17  IFRNCQRSFSITPVSHSIADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERE 76
           + R+  R  ++   +  I++L+G R ETD FGEI+VPANKYWGAQT+RSF NFKIGG RE
Sbjct: 1   MLRSAIRPNTVRVQTRYISNLKGFRVETDGFGEIKVPANKYWGAQTERSFENFKIGGSRE 60

Query: 77  RMPEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGS 136
           RMPE ++RAFG  KK AAIVN  LG LD      I QAA+EV+ G LN+HFPLVVFQTGS
Sbjct: 61  RMPEAVVRAFGVLKKCAAIVNTELGGLDPATSKLIQQAADEVATGKLNDHFPLVVFQTGS 120

Query: 137 GTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNT 196
           GTQSNMNANEVISNRAIEL GG LGSK++HPNNH N +QSSNDTFPTVMHIAA+T+I+  
Sbjct: 121 GTQSNMNANEVISNRAIELKGGVLGSKEIHPNNHCNMAQSSNDTFPTVMHIAAVTQISQH 180

Query: 197 LLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNL 256
           LLP L  LR+ L +K+ EFE I+KIGRTHLQDATPLTLGQEFSGY QQLTN I+RIE+  
Sbjct: 181 LLPELTHLRDALAAKSAEFEHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIERIERAQ 240

Query: 257 PELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHA 316
             L+++AQGGTAVGTGLNTK G+AE+ A ++S +T L+F T+PNKFE+LAAHDAIV    
Sbjct: 241 QNLRFLAQGGTAVGTGLNTKNGWAERIAAEISKETGLAFKTAPNKFEALAAHDAIVEASG 300

Query: 317 SLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQ 376
           +LNT+ACSLFKI+QDIRYL SGPRCGYGELS+PENEPGSSIMPGKVNPTQNEAM Q CVQ
Sbjct: 301 ALNTVACSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQ 360

Query: 377 VMGNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKID 436
           VMGNN+ ++FAGASGQFELN +KP++I+NLLSS +LL DA  SF +HC  GI+AN+ KI 
Sbjct: 361 VMGNNAAVTFAGASGQFELNVFKPVLISNLLSSVQLLGDASRSFRVHCVEGIKANEAKIS 420

Query: 437 RLLHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENM 496
            LLH SLMLVT+LNPKIGYDAA+KVAKNAH KGITLK+SALEL +L+ K+FDEWV PE M
Sbjct: 421 ELLHRSLMLVTALNPKIGYDAATKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEKM 480

Query: 497 LGPN 500
           LGP+
Sbjct: 481 LGPS 484

>KLLA0D00902g Chr4 (83648..85126) [1479 bp, 492 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 492

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/459 (73%), Positives = 395/459 (86%)

Query: 41  RTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSL 100
           R ETD+FGEIQVP++KYWGAQTQRS  NFKIGG RERMPEPI++AFG  KK+AA+VN  L
Sbjct: 32  RVETDAFGEIQVPSDKYWGAQTQRSLQNFKIGGPRERMPEPIVKAFGVLKKSAAVVNERL 91

Query: 101 GTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTL 160
           GTLD  +   I QAA+EV+QG L EHFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG L
Sbjct: 92  GTLDPEIAKPIKQAADEVAQGKLMEHFPLVVFQTGSGTQSNMNANEVISNRAIELIGGEL 151

Query: 161 GSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIK 220
           GSK++HPNNH NQ+QSSNDTFP+VMHIAA+TEIT+ LLP L  L+  L  K+ EF+ I+K
Sbjct: 152 GSKKIHPNNHCNQAQSSNDTFPSVMHIAAVTEITHHLLPELEGLKVALKQKSDEFQHIVK 211

Query: 221 IGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFA 280
           IGRTHLQDATPLTLGQEFSGY QQ+ N I R++++L  L+++AQGGTAVGTGLNTK+GFA
Sbjct: 212 IGRTHLQDATPLTLGQEFSGYVQQVENGIARVKQSLYHLKFLAQGGTAVGTGLNTKVGFA 271

Query: 281 EQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPR 340
           E  A Q+S +T + F T+PNKFE+LAAHDA+V    +LNTLA SLFKI+ DIRYL SGPR
Sbjct: 272 EDIAEQVSKETGIDFKTAPNKFEALAAHDAVVEASGALNTLAVSLFKIANDIRYLGSGPR 331

Query: 341 CGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKP 400
           CGYGELS+PENEPGSSIMPGKVNPTQNEAM Q CVQVMGN++ I+FAGASGQFELN +KP
Sbjct: 332 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCVQVMGNHAAITFAGASGQFELNVFKP 391

Query: 401 LMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASK 460
           +MI+NLLSS RLL DA  SF +HC  GI+AN+D+I +LLHESLMLVT+LNPKIGYDAASK
Sbjct: 392 VMISNLLSSIRLLGDASNSFRIHCVEGIKANEDRIAKLLHESLMLVTALNPKIGYDAASK 451

Query: 461 VAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499
           VAKNAH KGITLK+SALEL +LSS++FD+WV PE M+GP
Sbjct: 452 VAKNAHKKGITLKESALELKVLSSEEFDQWVIPEKMIGP 490

>KNAG0E02750 Chr5 (547746..549242) [1497 bp, 498 aa] {ON} Anc_6.13
           YPL262W
          Length = 498

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/480 (71%), Positives = 402/480 (83%), Gaps = 5/480 (1%)

Query: 20  NCQRSFSITPVSHSIADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMP 79
           N +R+ S + +++     Q  R ETDSFGEI VPA++YWGAQTQRSF NFKIGG+RE++P
Sbjct: 22  NLRRNMSASAITN-----QEFRVETDSFGEINVPADRYWGAQTQRSFQNFKIGGDREKIP 76

Query: 80  EPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQ 139
           EP++RAFG  KK+AA VN +LGTLD ++   I  AA+EV++G L++HFPLVVFQTGSGTQ
Sbjct: 77  EPVVRAFGILKKSAATVNENLGTLDKSIAAKIKLAADEVAEGKLSDHFPLVVFQTGSGTQ 136

Query: 140 SNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLP 199
           SNMNANEVISNRAIELLGG LGSKQVHPNNHVNQSQSSNDTFPTVMHIAA TEI N L+P
Sbjct: 137 SNMNANEVISNRAIELLGGELGSKQVHPNNHVNQSQSSNDTFPTVMHIAATTEIANKLIP 196

Query: 200 NLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPEL 259
            L  L++ L  K +EF  I+KIGRTHLQDATPLTLGQEFSGY QQ+ N I+R++ +L  L
Sbjct: 197 ELQNLKDALQHKVEEFSSIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVQSSLYHL 256

Query: 260 QYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLN 319
            ++AQGGTAVGTGLNTK+GF +  A ++S +T L F T+PNKFE+LAAHDAIV    +LN
Sbjct: 257 HFLAQGGTAVGTGLNTKVGFDKLVAEEVSKETGLHFETAPNKFEALAAHDAIVEASGALN 316

Query: 320 TLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMG 379
           TLACSLFKI+QDIRYL SGPRCGYGEL +P NEPGSSIMPGKVNPTQNEAM Q CVQVMG
Sbjct: 317 TLACSLFKIAQDIRYLGSGPRCGYGELILPANEPGSSIMPGKVNPTQNEAMTQVCVQVMG 376

Query: 380 NNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLL 439
           NNSTI+FAG+ GQFELN YKPLMI+NLLSS RLL+DA  SF +HC   ++ANKDKID  L
Sbjct: 377 NNSTITFAGSQGQFELNVYKPLMISNLLSSIRLLTDASKSFRIHCLNDLKANKDKIDENL 436

Query: 440 HESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499
           ++SLMLVT+LNPKIGYDAA+KVAKNAHHK ITLK+SALEL +L+ K+FDEWV PENM+ P
Sbjct: 437 NKSLMLVTALNPKIGYDAAAKVAKNAHHKNITLKESALELGVLTEKEFDEWVIPENMISP 496

>NCAS0D02620 Chr4 complement(504150..505631) [1482 bp, 493 aa] {ON}
           Anc_6.13 YPL262W
          Length = 493

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/465 (73%), Positives = 393/465 (84%)

Query: 35  ADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAA 94
           A  Q  R ETDSFGEI+VPA+KYWGAQTQRSF NFKIGG RER+P+PII AFG  KK+AA
Sbjct: 27  ASQQQYRIETDSFGEIKVPADKYWGAQTQRSFQNFKIGGSRERIPDPIITAFGILKKSAA 86

Query: 95  IVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIE 154
           IVN SLGTLD  + D I +AA+EV QG L +HFPLVVFQTGSGTQ+NMN NEVISNRAIE
Sbjct: 87  IVNESLGTLDPKVADPIKKAADEVVQGKLKDHFPLVVFQTGSGTQTNMNVNEVISNRAIE 146

Query: 155 LLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKE 214
           L+GG LGSKQ+HPNNH NQSQSSNDTFP+VMHIAA+ EITN+L+P L  L++ LD KAKE
Sbjct: 147 LVGGKLGSKQIHPNNHCNQSQSSNDTFPSVMHIAAVLEITNSLIPELTKLKDALDVKAKE 206

Query: 215 FEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLN 274
           F  I+KIGRTHLQDATPLTLGQEFSGY QQL N I RIE +L  L+++AQGGTAVGTGLN
Sbjct: 207 FADIVKIGRTHLQDATPLTLGQEFSGYVQQLENGIYRIESSLYHLKFLAQGGTAVGTGLN 266

Query: 275 TKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRY 334
           TKIGF +  A ++S +T + F T+PNKFE+LAAHDAIV    +LNT+A SLFKI+QDIRY
Sbjct: 267 TKIGFDKLIAEEVSKETGIEFKTAPNKFEALAAHDAIVFASGALNTVAGSLFKIAQDIRY 326

Query: 335 LASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFE 394
           L SGPRCGYGEL +PENEPGSSIMPGKVNPTQNEAM Q CVQ+MGNN TIS AG+ GQFE
Sbjct: 327 LGSGPRCGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVCVQIMGNNQTISIAGSQGQFE 386

Query: 395 LNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIG 454
           LN YKPLMIANLL+S RL++DA  SF +HC   ++ANKDKI+  L++SLMLVT+LNPKIG
Sbjct: 387 LNVYKPLMIANLLNSIRLMTDACKSFRIHCIDDLKANKDKINENLNKSLMLVTALNPKIG 446

Query: 455 YDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499
           YDAASK+AKNAH K ITLK+SALEL  L++++FDEWV PENM+GP
Sbjct: 447 YDAASKIAKNAHLKNITLKESALELKYLTAEEFDEWVVPENMIGP 491

>KAFR0B06520 Chr2 (1352364..1353851) [1488 bp, 495 aa] {ON} Anc_6.13
           YPL262W
          Length = 495

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/459 (73%), Positives = 389/459 (84%)

Query: 41  RTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSL 100
           R ETDSFGEI VP +KYWGAQTQRS  NFKIGGERE++P PII AFG  KK+AAIVN  L
Sbjct: 35  RAETDSFGEINVPNDKYWGAQTQRSLQNFKIGGEREKIPIPIIEAFGILKKSAAIVNERL 94

Query: 101 GTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTL 160
           GTLD  L   I+ AA+EVSQG LN+HFPLVVFQTGSGTQSNMNANEVISNRAIEL+GG L
Sbjct: 95  GTLDSELAKNIIIAADEVSQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAIELMGGKL 154

Query: 161 GSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIK 220
           GSK VHPNNHVNQSQSSNDTFPTVMHIAA+ EIT  LLP L  L+ +LD K+ EF  I+K
Sbjct: 155 GSKTVHPNNHVNQSQSSNDTFPTVMHIAAMLEITRKLLPELNSLKNSLDKKSNEFNDIVK 214

Query: 221 IGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFA 280
           IGRTHLQDATPLTLGQEFSGY QQ+TN I+RIE  L  L+++AQGGTAVGTGLNTK GF 
Sbjct: 215 IGRTHLQDATPLTLGQEFSGYVQQMTNGIRRIETALYHLKFLAQGGTAVGTGLNTKAGFD 274

Query: 281 EQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPR 340
           +  A Q+S +T ++F T+PNKFE+LAAHDAIV V  +LNTLACSLFKI+QDIRYL SGPR
Sbjct: 275 KLIAEQISEETGINFETAPNKFEALAAHDAIVEVSGALNTLACSLFKIAQDIRYLGSGPR 334

Query: 341 CGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKP 400
           CGYGELS+PENEPGSSIMPGKVNPTQNEAM Q C+QVMGN+STI+FAG+ GQFELN YKP
Sbjct: 335 CGYGELSLPENEPGSSIMPGKVNPTQNEAMTQVCIQVMGNHSTITFAGSQGQFELNVYKP 394

Query: 401 LMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASK 460
           L+I+NLLSS RLL+DA +SF +HC  G++AN++ I   L++SLMLVT+LNP IGYD ASK
Sbjct: 395 LLISNLLSSIRLLTDASYSFRVHCIDGLKANRENITENLNKSLMLVTALNPYIGYDNASK 454

Query: 461 VAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499
           +AKNAHHK ITLK+SALEL +L+ +QF EWV PE M+GP
Sbjct: 455 IAKNAHHKNITLKESALELGLLTEEQFSEWVIPEKMIGP 493

>ZYRO0C07964g Chr3 complement(607609..609126) [1518 bp, 505 aa] {ON}
           highly similar to uniprot|P08417 Saccharomyces
           cerevisiae YPL262W FUM1 Fumarase converts fumaric acid
           to L-malic acid in the TCA cycle cytosolic and
           mitochondrial localization determined by the N-terminal
           mitochondrial targeting sequence and protein
           conformation
          Length = 505

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/500 (69%), Positives = 406/500 (81%), Gaps = 13/500 (2%)

Query: 13  VSLNIFRN---CQ----RSFSITPVSH------SIADLQGTRTETDSFGEIQVPANKYWG 59
           +S N+ +N   CQ    R  S TP+S       +   LQ  R ETD+FGEI+VPA+KYWG
Sbjct: 4   LSSNVLKNSCVCQVSSPRLTSKTPMSQISQLHTTTPWLQEHRVETDAFGEIKVPADKYWG 63

Query: 60  AQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVS 119
           AQTQRSF NF+IGG+RERMPE ++ AFG  KKA A VN + G LD  L  AI QAA+EV+
Sbjct: 64  AQTQRSFENFRIGGQRERMPEAVVHAFGILKKATATVNEANGQLDPKLAVAIKQAADEVA 123

Query: 120 QGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSND 179
            G L +HFPLVVFQTGSGTQSNMNANEVISNRAIELLGG LGSK VHPNNH+N SQSSND
Sbjct: 124 SGKLKDHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGKLGSKSVHPNNHINMSQSSND 183

Query: 180 TFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFS 239
           TFPTVMHIAA+  IT  LLPNL  L+++L  K++EF  I+KIGRTHLQDATPLTLGQEFS
Sbjct: 184 TFPTVMHIAAVLAITKDLLPNLTALKDSLQKKSEEFADIVKIGRTHLQDATPLTLGQEFS 243

Query: 240 GYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSP 299
           GY QQ+ N IKR+E  L  L+ +AQGGTAVGTGLNTKIG+AE  A +++ +T + F T+P
Sbjct: 244 GYVQQVANGIKRVESTLDSLKLLAQGGTAVGTGLNTKIGWAENVAAEVAKETGIDFQTAP 303

Query: 300 NKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMP 359
           NKFE+LAAHDA+V    +LNTLA SLFKI+QDIRYL SGPRCGYGELS+PENEPGSSIMP
Sbjct: 304 NKFEALAAHDAVVEASGALNTLAVSLFKIAQDIRYLGSGPRCGYGELSLPENEPGSSIMP 363

Query: 360 GKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFS 419
           GKVNPTQNEA+ Q CVQV GN+S I+FAGASGQFELN +KP+MI+NLLSS  LLSDA +S
Sbjct: 364 GKVNPTQNEALTQVCVQVFGNHSAITFAGASGQFELNVFKPVMISNLLSSINLLSDASYS 423

Query: 420 FNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALEL 479
           F +HC  GIQAN++ I +LLHESLMLVT+LNPKIGYDAASKVAKNAH  GITLK+SAL+L
Sbjct: 424 FRVHCVDGIQANRENIAKLLHESLMLVTALNPKIGYDAASKVAKNAHKNGITLKESALQL 483

Query: 480 DILSSKQFDEWVRPENMLGP 499
           +IL++++FD WV PE+M+GP
Sbjct: 484 NILTAEEFDHWVVPEHMIGP 503

>TPHA0J00270 Chr10 (61961..63451) [1491 bp, 496 aa] {ON} Anc_6.13
           YPL262W
          Length = 496

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/466 (70%), Positives = 395/466 (84%)

Query: 34  IADLQGTRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAA 93
           ++D  G R ETD FGEI+VPANKYWGAQT+RSF NF+IGG RERMP+P+++AFG  KK+A
Sbjct: 30  LSDEAGFRIETDGFGEIKVPANKYWGAQTERSFENFRIGGPRERMPDPVVKAFGVLKKSA 89

Query: 94  AIVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAI 153
           AIVN   GTLD  +   I +AA+EV QG LN+HFPLVVFQTGSGTQSNMNANEVISNRAI
Sbjct: 90  AIVNEGYGTLDPQISKVIQEAADEVIQGKLNDHFPLVVFQTGSGTQSNMNANEVISNRAI 149

Query: 154 ELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAK 213
           ELLGGTLGSKQVHPNNHVNQ+QSSND+FPTVMHIAA+TEIT+ L+P +  LR+ L+SK+K
Sbjct: 150 ELLGGTLGSKQVHPNNHVNQAQSSNDSFPTVMHIAAVTEITDHLIPEVANLRDALESKSK 209

Query: 214 EFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGL 273
           +F  I+KIGRTHLQDATPLTLGQEFSGY QQLTN I RIE +L  L+++AQGGTAVGTGL
Sbjct: 210 DFAHIVKIGRTHLQDATPLTLGQEFSGYVQQLTNGIGRIEHSLINLKFLAQGGTAVGTGL 269

Query: 274 NTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIR 333
           NT+IGFAE+ A Q+S +T ++F T+PNKFE+LAAHDAIV    ++ T+A SLFKI+QDIR
Sbjct: 270 NTRIGFAEKIAEQISKETGVAFKTAPNKFEALAAHDAIVEASGAITTVATSLFKIAQDIR 329

Query: 334 YLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQF 393
           YL SGPRCGYGELS+PENEPGSSIMPGK+NPTQNEA+ Q C Q++GNN TI FAG  GQF
Sbjct: 330 YLGSGPRCGYGELSLPENEPGSSIMPGKINPTQNEAVTQVCAQIIGNNQTIIFAGTQGQF 389

Query: 394 ELNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKI 453
           ELN +KP+MI+NLLSS RLL D   SF +HC  GI+AN+++I  L+++SLMLVT+LNPKI
Sbjct: 390 ELNVFKPVMISNLLSSIRLLGDVSKSFRIHCVEGIKANEERIADLMNKSLMLVTALNPKI 449

Query: 454 GYDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499
           GYD A+KVAKNAH KGITLK+SA++L  L+  +FDEWV PE M+GP
Sbjct: 450 GYDEATKVAKNAHKKGITLKESAMQLGSLTESEFDEWVVPEKMIGP 495

>YPL262W Chr16 (47336..48802) [1467 bp, 488 aa] {ON}  FUM1Fumarase,
           converts fumaric acid to L-malic acid in the TCA cycle;
           cytosolic and mitochondrial distribution determined by
           the N-terminal targeting sequence, protein conformation,
           and status of glyoxylate shunt; phosphorylated in
           mitochondria
          Length = 488

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/484 (70%), Positives = 400/484 (82%), Gaps = 2/484 (0%)

Query: 18  FRNCQ-RSFSITPVSHSIADLQGT-RTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGER 75
           F NC  ++F  +    +I  +  + RTETD+FGEI VPA+KYWGAQTQRSF NFKIGG R
Sbjct: 4   FTNCSCKTFVKSSYKLNIRRMNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIGGAR 63

Query: 76  ERMPEPIIRAFGQQKKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTG 135
           ERMP P++ AFG  KK+AAIVN SLG LD  +  AI QAA+EV+ G L++HFPLVVFQTG
Sbjct: 64  ERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVFQTG 123

Query: 136 SGTQSNMNANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITN 195
           SGTQSNMNANEVISNRAIE+LGG +GSKQVHPNNH NQSQSSNDTFPTVMHIAA  +I N
Sbjct: 124 SGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQIQN 183

Query: 196 TLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKN 255
            L+P L  L+  L++K+KEF+ I+KIGRTHLQDATPLTLGQEFSGY QQ+ N I+R+  +
Sbjct: 184 ELIPELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHS 243

Query: 256 LPELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVH 315
           L  L ++AQGGTAVGTGLNTK GF  + A Q+S +T L F T+PNKFE+LAAHDAIV   
Sbjct: 244 LKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIVECS 303

Query: 316 ASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACV 375
            +LNTLACSLFKI+QDIRYL SGPRCGY EL +PENEPGSSIMPGKVNPTQNEA+ Q CV
Sbjct: 304 GALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCV 363

Query: 376 QVMGNNSTISFAGASGQFELNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKI 435
           QVMGNN+ I+FAG+ GQFELN +KP+MIANLL+S RL++DA +SF +HC  GI+AN+ +I
Sbjct: 364 QVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRI 423

Query: 436 DRLLHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSALELDILSSKQFDEWVRPEN 495
             LL +SLMLVT+LNPKIGYDAASKVAKNAH KGITLK+SALEL +L+ K+FDEWV PE+
Sbjct: 424 HELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVVPEH 483

Query: 496 MLGP 499
           MLGP
Sbjct: 484 MLGP 487

>Smik_6.470 Chr6 complement(772380..773846) [1467 bp, 488 aa] {ON}
           YPL262W (REAL)
          Length = 488

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/459 (72%), Positives = 389/459 (84%)

Query: 41  RTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSL 100
           RTETD+FGEI VPA+KYWGAQTQRSF NFKIGG RERMP P++ AFG  KK+AAIVN SL
Sbjct: 29  RTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88

Query: 101 GTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTL 160
           G LD  +  AI +AA+EV+ G L++HFPLVVFQTGSGTQSNMNANEVISNRAIE+LGG +
Sbjct: 89  GGLDPKISKAIQEAADEVASGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 161 GSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIK 220
           GSK+VHPNNH NQSQSSNDTFPTVMHIAA  +I N L+P L  L+  L++K+KEF+ I+K
Sbjct: 149 GSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELANLKNALEAKSKEFDHIVK 208

Query: 221 IGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFA 280
           IGRTHLQDATPLTLGQEFSGY QQ+ N I+R+  +L  L ++AQGGTAVGTGLNTK GF 
Sbjct: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 281 EQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPR 340
            + A Q+S +T L F T+PNKFE+LAAHDAIV    +LNTLACSLFKI+QDIRYL SGPR
Sbjct: 269 VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 341 CGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKP 400
           CGY EL +PENEPGSSIMPGKVNPTQNEA+ Q CVQVMGNN+ I+FAG+ GQFELN +KP
Sbjct: 329 CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388

Query: 401 LMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASK 460
           +MIANLL+S RL++DA +SF +HC  GI+AN+ +I  LL +SLMLVT+LNPKIGYDAASK
Sbjct: 389 VMIANLLNSIRLITDAAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 461 VAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499
           VAKNAH KGITLK+SALEL +L+ K+FDEWV PENMLGP
Sbjct: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487

>Skud_16.16 Chr16 (26407..27873) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/459 (72%), Positives = 389/459 (84%)

Query: 41  RTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSL 100
           R ETD+FGEI VPA+KYWGAQTQRSF NFKIGG RERMP P++ AFG  KK+AA+VN SL
Sbjct: 29  RIETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAVVNESL 88

Query: 101 GTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTL 160
           G LD  +  AI QAA+EV+ G L++HFPLVVFQTGSGTQSNMNANEVISNRAIE+LGG +
Sbjct: 89  GGLDPKISKAIQQAADEVTSGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 161 GSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIK 220
           GSK+VHPNNH NQSQSSNDTFPTVMHIAA  +I N L+P L  L+  L++K+KEFE I+K
Sbjct: 149 GSKEVHPNNHCNQSQSSNDTFPTVMHIAASLQIQNELIPELTNLKNALEAKSKEFEHIVK 208

Query: 221 IGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFA 280
           IGRTHLQDATPLTLGQEFSGY QQ+ N I+R+  +L  L ++AQGGTAVGTGLNTK GF 
Sbjct: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHSLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 281 EQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPR 340
            + A Q+S++T L F T+PNKFE+LAAHDAIV    +LNTLACSLFKI+QDIRYL SGPR
Sbjct: 269 IKIAEQISSETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 341 CGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKP 400
           CGY EL +PENEPGSSIMPGKVNPTQNEA+ Q CVQVMGNN+ I+FAG+ GQFELN +KP
Sbjct: 329 CGYHELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFAGSQGQFELNVFKP 388

Query: 401 LMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASK 460
           +MIANLL+S RL++D+ +SF +HC  GI+AN+ +I  LL +SLMLVT+LNPKIGYDAASK
Sbjct: 389 VMIANLLNSIRLITDSAYSFRVHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 461 VAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499
           VAKNAH KGITLK+SALEL +L+ K+FDEWV PENMLGP
Sbjct: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487

>Suva_16.43 Chr16 (62871..64337) [1467 bp, 488 aa] {ON} YPL262W
           (REAL)
          Length = 488

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/459 (72%), Positives = 384/459 (83%)

Query: 41  RTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSL 100
           RTETD+FGEI VPA+KYWGAQTQRSF NFKIGG RERMP P++ AFG  KK+AAIVN SL
Sbjct: 29  RTETDAFGEINVPADKYWGAQTQRSFQNFKIGGARERMPLPLVHAFGVLKKSAAIVNESL 88

Query: 101 GTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTL 160
           G LD  +  AI QAA+EV+ G L++HFPLVVFQTGSGTQSNMNANEVISNRAIE+LGG +
Sbjct: 89  GGLDPKVSKAIQQAADEVAAGKLDDHFPLVVFQTGSGTQSNMNANEVISNRAIEILGGKI 148

Query: 161 GSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIK 220
           GSKQVHPNN  NQSQSSNDTFPTVMHIAA  +I   L+P L  L+  L++K+KEFE I+K
Sbjct: 149 GSKQVHPNNDCNQSQSSNDTFPTVMHIAASLQIEKELIPELTNLKNALEAKSKEFEHIVK 208

Query: 221 IGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFA 280
           IGRTHLQDATPLTLGQEFSGY QQ+ N I+R+   L  L ++AQGGTAVGTGLNTK GF 
Sbjct: 209 IGRTHLQDATPLTLGQEFSGYVQQVENGIQRVAHTLKTLSFLAQGGTAVGTGLNTKPGFD 268

Query: 281 EQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPR 340
            + A Q+S +T L F T+PNKFE+LAAHDAIV    +LNTLACSLFKI+QDIRYL SGPR
Sbjct: 269 VKIAEQISKETGLKFQTAPNKFEALAAHDAIVECSGALNTLACSLFKIAQDIRYLGSGPR 328

Query: 341 CGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKP 400
           CGY EL +PENEPGSSIMPGKVNPTQNEA+ Q CVQVMGNN+ I+F G+ GQFELN +KP
Sbjct: 329 CGYNELMLPENEPGSSIMPGKVNPTQNEALTQVCVQVMGNNAAITFGGSQGQFELNVFKP 388

Query: 401 LMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASK 460
           +MIANLL+S RL++DA  SF +HC  GI+AN+ +I  LL +SLMLVT+LNPKIGYDAASK
Sbjct: 389 VMIANLLNSIRLIADASRSFRIHCVEGIKANEPRIHELLTKSLMLVTALNPKIGYDAASK 448

Query: 461 VAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499
           VAKNAH KGITLK+SALEL +L+ K+FDEWV PENMLGP
Sbjct: 449 VAKNAHKKGITLKESALELGVLTEKEFDEWVVPENMLGP 487

>TBLA0G01000 Chr7 (252070..253467) [1398 bp, 465 aa] {ON} Anc_6.13
           YPL262W
          Length = 465

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/460 (70%), Positives = 391/460 (85%)

Query: 40  TRTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNS 99
           TR E D FGE++VPANKYWGAQTQR+  NF IGGERERMPEP+I A+G  KK+ AIVN S
Sbjct: 4   TRIEVDGFGELEVPANKYWGAQTQRALNNFHIGGERERMPEPLILAYGILKKSVAIVNES 63

Query: 100 LGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGT 159
           LGTLD  +  AI +AA+EV++G LNEHFPLVVFQTGSGTQ+NMN NEVISNRAIE+LGG 
Sbjct: 64  LGTLDPKISKAIQEAADEVAKGSLNEHFPLVVFQTGSGTQTNMNVNEVISNRAIEILGGQ 123

Query: 160 LGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKII 219
           LGSK VHPNNHVNQSQS+ND+FPT MHI+A+ E+   LLP L  LR+ L  K+ EF KI+
Sbjct: 124 LGSKTVHPNNHVNQSQSTNDSFPTAMHISAVREVVFKLLPELEKLRDALKDKSIEFNKIV 183

Query: 220 KIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGF 279
           KIGRTHLQDATPLTLGQEFSGY QQ+ N I R++ +L  L++IAQGGTAVGTG+NTK  F
Sbjct: 184 KIGRTHLQDATPLTLGQEFSGYVQQVENGITRVQNSLTNLKFIAQGGTAVGTGINTKKDF 243

Query: 280 AEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGP 339
               A+Q+S +T + F T+PNKFE+LA+HDAIV    +LNTLACSLFKISQDIR+L SGP
Sbjct: 244 DILVAKQISLETGIEFKTAPNKFEALASHDAIVECSGALNTLACSLFKISQDIRFLGSGP 303

Query: 340 RCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYK 399
           RCGYGELS+PENEPGSSIMPGKVNPTQNEAMCQAC+QVMGNNS I+FAGASGQFELNTYK
Sbjct: 304 RCGYGELSLPENEPGSSIMPGKVNPTQNEAMCQACIQVMGNNSAITFAGASGQFELNTYK 363

Query: 400 PLMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAAS 459
           PLMI+NLL+S RLL+D+  SF +HC  GI+AN+DKI++LL+ESLMLVT+LNPKIGYDAA+
Sbjct: 364 PLMISNLLNSIRLLTDSCNSFRIHCIVGIRANEDKINKLLNESLMLVTALNPKIGYDAAT 423

Query: 460 KVAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499
            +AK+AH  G+TLK++AL+  +L+++QFDEW+ PE+M+ P
Sbjct: 424 AIAKDAHKNGLTLKEAALKSKLLTAEQFDEWIVPESMVHP 463

>NDAI0I02470 Chr9 complement(567782..569209) [1428 bp, 475 aa] {ON}
           Anc_6.13 YPL262W
          Length = 475

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/459 (71%), Positives = 394/459 (85%)

Query: 41  RTETDSFGEIQVPANKYWGAQTQRSFMNFKIGGERERMPEPIIRAFGQQKKAAAIVNNSL 100
           R ETDSFGEI+VP+NKYWGAQTQRSF NFKIGGERE++P PII+AFG  KK+AAIVN SL
Sbjct: 15  RVETDSFGEIKVPSNKYWGAQTQRSFQNFKIGGEREKIPLPIIKAFGILKKSAAIVNQSL 74

Query: 101 GTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVISNRAIELLGGTL 160
           GTLD ++   I++A++EV QG LN+HFPLVVFQTGSGTQ+NMNANEVISNRA EL+G  L
Sbjct: 75  GTLDPSIATPIIKASDEVIQGKLNDHFPLVVFQTGSGTQTNMNANEVISNRANELIGAEL 134

Query: 161 GSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEFEKIIK 220
           GSK++HPNNHVNQSQSSNDTFP+VMHIAA+ E+ N L+P L  L+ +LD+KAKE+  I+K
Sbjct: 135 GSKKIHPNNHVNQSQSSNDTFPSVMHIAAVLELNNNLIPQLTELKNSLDNKAKEYANIVK 194

Query: 221 IGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNTKIGFA 280
           IGRTHLQDATPLTLGQEFSGY QQLTN I+RI+ +L  L+++AQGGTAVGTGLNTK+GF 
Sbjct: 195 IGRTHLQDATPLTLGQEFSGYVQQLTNGIERIQASLYHLKFLAQGGTAVGTGLNTKVGFD 254

Query: 281 EQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPR 340
           +  A+++S +T + F T+PNKFE+LAAHDAIV   +++ T+A SLFKI+QDIRYL SGPR
Sbjct: 255 KMIAQEVSKETGIDFETAPNKFEALAAHDAIVFASSAITTVAGSLFKIAQDIRYLGSGPR 314

Query: 341 CGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKP 400
           CGYGEL +PENEPGSSIMPGKVNPTQNEAM Q  +Q+MGNN TI  AG+ GQFELN YKP
Sbjct: 315 CGYGELQLPENEPGSSIMPGKVNPTQNEAMTQVALQIMGNNQTIVMAGSQGQFELNVYKP 374

Query: 401 LMIANLLSSTRLLSDAIFSFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASK 460
           LMIANLL+S RL+SDA  SF +HC  G++AN DKI+  LH+SLMLVT+LNPKIGYDAASK
Sbjct: 375 LMIANLLNSIRLMSDACHSFKIHCVDGLKANTDKINENLHKSLMLVTALNPKIGYDAASK 434

Query: 461 VAKNAHHKGITLKQSALELDILSSKQFDEWVRPENMLGP 499
           +AKNAH K ITLK+SALEL +L+ ++FD+WV PENM+GP
Sbjct: 435 LAKNAHAKNITLKESALELGLLTEEEFDQWVIPENMIGP 473

>SAKL0D09746g Chr4 complement(808721..810115) [1395 bp, 464 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 464

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 97/240 (40%), Gaps = 21/240 (8%)

Query: 144 ANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIV 203
           ANE    R  E++G  +  K       V+  +S ND   T M I     +   LLP L  
Sbjct: 92  ANE---RRLGEIIGREISGK-------VHTGRSRNDQVATDMRIYCRDILNEVLLPALQA 141

Query: 204 LRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIA 263
             + L ++AKE   ++  G THLQ A P+      S Y    T    R+++ +  L    
Sbjct: 142 FIKVLTTRAKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYNRLKQIVERLNKSP 201

Query: 264 QGGTAVGTGLNTKIGFAEQF-ARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLA 322
            G  A+        G   +F AR L  Q  +      N   +++  D +V +        
Sbjct: 202 LGAGALA---GHPYGIDREFLARGLGFQGVIG-----NSLTAVSDRDFVVEIMFWGTLFM 253

Query: 323 CSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNS 382
             + + S+D+  + S    G+ +LS      GSS+MP K NP   E +     +V G  S
Sbjct: 254 NHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNPDSLELLRGKAGRVFGELS 311

>TBLA0F03480 Chr6 (857021..858421) [1401 bp, 466 aa] {ON} Anc_1.354
           YHR018C
          Length = 466

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 95/227 (41%), Gaps = 12/227 (5%)

Query: 156 LGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEF 215
           LG  +G+   H    V+  +S ND   T + I     +   LLP +I L + +  +A+  
Sbjct: 96  LGEIIGT---HIAGKVHTGRSRNDQCVTDLRIYCRDILVEKLLPFMIDLVQVITKRAENE 152

Query: 216 EKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNT 275
             I+  G THLQ A P+      S Y    T   KR+++ L  L     G  A+      
Sbjct: 153 IDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQVLERLNKCPLGAGAIA---GH 209

Query: 276 KIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYL 335
             G   Q+   LS++   + +   N   +++  D IV++          + + S+D+  +
Sbjct: 210 PYGIDRQY---LSDELGFNSIIG-NSLVAVSDRDFIVDIMFWSTLFMNHISRFSEDL-II 264

Query: 336 ASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNS 382
            S    G+ +LS      GSS+MP K N    E +     +V G  S
Sbjct: 265 YSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGQLS 310

>NDAI0J01950 Chr10 (485753..487201) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 72/323 (22%), Positives = 141/323 (43%), Gaps = 30/323 (9%)

Query: 190 LTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAI 249
           L +  + ++P L+ + + L   A E++ +  +G TH Q A   TLG+  + + Q+L   +
Sbjct: 121 LRDAYDLVIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 250 KRIEKNLPELQYIAQGGT--------AVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNK 301
           +   +   ++      GT        A+  G + K+   ++   +L     L F T    
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTEL-----LGFDTVYPV 235

Query: 302 FESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIP--ENEPGSSIMP 359
                +    ++V A L++ A +  K++ DIR LA+       EL  P  +++ GSS M 
Sbjct: 236 TGQTYSRKIDIDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAMA 290

Query: 360 GKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANL-LSSTRLLSDAIF 418
            K NP + E +C +  + +G+  + +   AS Q+   T     I  + L S  L +D + 
Sbjct: 291 YKRNPMRCERVC-SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTTDILL 349

Query: 419 SFNLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGY--------DAASKVAKNAHHKGI 470
           S  L+ ++G+      I+R +   L  + + N  +          D   ++   +H    
Sbjct: 350 STLLNISSGLVVYPKVIERRIKSELPFMATENIIMAMVEKKASRQDVHERIRVLSHQAAA 409

Query: 471 TLKQSALELDILSSKQFDEWVRP 493
            +K+   + D++   Q DE+ +P
Sbjct: 410 VVKEQGGDNDLIERIQKDEYFKP 432

>NCAS0J01200 Chr10 (209722..211170) [1449 bp, 482 aa] {ON} Anc_4.197
           YLR359W
          Length = 482

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 72/333 (21%), Positives = 144/333 (43%), Gaps = 31/333 (9%)

Query: 190 LTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAI 249
           L +  + ++P L+ + + L   A E++ +  +G TH Q A   TLG+  + + Q+L   +
Sbjct: 121 LRDAYDIIIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDL 180

Query: 250 KRIEKNLPELQYIAQGGT--------AVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNK 301
           +   +   ++      GT        A+  G + K+   ++   +L     L F T    
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTEL-----LGFDTVYPV 235

Query: 302 FESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGK 361
                +    ++V A L + A +  K++ DIR LA+       E    +++ GSS M  K
Sbjct: 236 TGQTYSRKIDIDVLAPLASFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYK 292

Query: 362 VNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANL-LSSTRLLSDAIFSF 420
            NP + E +C +  + +G+  + +   AS Q+   T     I  + L S  L +D + S 
Sbjct: 293 RNPMRCERVC-SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLST 351

Query: 421 NLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGY--------DAASKVAKNAHHKGITL 472
            L+ ++G+      I+R +   L  + + N  +          D   ++   +H     +
Sbjct: 352 LLNISSGLVVYPKVIERRIKSELPFMATENIIMAMVEKNASRQDVHEQIRVLSHQAAAVV 411

Query: 473 KQSALELDILSSKQFDEWVRP-----ENMLGPN 500
           K+   + D++   Q DE+ +P     +++L P+
Sbjct: 412 KEQGGDNDLIQRIQADEFFKPIWGELDDLLEPS 444

>KLLA0A08404g Chr1 complement(743192..744577) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 461

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 99/236 (41%), Gaps = 19/236 (8%)

Query: 144 ANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIV 203
           ANE    R  E++G  +  K       V+  +S ND   T M I     +  T+LP L  
Sbjct: 90  ANE---RRLGEIIGRGIAGK-------VHTGRSRNDQVATDMRIYCRDILNGTVLPALSS 139

Query: 204 LRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIA 263
           L + +  +A+E   ++  G THLQ A P+      S Y    T   KR+++ +  L    
Sbjct: 140 LIKVILQRAEEEIDVLMPGYTHLQRAQPIRWAHWLSCYATYFTEDYKRLQQIVERLNVSP 199

Query: 264 QGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLAC 323
            G  A+        G   +F   L+   N + +   N   ++A  D +V +    +    
Sbjct: 200 LGAGALA---GHPYGIDREF---LAAGLNFNGVIG-NSLTAVADRDFVVEIMFWGSLFMN 252

Query: 324 SLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMG 379
            + + ++D+  + S    G+ +LS      GSS+MP K NP   E +     +V G
Sbjct: 253 HISRFAEDL-IIYSTAEFGFIQLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 306

>YLR359W Chr12 (844282..845730) [1449 bp, 482 aa] {ON}
           ADE13Adenylosuccinate lyase, catalyzes two steps in the
           'de novo' purine nucleotide biosynthetic pathway;
           expression is repressed by adenine and activated by
           Bas1p and Pho2p; mutations in human ortholog ADSL cause
           adenylosuccinase deficiency
          Length = 482

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 67/316 (21%), Positives = 137/316 (43%), Gaps = 26/316 (8%)

Query: 195 NTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEK 254
           + ++P L+ +   L   A E++ +  +G TH Q A   TLG+  + + Q+L   ++  E+
Sbjct: 126 DIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFER 185

Query: 255 NLPELQYIAQGGT--------AVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLA 306
              ++      GT        A+  G + K+   ++   +L     +  +T       + 
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKID 245

Query: 307 AHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQ 366
                ++V A L++ A +  K++ DIR LA+       E    +++ GSS M  K NP +
Sbjct: 246 -----IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYKRNPMR 297

Query: 367 NEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANL-LSSTRLLSDAIFSFNLHCA 425
            E +C +  + +G+  + +   AS Q+   T     I  + L S  L +D + S  L+ +
Sbjct: 298 CERVC-SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLSTLLNIS 356

Query: 426 TGIQANKDKIDRLLHESLMLVTSLNPKIGY--------DAASKVAKNAHHKGITLKQSAL 477
           +G+      I+R +   L  + + N  +          +   ++   +H     +K+   
Sbjct: 357 SGLVVYPKVIERRIKGELPFMATENIIMAMVEKNASRQEVHERIRVLSHQAAAVVKEEGG 416

Query: 478 ELDILSSKQFDEWVRP 493
           E D++   + DE+ +P
Sbjct: 417 ENDLIERVKRDEFFKP 432

>KAFR0A00950 Chr1 (178176..179570) [1395 bp, 464 aa] {ON} Anc_1.354
           YHR018C
          Length = 464

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 96/238 (40%), Gaps = 21/238 (8%)

Query: 144 ANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIV 203
           ANE    R  E++G  +  K       V+  +S ND   T M I     +TN LL  L  
Sbjct: 92  ANE---RRLGEIIGTGIAGK-------VHTGRSRNDQVATDMRIYCRDILTNNLLTYLKE 141

Query: 204 LRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIA 263
           L   +  +A E   I+  G THLQ A P+      S Y    T   KR+++ L  L    
Sbjct: 142 LISVICRRANEEMDILMPGYTHLQRAQPIRWSHWLSFYATYFTEDYKRLQEILARLNVSP 201

Query: 264 QGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFL-TSPNKFESLAAHDAIVNVHASLNTLA 322
            G  A+        G   +F  Q     +L F     N   +++  D +V +    +   
Sbjct: 202 LGAGALA---GHPYGIDREFLAQ-----DLGFSGVIGNSLVAVSDRDFVVEIMFWGSLFM 253

Query: 323 CSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGN 380
             + + S+D+  + S    G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 254 NHISRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 309

>Skud_12.443 Chr12 (784448..785896) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 71/321 (22%), Positives = 137/321 (42%), Gaps = 36/321 (11%)

Query: 195 NTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEK 254
           + ++P L+ +   L   A E++ +  +G TH Q A   TLG+  + + Q+L   ++  E+
Sbjct: 126 DIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFER 185

Query: 255 NLPELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAI--- 311
              ++      GT   TG  T+  F   F     N   +  L +  +   L   D +   
Sbjct: 186 ARNDIGLRGVKGT---TG--TQASFLALFH---GNHDKVEALDA--RVTELLGFDKVYPV 235

Query: 312 ----------VNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGK 361
                     ++V A L++ A +  K++ DIR LA+       E    +++ GSS M  K
Sbjct: 236 TGQTYSRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 362 VNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANL-LSSTRLLSDAIFSF 420
            NP + E +C +  + +G+  + +   AS Q+   T     I  + L S  L +D + S 
Sbjct: 293 RNPMRCERVC-SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLST 351

Query: 421 NLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGY--------DAASKVAKNAHHKGITL 472
            L+ ++G+      I+R +   L  + + N  +          +   ++   +H     +
Sbjct: 352 LLNISSGLVVYPKVIERRIKGELPFMATENIIMAMVEKNASRQEVHERIRVLSHQAAAVV 411

Query: 473 KQSALELDILSSKQFDEWVRP 493
           K+   E D++   + DE+ +P
Sbjct: 412 KEEGGENDLIERVKKDEFFKP 432

>Smik_12.446 Chr12 (783341..784789) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 67/316 (21%), Positives = 136/316 (43%), Gaps = 26/316 (8%)

Query: 195 NTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEK 254
           + ++P L+ +   L   A E++ +  +G TH Q A   TLG+  + + Q+L   ++  E+
Sbjct: 126 DIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDLRNFER 185

Query: 255 NLPELQYIAQGGT--------AVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLA 306
              ++      GT        A+  G + K+   ++   +L     +  +T       + 
Sbjct: 186 ARNDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTYSRKID 245

Query: 307 AHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQ 366
                ++V A L++ A +  K++ DIR LA+       E    + + GSS M  K NP +
Sbjct: 246 -----IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYKRNPMR 297

Query: 367 NEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANL-LSSTRLLSDAIFSFNLHCA 425
            E +C +  + +G+  + +   AS Q+   T     I  + L S  L +D + S  L+ +
Sbjct: 298 CERVC-SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLSTLLNIS 356

Query: 426 TGIQANKDKIDRLLHESLMLVTSLNPKIGY--------DAASKVAKNAHHKGITLKQSAL 477
           +G+      I+R +   L  + + N  +          +   ++   +H     +K+   
Sbjct: 357 SGLVVYPKVIERRIKGELPFMATENIIMAMVEKNASRQEVHERIRVLSHQAAAVVKEEGG 416

Query: 478 ELDILSSKQFDEWVRP 493
           E D++   + DE+ +P
Sbjct: 417 ENDLIERVKNDEFFKP 432

>ZYRO0B07964g Chr2 complement(620761..622209) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 70/321 (21%), Positives = 135/321 (42%), Gaps = 26/321 (8%)

Query: 190 LTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAI 249
           L +  + ++P LI + + L   A  ++ +  +G TH Q A   TLG+  + + Q L   +
Sbjct: 121 LRDAYDVIIPKLINVIDRLSKFALNYKDVPVLGWTHFQPAQLTTLGKRVTLWIQDLLWDL 180

Query: 250 KRIEKNLPELQYIAQGGT--------AVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNK 301
           +  ++   ++      GT        A+  G + K+   +Q   +L     L F T    
Sbjct: 181 RNFDRARNDIGLRGVKGTTGTQASFLALFHGNHDKVEELDQRVTEL-----LGFETVYPV 235

Query: 302 FESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGK 361
                +    ++V A L + A +  K++ DIR LA+       E    + + GSS M  K
Sbjct: 236 TGQTYSRKIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKTQIGSSAMAYK 292

Query: 362 VNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANL-LSSTRLLSDAIFSF 420
            NP + E +C +  + MG+    +   AS Q+   T     I  + L S  L +D + S 
Sbjct: 293 RNPMRCERVC-SLARHMGSLFNDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLST 351

Query: 421 NLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGY--------DAASKVAKNAHHKGITL 472
            L+ ++G+      I+R ++  L  + + N  +          +   K+   +H     +
Sbjct: 352 LLNISSGMVVYPKVIERRINSELPFMATENIIMAMVEKGASRQEVHEKIRVLSHQAAAVV 411

Query: 473 KQSALELDILSSKQFDEWVRP 493
           K+   + D++   + D + +P
Sbjct: 412 KEEGGDNDLIERVKNDPFFKP 432

>AEL019W Chr5 (600410..601819) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR018C (ARG4)
          Length = 469

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 64/293 (21%), Positives = 118/293 (40%), Gaps = 38/293 (12%)

Query: 90  KKAAAIVNNSLGTLDDTLKDAIVQAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANEVIS 149
           +K   +  + L ++ + LK    Q  +E  QG+  +H            +    ANE   
Sbjct: 50  QKTGLLTKDELESIHEGLK----QVEQEWEQGVFVKHVD---------DEDIHTANE--- 93

Query: 150 NRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLD 209
            R  E++G        H +  V+  +S ND   T M +     + + + P L  L + L 
Sbjct: 94  RRLGEIIGR-------HISGKVHTGRSRNDQVATDMRLYCREMLQDKVEPALFELIKVLL 146

Query: 210 SKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAV 269
            +A+E   ++  G THLQ A P+      S Y        KR+++ +  L     G  A+
Sbjct: 147 HRAREEIDVLMPGYTHLQRAQPIRWSHWLSCYATYFVEDFKRLKEVIARLNQSPLGAGAL 206

Query: 270 G---TGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLF 326
                G++      E  A +L     +      N   +++  D +V + +  +     + 
Sbjct: 207 AGHPYGIDR-----EYLACELGFDGVIG-----NSMTAVSDRDFVVEIMSWGSLFMNHIS 256

Query: 327 KISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMG 379
           ++++D+  + S    G+ +L+      GSS+MP K NP   E +     +V G
Sbjct: 257 RLAEDL-IIYSTAEFGFVKLA-DAYSTGSSLMPQKRNPDSLELLRGKSGRVFG 307

>Kwal_47.18066 s47 (668459..669907) [1449 bp, 482 aa] {ON} YLR359W
           (ADE13) - Adenylosuccinate Lyase [contig 198] FULL
          Length = 482

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 71/330 (21%), Positives = 143/330 (43%), Gaps = 25/330 (7%)

Query: 190 LTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAI 249
           L +  + L+P L+ + + L   A E++ +  +G TH Q A   TLG+  + + Q+L   +
Sbjct: 121 LRDAYDILIPKLVNVIDRLSKFAMEWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDL 180

Query: 250 KRIEKNLPELQYIAQGGTAVGTG-----LNTKIGFAEQFARQLSNQTNLSFLTSPNKFES 304
           +   +   ++      GT    G      ++     E   ++++    L F T       
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQGSFLALFHSDHDKVEALDKRVTEL--LGFDTVYPVTGQ 238

Query: 305 LAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNP 364
             +    ++V A L++ A +  K++ DIR LA+       E    +++ GSS M  K NP
Sbjct: 239 TYSRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYKRNP 295

Query: 365 TQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANL-LSSTRLLSDAIFSFNLH 423
            + E +C +  + +G+  + +   AS Q+   T     I  + L S  L +D + S  L+
Sbjct: 296 MRCERVC-SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILLSTLLN 354

Query: 424 CATGIQANKDKIDRLLHESLMLVTSLN---PKIGYDAASKVAKNA-----HHKGITLKQS 475
            ++G+      I+R +   L  + + N     +G  A+ +    A     H     +K+ 
Sbjct: 355 ISSGLVVYPKVIERRIKSELPFMATENFIMAMVGKGASRQEVHEAIRVLSHQAAAVVKEE 414

Query: 476 ALELDILSSKQFDEWVRP-----ENMLGPN 500
             + D++   + D++  P     +++L P+
Sbjct: 415 GGDNDLIERVKTDKFFEPIWEELDSLLDPS 444

>CAGL0B02794g Chr2 complement(269303..270751) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359w ADE13
          Length = 482

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 119/270 (44%), Gaps = 18/270 (6%)

Query: 190 LTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAI 249
           L +  + ++P L+ +   L   A E++ +  +G TH Q A   TLG+  + + Q+L   +
Sbjct: 121 LRDAYDIVIPKLVNVINRLAKFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 250 KRIEKNLPELQYIAQGGTAVGTGLNTKIGFAEQF------ARQLSNQTN--LSFLTSPNK 301
           +  E+   ++      GT   TG  T+  F   F        +L  +    L F T    
Sbjct: 181 RNFERARNDIGLRGVKGT---TG--TQASFLALFHGNHDKVEELDERVTELLGFDTVYPV 235

Query: 302 FESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGK 361
                +    ++V A L++ A S  K++ DIR LA+       E    +++ GSS M  K
Sbjct: 236 TGQTYSRKIDIDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 362 VNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANL-LSSTRLLSDAIFSF 420
            NP + E +C +  + +G+  + +   AS Q+   T     I  + L S  L +D + + 
Sbjct: 293 RNPMRCERVC-SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTTDILLTT 351

Query: 421 NLHCATGIQANKDKIDRLLHESLMLVTSLN 450
            L+ ++G+      I+R +   L  + + N
Sbjct: 352 ILNISSGLVVYPKVIERRIKSELPFMATEN 381

>Suva_10.459 Chr10 (803809..805257) [1449 bp, 482 aa] {ON} YLR359W
           (REAL)
          Length = 482

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 67/321 (20%), Positives = 138/321 (42%), Gaps = 26/321 (8%)

Query: 190 LTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAI 249
           L +  + ++P L+ +   L   A E++ +  +G TH Q A   TLG+  + + Q+L   +
Sbjct: 121 LRDAYDIIIPKLVNVINRLAKFAMEYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDL 180

Query: 250 KRIEKNLPELQYIAQGGT--------AVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNK 301
           +  E+   ++      GT        A+  G + K+   ++   +L     +  +T    
Sbjct: 181 RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKVEALDERVTELLGFDKVYPVTGQTY 240

Query: 302 FESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGK 361
              +      ++V A L++ A +  K++ DIR LA+       E    +++ GSS M  K
Sbjct: 241 SRKID-----IDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 362 VNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANL-LSSTRLLSDAIFSF 420
            NP + E +C +  + +G+    +   AS Q+   T     I  + L S  L +D + S 
Sbjct: 293 RNPMRCERVC-SLARHLGSLFNDTVQTASVQWFERTLDDSAIRRISLPSAFLTADILLST 351

Query: 421 NLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGY--------DAASKVAKNAHHKGITL 472
            L+ ++G+      I+R +   L  + + N  +          +   ++   +H     +
Sbjct: 352 LLNISSGLVVYPKVIERRIKGELPFMATENIIMAMVEKNASRQEVHERIRVLSHQAAAVV 411

Query: 473 KQSALELDILSSKQFDEWVRP 493
           K+   E D++   + D++ +P
Sbjct: 412 KEEGGENDLIERVKKDKFFQP 432

>Kpol_1018.125 s1018 complement(330965..332347) [1383 bp, 460 aa]
           {ON} complement(330965..332347) [1383 nt, 461 aa]
          Length = 460

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/241 (25%), Positives = 98/241 (40%), Gaps = 19/241 (7%)

Query: 144 ANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIV 203
           ANE    R  EL+G  +  K       V+  +S ND   T + I     I + LLP+L  
Sbjct: 89  ANE---RRLGELIGTDISGK-------VHTGRSRNDQCVTDLRIYCRDIIQDKLLPSLKS 138

Query: 204 LRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIA 263
           L + L  + +    I+  G THLQ A P+      S Y    T   KR+++ L  L    
Sbjct: 139 LIQVLVKRGEGEIGILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLKQLLDRLNVSP 198

Query: 264 QGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLAC 323
            G  A+        G   +F   L+N    + +   N   +++  D +V +         
Sbjct: 199 LGAGALA---GHPYGIDREF---LANGLGFNGVIG-NSLVAVSDRDFVVELLFWGTLFMN 251

Query: 324 SLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNST 383
            + + ++D+  + S    G+  LS      GSS+MP K N    E +     +V GN S 
Sbjct: 252 HISRFAEDL-IIYSTAEFGFITLS-DAYSTGSSLMPQKKNSDSLELLRGKSGRVFGNLSG 309

Query: 384 I 384
           +
Sbjct: 310 L 310

>TPHA0B01040 Chr2 complement(235467..236915) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 124/296 (41%), Gaps = 18/296 (6%)

Query: 190 LTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAI 249
           L +  + ++P L+ + + L   A E++ +  +G TH Q A   TLG+  + + Q+L   +
Sbjct: 121 LRDAYDVIIPKLVNVIDRLSKFAMEYKDLPVLGWTHFQPAQLTTLGKRSTLWIQELLWDL 180

Query: 250 KRIEKNLPELQYIAQGGTAVGTGLNTKIGFAEQF------ARQLSNQTN--LSFLTSPNK 301
           +   +   +L      GT   TG  T+  F   F        +L  +    L F T    
Sbjct: 181 RNFVRARNDLGLRGVKGT---TG--TQASFLALFHGNHDKVEELDERVTELLGFDTVYPV 235

Query: 302 FESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGK 361
                +    ++V A L + A +  K++ DIR LA+       E    +++ GSS M  K
Sbjct: 236 TGQTYSRKIDIDVLAPLASFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 362 VNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANL-LSSTRLLSDAIFSF 420
            NP + E +C +  + +G+  + +   AS Q+   T     I  + L    L +D + S 
Sbjct: 293 RNPMRCERVC-SLARHLGSLYSDAVQTASVQWFERTLDDSAIRRISLPGAFLTTDILLST 351

Query: 421 NLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGYDAASKVAKNAHHKGITLKQSA 476
            L+ ++G+      I+R +   L  + + N  +         ++ H     L Q A
Sbjct: 352 LLNISSGLVVYPKVIERRIKSELPFMATENIIMAMVEKGASRQDVHENIRVLSQQA 407

>NDAI0G05940 Chr7 (1470741..1472129) [1389 bp, 462 aa] {ON}
           Anc_1.354 YHR018C
          Length = 462

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 94/238 (39%), Gaps = 21/238 (8%)

Query: 144 ANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIV 203
           ANE    R  E++G  +  K       V+  +S ND   T + I     +   L P +  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPGMTS 140

Query: 204 LRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIA 263
           L E L  +A+E   I+  G THLQ A P+      S Y    T  +KR+++ L       
Sbjct: 141 LIEVLIKRAEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLKQILERFNKSP 200

Query: 264 QGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFL-TSPNKFESLAAHDAIVNVHASLNTLA 322
            G  A+        G   +F  +      L F     N   +++  D +V +        
Sbjct: 201 LGAGALA---GHPYGIDREFLAE-----GLGFDGVIGNSLVAVSDRDFVVELMFWGTLFM 252

Query: 323 CSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGN 380
             + + ++D+  + S    G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 253 NHISRFAEDL-VIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>SAKL0B04972g Chr2 (430349..431797) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 62/259 (23%), Positives = 116/259 (44%), Gaps = 22/259 (8%)

Query: 190 LTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAI 249
           L +  + L+P L+ +   L   A E++ +  +G TH Q A   TLG+  + + Q+L   +
Sbjct: 121 LRDAYDILIPKLVNVINRLSQFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDL 180

Query: 250 KRIEKNLPELQYIAQGGT--------AVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNK 301
           +   +   ++      GT        A+  G + K+   ++   +L     L F T    
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTEL-----LGFDTVYPV 235

Query: 302 FESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIP--ENEPGSSIMP 359
                +    ++V A L++ A +  K++ DIR LA+       E+  P  +++ GSS M 
Sbjct: 236 TGQTYSRKIDIDVLAPLSSFAATAHKMATDIRLLAN-----LKEMEEPFEKSQIGSSAMA 290

Query: 360 GKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANL-LSSTRLLSDAIF 418
            K NP + E +C +  + +G+  + +   AS Q+   T     I  + L S  L +D + 
Sbjct: 291 YKRNPMRCERVC-SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILL 349

Query: 419 SFNLHCATGIQANKDKIDR 437
           S  L+ ++G+      I+R
Sbjct: 350 STLLNISSGLVVYPKVIER 368

>KNAG0I01560 Chr9 (303704..305092) [1389 bp, 462 aa] {ON} Anc_1.354
           YHR018C
          Length = 462

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 89/225 (39%), Gaps = 12/225 (5%)

Query: 156 LGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEF 215
           LG  +G    H    V+  +S ND   T M I     +   LLP +  L + L  +A+  
Sbjct: 96  LGEIIGR---HIAGKVHTGRSRNDQVVTDMRIYCRDILNEKLLPFMADLIKVLVKRAENE 152

Query: 216 EKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVGTGLNT 275
              +  G THLQ A P+      S Y    T   KR+++ L  L     G  A+      
Sbjct: 153 IDTLMPGYTHLQRAQPIRWAHWLSSYATYFTEDYKRLKQILERLNVSPLGAGALA---GH 209

Query: 276 KIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDIRYL 335
             G   +F   L+   N   +   N   +++  D +V +          + + ++D+  +
Sbjct: 210 PYGIDREF---LAEGLNFGGVIG-NSLVAVSDRDFVVELMFWGTLFMNHISRFAEDL-II 264

Query: 336 ASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGN 380
            S    G+ +LS      GSS+MP K N    E +     +V G+
Sbjct: 265 YSTAEFGFVKLS-DSYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>KLLA0B13189g Chr2 complement(1153780..1155228) [1449 bp, 482 aa]
           {ON} highly similar to uniprot|Q05911 Saccharomyces
           cerevisiae YLR359W ADE13 Adenylosuccinate lyase
           catalyzes two steps in the 'de novo' purine nucleotide
           biosynthetic pathway
          Length = 482

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/260 (24%), Positives = 115/260 (44%), Gaps = 24/260 (9%)

Query: 190 LTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAI 249
           L +  + L+P L+ +   L   A E++ +  +G TH Q A   TLG+  + + Q+L   +
Sbjct: 121 LRDAYDILIPKLVNVINRLSKFALEYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDL 180

Query: 250 KRIEKNLPELQYIAQGGTAVGT---------GLNTKIGFAEQFARQLSNQTNLSFLTSPN 300
           +   +   ++      GT  GT         G + K+   ++   +L     L F T   
Sbjct: 181 RNFVRARNDIGLRGVKGTT-GTQASFLTLFHGDHDKVEALDKRVAEL-----LGFSTVYP 234

Query: 301 KFESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIP--ENEPGSSIM 358
                 +    ++V A L++ A +  K++ DIR LA+       EL  P  +++ GSS M
Sbjct: 235 VTGQTYSRKIDIDVLAPLSSFAATAHKMATDIRLLAN-----LKELEEPFEKSQIGSSAM 289

Query: 359 PGKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANL-LSSTRLLSDAI 417
             K NP + E +C +  + +G+    +   AS Q+   T     I  + L S  L +D +
Sbjct: 290 AYKRNPMRCERVC-SLARHLGSLFNDAVQTASVQWFERTLDDSAIRRISLPSAFLTADIL 348

Query: 418 FSFNLHCATGIQANKDKIDR 437
            S  L+ ++G+      I+R
Sbjct: 349 LSTLLNISSGLVVYPKVIER 368

>CAGL0I08987g Chr9 complement(871699..873084) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018c ARLY
          Length = 461

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/240 (25%), Positives = 94/240 (39%), Gaps = 21/240 (8%)

Query: 144 ANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIV 203
           ANE    R  EL+G  +  K       V+  +S ND   T M I     +   + P +  
Sbjct: 92  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDMRIYCREILNEKIFPAMKS 141

Query: 204 LRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIA 263
           L   L ++A++   I+  G THLQ A P+      S Y    T  +KR+E+    L    
Sbjct: 142 LINVLVNRAEKEIDILMPGYTHLQRAQPIRWAHWLSSYATYFTEDLKRLEQIAERLNKSP 201

Query: 264 QGGTAVGTGLNTKIGFAEQFARQLSNQTNLSF-LTSPNKFESLAAHDAIVNVHASLNTLA 322
            G  A+        G   QF  +      L F     N   +++  D +V +        
Sbjct: 202 LGSGALA---GHPYGIDRQFLAE-----GLGFNGVIGNSLVAVSDRDFVVELMFWATLFM 253

Query: 323 CSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNS 382
             + + S+D+  + S    G+ +LS      GSS+MP K N    E +     +V G  S
Sbjct: 254 NHVSRFSEDL-IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGELS 311

>Kpol_1042.16 s1042 (40749..42197) [1449 bp, 482 aa] {ON}
           (40749..42197) [1449 nt, 483 aa]
          Length = 482

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/270 (22%), Positives = 119/270 (44%), Gaps = 18/270 (6%)

Query: 190 LTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAI 249
           L +  + ++P L+ + + L   A E++ +  +G TH Q A   T+G+  + + Q+L   +
Sbjct: 121 LRDAYDIIIPKLVNVIDRLAKFASEYKDLPVLGWTHFQPAQLTTMGKRATLWIQELLWDL 180

Query: 250 KRIEKNLPELQYIAQGGT--------AVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNK 301
           +   +   ++      GT        A+  G + K+   ++   +L     L F T    
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQASFLALFHGDDDKVEALDKRVVEL-----LGFDTVYPV 235

Query: 302 FESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGK 361
                +    ++V A L++ A +  K++ DIR LA+       E    +++ GSS M  K
Sbjct: 236 TGQTYSRKIDIDVLAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 362 VNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANL-LSSTRLLSDAIFSF 420
            NP + E +C +  + +G+  + +   AS Q+   T     I  + L    L +D + S 
Sbjct: 293 RNPMRCERVC-SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPGAFLTADILLST 351

Query: 421 NLHCATGIQANKDKIDRLLHESLMLVTSLN 450
            L+ ++G+      I+R +   L  + + N
Sbjct: 352 LLNISSGLVVYPKVIERRIKSELPFMATEN 381

>TPHA0A02190 Chr1 (452902..454293) [1392 bp, 463 aa] {ON} Anc_1.354
           YHR018C
          Length = 463

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 95/230 (41%), Gaps = 18/230 (7%)

Query: 156 LGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIVLRETLDSKAKEF 215
           LG  +G+K    +  V+  +S ND   T + I     +++ LL NL  L   L ++A+E 
Sbjct: 96  LGEIIGTK---ISGKVHTGRSRNDQCVTDLRIYCREYLSDKLLKNLETLINVLINRAEEE 152

Query: 216 EKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQGGTAVG---TG 272
            + I  G THLQ A P+      S Y        KR+ +    L     G  A+     G
Sbjct: 153 IEFIMPGYTHLQRAQPIRWSHWLSSYATYFLEDYKRLVQLKERLNKSPLGAGALAGHPYG 212

Query: 273 LNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACSLFKISQDI 332
           ++      E  A +L   + +      N   +++  D +V +          + + ++D+
Sbjct: 213 IDR-----EYLAEKLGFDSVIG-----NSLVAVSDRDFVVEILFWSTLFMNHISRFAEDL 262

Query: 333 RYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNS 382
             + S    G+ +LS      GSS+MP K N    E +     +V GN S
Sbjct: 263 -IIYSTAEFGFIKLS-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGNLS 310

>YHR018C Chr8 complement(140011..141402) [1392 bp, 463 aa] {ON}
           ARG4Argininosuccinate lyase, catalyzes the final step in
           the arginine biosynthesis pathway
          Length = 463

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 93/251 (37%), Gaps = 47/251 (18%)

Query: 144 ANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIV 203
           ANE    R  EL+G  +  K       V+  +S ND   T + I     + +TL P L  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDIVNDTLFPALKG 140

Query: 204 LRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIA 263
           L E L  +A+    ++  G THLQ A P+      S Y    T   KR+ + L  L    
Sbjct: 141 LVEVLIKRAEGEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 264 QGGTAV--------------GTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHD 309
            G  A+              G G N+ IG                     N   +++  D
Sbjct: 201 LGAGALAGHPYGIDREFLAEGLGFNSVIG---------------------NSLVAVSDRD 239

Query: 310 AIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEA 369
            IV +          + + ++D+  +      G+ +LS      GSS+MP K N    E 
Sbjct: 240 FIVELMFWGTLFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLEL 297

Query: 370 MCQACVQVMGN 380
           +     +V G+
Sbjct: 298 LRGKSGRVFGD 308

>Skud_8.70 Chr8 complement(121600..122991) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 93/251 (37%), Gaps = 47/251 (18%)

Query: 144 ANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIV 203
           ANE    R  E++G  +  K       V+  +S ND   T + I     + + L P L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDNLFPALKG 140

Query: 204 LRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIA 263
           L + L  +AK    I+  G THLQ A P+      S Y    T   KR+++ L  L    
Sbjct: 141 LVDVLIKRAKGEINILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLDQILHRLNQSP 200

Query: 264 QGGTAV--------------GTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHD 309
            G  A+              G G N+ IG                     N   +++  D
Sbjct: 201 LGAGALAGHPYGIDREFLAEGLGFNSVIG---------------------NSMVAVSDRD 239

Query: 310 AIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEA 369
            IV +          + + ++D+  +      G+ +LS      GSS+MP K N    E 
Sbjct: 240 FIVELMFWGTLFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLEL 297

Query: 370 MCQACVQVMGN 380
           +     +V G+
Sbjct: 298 LRGKSGRVFGD 308

>ZYRO0G00748g Chr7 (57164..58552) [1389 bp, 462 aa] {ON} highly
           similar to uniprot|P04076 Saccharomyces cerevisiae
           YHR018C ARG4 Argininosuccinate lyase catalyzes the final
           step in the arginine biosynthesis pathway
          Length = 462

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 94/238 (39%), Gaps = 21/238 (8%)

Query: 144 ANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIV 203
           ANE    R  E++G  +  K       V+  +S ND   T M I     +   LLP L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQVVTDMRIFCRDTVNEKLLPGLKE 140

Query: 204 LRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIA 263
           L   +  +A++    +  G THLQ A P+      S Y    T  +KR+ + L       
Sbjct: 141 LVSVMVKRAEKEIGYLMPGYTHLQRAQPIRWSHWLSSYATYFTEDLKRLRQLLERFNQSP 200

Query: 264 QGGTAVGTGLNTKIGFAEQF-ARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLA 322
            G  A+        G   +F A +L  Q  +      N   +++  D +V +        
Sbjct: 201 LGAGALA---GHPYGIDREFLAEELGFQGVIG-----NSLVAVSDRDFVVELMFWGTLFM 252

Query: 323 CSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGN 380
             + + ++D+  + S    G+ +L+      GSS+MP K N    E +     +V G+
Sbjct: 253 NHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>KLTH0A03344g Chr1 (289188..290636) [1449 bp, 482 aa] {ON} highly
           similar to uniprot|Q05911 Saccharomyces cerevisiae
           YLR359W ADE13 Adenylosuccinate lyase catalyzes two steps
           in the 'de novo' purine nucleotide biosynthetic pathway
          Length = 482

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 70/321 (21%), Positives = 136/321 (42%), Gaps = 26/321 (8%)

Query: 190 LTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAI 249
           L +  + L+P L+ +   L   A +++ +  +G TH Q A   TLG+  + + Q+L   +
Sbjct: 121 LRDAYDILIPKLVNVINRLSQFALQWKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDL 180

Query: 250 KRIEKNLPELQYIAQGGT--------AVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNK 301
           +   +   ++      GT        A+  G + K+   ++   +L     L F T    
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTEL-----LGFDTVYPV 235

Query: 302 FESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGK 361
                +    ++V A L + A +  K++ DIR LA+       E    +++ GSS M  K
Sbjct: 236 TGQTYSRKIDIDVLAPLCSFAATAHKMATDIRLLANLKEI---EEPFEKSQIGSSAMAYK 292

Query: 362 VNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANL-LSSTRLLSDAIFSF 420
            NP + E +C +  + +G+    +   AS Q+   T     I  + L S  L +D + S 
Sbjct: 293 RNPMRCERVC-SLARHLGSLFNDAVQTASVQWFERTLDDSAIRRISLPSAFLTTDILLST 351

Query: 421 NLHCATGIQANKDKIDRLLHESLMLVTSLN---PKIGYDAASKVAKNA-----HHKGITL 472
            L+ ++G+      I+R +   L  + + N     +G  A+ +    A     H     +
Sbjct: 352 LLNISSGLVVYPKVIERRIKSELPFMATENIIMAMVGKGASRQEVHEAIRVLSHQAAAVV 411

Query: 473 KQSALELDILSSKQFDEWVRP 493
           K+   + D++   + D + +P
Sbjct: 412 KEEGGDNDLIERIKKDNFFQP 432

>TDEL0D02220 Chr4 (428430..429827) [1398 bp, 465 aa] {ON} Anc_1.354
           YHR018C
          Length = 465

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 92/238 (38%), Gaps = 21/238 (8%)

Query: 144 ANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIV 203
           ANE    R  E++G  +  K       V+  +S ND   T + I     + + L P+L  
Sbjct: 91  ANE---RRLGEIIGRNIAGK-------VHTGRSRNDQCVTDLRIYCRDLLNDKLFPDLQA 140

Query: 204 LRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIA 263
           L + +  + KE   ++  G THLQ A P+      S Y    T   KR+ + +     I 
Sbjct: 141 LVDVMIKRGKEEIDVLMPGYTHLQRAQPIRWSHWLSSYATYFTEDFKRLRQIMDR---IN 197

Query: 264 QGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFL-TSPNKFESLAAHDAIVNVHASLNTLA 322
           Q     G       G   +F         L F     N   +++  D IV +        
Sbjct: 198 QSPLGAGALAGHPYGIDREFL-----AAGLGFDGVIGNSLVAVSDRDFIVELMFWGTLFM 252

Query: 323 CSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGN 380
             + + ++D+  + S    G+ +L+      GSS+MP K N    E +     +V G+
Sbjct: 253 NHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGD 308

>Smik_8.83 Chr8 complement(120320..121711) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 61/251 (24%), Positives = 92/251 (36%), Gaps = 47/251 (18%)

Query: 144 ANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIV 203
           ANE    R  EL+G  +  K       V+  +S ND   T + I     +  TL P L  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNGTLFPALKG 140

Query: 204 LRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIA 263
           L + L  +A+    I+  G THLQ A P+      S Y    T   KR+ + L  L    
Sbjct: 141 LVDVLIKRAEGEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLGQILHRLNQSP 200

Query: 264 QGGTAV--------------GTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHD 309
            G  A+              G G N+ IG                     N   +++  D
Sbjct: 201 LGAGALAGHPYGIDREFLAEGLGFNSVIG---------------------NSLVAVSDRD 239

Query: 310 AIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEA 369
            IV +          + + ++D+  +      G+ +LS      GSS+MP K N    E 
Sbjct: 240 FIVELMFWGTLFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLEL 297

Query: 370 MCQACVQVMGN 380
           +     +V G+
Sbjct: 298 LRGKSGRVFGD 308

>Ecym_2749 Chr2 complement(1453019..1454431) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii AEL019W
          Length = 470

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 96/242 (39%), Gaps = 25/242 (10%)

Query: 144 ANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIV 203
           ANE    R  EL+G  +  K       V+  +S ND   T M I     +   +LP +  
Sbjct: 91  ANE---RRLGELIGTAVAGK-------VHTGRSRNDQVATDMRIYCREILNEKILPAVSS 140

Query: 204 LRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIA 263
               L ++A+E   ++  G THLQ A P+      S Y    T    R+ + +  L    
Sbjct: 141 FIRVLINRAREEVDVLMPGYTHLQRAQPIRWSHWLSCYATYFTEDYNRLRQVVERLNQSP 200

Query: 264 QGGTAVG---TGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNT 320
            G  A+     G++ K          L+ Q   + +   N   +++  D ++ +    + 
Sbjct: 201 LGAGALAGHPYGIDRKY---------LAEQLGFNGIIG-NSLVAVSDRDFVIEIMFWGSL 250

Query: 321 LACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGN 380
               + + ++D+  + S    G+  L+      GSS+MP K NP   E +     +V G 
Sbjct: 251 FMNHISRFAEDL-IIYSTAEFGFINLA-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFGQ 308

Query: 381 NS 382
            S
Sbjct: 309 LS 310

>Suva_15.201 Chr15 complement(348498..349889) [1392 bp, 463 aa] {ON}
           YHR018C (REAL)
          Length = 463

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 93/251 (37%), Gaps = 47/251 (18%)

Query: 144 ANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIV 203
           ANE    R  EL+G  +  K       V+  +S ND   T + I     + ++L P +  
Sbjct: 91  ANE---RRLGELIGRDIAGK-------VHTGRSRNDQVVTDLRIYCRDVVNDSLFPAMKG 140

Query: 204 LRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIA 263
           L + L  +A+    I+  G THLQ A P+      S Y    T   KR+ + L  L    
Sbjct: 141 LVDVLVKRAEGEMDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDYKRLVQILHRLNQSP 200

Query: 264 QGGTAV--------------GTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHD 309
            G  A+              G G N+ IG                     N   +++  D
Sbjct: 201 LGAGALAGHPYGIDREFLAEGLGFNSVIG---------------------NSLVAVSDRD 239

Query: 310 AIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEA 369
            IV +          + + ++D+  +      G+ +LS      GSS+MP K N    E 
Sbjct: 240 FIVELMFWGTLFMNHISRFAEDL-IIYCTAEFGFIQLS-DAYSTGSSLMPQKKNADSLEL 297

Query: 370 MCQACVQVMGN 380
           +     +V G+
Sbjct: 298 LRGKSGRVFGD 308

>TDEL0E01760 Chr5 complement(337315..338763) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 61/272 (22%), Positives = 121/272 (44%), Gaps = 22/272 (8%)

Query: 190 LTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAI 249
           L +  + ++P L+ +   L   A +++ +  +G TH Q A   TLG+  + + Q+L   +
Sbjct: 121 LRDAYDLIIPKLVNVINRLSDFALKYKDLPVLGWTHFQPAQLTTLGKRVTLWIQELLWDL 180

Query: 250 KRIEKNLPELQYIAQGGT--------AVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNK 301
           +   +   ++      GT        A+  G + K+   ++   +L     L F T    
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTEL-----LGFDTVYPV 235

Query: 302 FESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIP--ENEPGSSIMP 359
                +    ++V + L++ A +  K++ DIR LA+       E+  P  +++ GSS M 
Sbjct: 236 TGQTYSRKIDIDVLSPLSSFAATAHKMATDIRLLAN-----LKEMEEPFEKSQIGSSAMA 290

Query: 360 GKVNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANL-LSSTRLLSDAIF 418
            K NP + E +C +  + +G+  + +   AS Q+   T     I  + L S  L +D + 
Sbjct: 291 YKRNPMRCERVC-SLARHLGSLFSDAVQTASVQWFERTLDDSAIRRISLPSAFLTADILL 349

Query: 419 SFNLHCATGIQANKDKIDRLLHESLMLVTSLN 450
           S  L+ ++G+      I+R +   L  + + N
Sbjct: 350 STLLNISSGLVVYPKVIERRIKSELPFMATEN 381

>Kwal_27.12782 s27 complement(1373166..1374563) [1398 bp, 465 aa]
           {ON} YHR018C (ARG4) - argininosuccinate lyase [contig
           260] FULL
          Length = 465

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 122/309 (39%), Gaps = 50/309 (16%)

Query: 89  QKKAAAIVNNSLGTLDDTLKDAIV--QAAEEVSQGLLNEHFPLVVFQTGSGTQSNMNANE 146
           QK   A ++NS    +  LK  ++  Q   E+ +GL      ++  +  S +    + +E
Sbjct: 34  QKMYNADLDNSKYYTEGLLKVGLLTEQELSEIHRGL-----EIIRGEWASNSFVEKDGDE 88

Query: 147 VISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITN--TLLPNLIVL 204
            I       LG  +G    H    V+  +S ND   T M I     + N   +L +LI  
Sbjct: 89  DIHTANERRLGEIIGR---HIAGKVHTGRSRNDQVATDMRIYCREALDNLAKILEDLI-- 143

Query: 205 RETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEK-----NLPEL 259
              L    +E + ++  G THLQ A P+      + Y    T   KR+++     N+  L
Sbjct: 144 GAILQRSEQEIDALMP-GYTHLQRAQPIRWSHWLNLYATYFTEDFKRLKQIRERLNVSPL 202

Query: 260 QYIAQGGTAVGTG---LNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHA 316
              A  G   G     L  ++GF++                  N  ++++  D +V +  
Sbjct: 203 GCGALAGHPYGIDREFLAERLGFSDVIG---------------NSLQAVSDRDFVVEI-- 245

Query: 317 SLNTLACSLF-----KISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMC 371
                 CSLF     + S+D+  + S     + +LS      GSS+MP K NP   E + 
Sbjct: 246 ---MFWCSLFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPDSLELLR 300

Query: 372 QACVQVMGN 380
               +V G+
Sbjct: 301 GKSGRVFGS 309

>KNAG0B05840 Chr2 (1150025..1151473) [1449 bp, 482 aa] {ON}
           Anc_4.197 YLR359W
          Length = 482

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 85/190 (44%), Gaps = 16/190 (8%)

Query: 190 LTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAI 249
           L +  + ++P L+ + + L   A +++ +  +G TH Q A   TLG+  + + Q+L   +
Sbjct: 121 LRDAYDLVIPKLVNVIDRLSKFALQYKDLPVLGWTHFQPAQLTTLGKRTTLWIQELLWDL 180

Query: 250 KRIEKNLPELQYIAQGGT--------AVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNK 301
           +   +   ++      GT        A+  G + K+   ++   +L     L F T    
Sbjct: 181 RNFVRARNDIGLRGVKGTTGTQASFLALFHGDHDKVEALDKRVTEL-----LGFDTVYPV 235

Query: 302 FESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGK 361
                +    ++V A L++ A S  K++ DIR LA+       E    +++ GSS M  K
Sbjct: 236 TGQTYSRKIDIDVLAPLSSFAASAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 362 VNPTQNEAMC 371
            NP + E +C
Sbjct: 293 RNPMRCERVC 302

>Ecym_2452 Chr2 (881643..883091) [1449 bp, 482 aa] {ON} similar to
           Ashbya gossypii ABL006C
          Length = 482

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 87/192 (45%), Gaps = 20/192 (10%)

Query: 190 LTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAI 249
           L +  + L+P L+ +   L + A +++ +  +G TH Q A   TLG+  + + Q+L   +
Sbjct: 121 LRDAYDILIPKLVNVINRLSTFAIKYKDLPVLGWTHYQPAQLTTLGKRVTLWIQELLWDL 180

Query: 250 KRIEKNLPELQYIAQGGT--------AVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNK 301
           +   +   ++ +    GT        A+  G + K+   ++   +LS    +  +T    
Sbjct: 181 RNFVRARNDIGFRGVKGTTGTQASFLALFHGDHDKVEALDKRVAELSGFDIIYPVTGQTY 240

Query: 302 FESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIP--ENEPGSSIMP 359
                +    ++V   L++ A +  K++ DIR LA+       EL  P   ++ GSS M 
Sbjct: 241 -----SRKVDIDVLGPLSSFAATSHKLATDIRLLAN-----LKELEEPFEASQIGSSAMA 290

Query: 360 GKVNPTQNEAMC 371
            K NP + E +C
Sbjct: 291 YKRNPMRCERVC 302

>KLTH0G19338g Chr7 complement(1665123..1666520) [1398 bp, 465 aa]
           {ON} highly similar to uniprot|P04076 Saccharomyces
           cerevisiae YHR018C ARG4 Argininosuccinate lyase
           catalyzes the final step in the arginine biosynthesis
           pathway
          Length = 465

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 121/303 (39%), Gaps = 34/303 (11%)

Query: 89  QKKAAAIVNNSLGTLDDTLKDAIVQAAE--EVSQGLLNEHFPLVVFQTGSGTQSNMNANE 146
           QK   A ++NS    +  LK  ++   E  E+ +GL      ++  +  S +    + +E
Sbjct: 34  QKMYNADLDNSKYYTEGLLKAGLLTQEELDEIHRGL-----EIIRGEWASNSFVEKDGDE 88

Query: 147 VISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNT--LLPNLIVL 204
            I       LG  +G    H    V+  +S ND   T M I     + N   +L +L+  
Sbjct: 89  DIHTANERRLGEIIGR---HIAGKVHTGRSRNDQVATDMRIYCREALDNMAKILKDLV-- 143

Query: 205 RETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIAQ 264
              L    +E + ++  G THLQ A P+      + Y    T   KR+ K + E   ++ 
Sbjct: 144 GAILQRAEQEIDALMP-GYTHLQRAQPIRWSHWLNLYATYFTEDFKRL-KQIRERLNVSP 201

Query: 265 GGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNKFESLAAHDAIVNVHASLNTLACS 324
            G     G    I   E  A +L     +      N  ++++  D +V +        CS
Sbjct: 202 LGCGALAGHPYGID-REHIAERLGFDGVIG-----NSLQAVSDRDFVVEI-----LFWCS 250

Query: 325 LF-----KISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMG 379
           LF     + S+D+  + S     + +LS      GSS+MP K NP   E +     +V G
Sbjct: 251 LFMNHISRFSEDL-IIYSTAEFNFVKLS-DAYSTGSSLMPQKKNPDSLELLRGKSGRVFG 308

Query: 380 NNS 382
           + S
Sbjct: 309 SLS 311

>TBLA0A08320 Chr1 complement(2043721..2045169) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 85/190 (44%), Gaps = 16/190 (8%)

Query: 190 LTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAI 249
           L +  + ++P L+ +   L + A E++ +  +G TH Q A   TLG+  + + Q+L   +
Sbjct: 121 LRDAYDLVIPKLVNVINRLANFALEYKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 250 KRIEKNLPELQYIAQGGT--------AVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNK 301
           +  E+   ++      GT        A+  G + K+   ++   +L     L F T    
Sbjct: 181 RNFERARNDIGLRGVKGTTGTQASFLALFHGNHDKVEELDERVVEL-----LGFDTVYPV 235

Query: 302 FESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGK 361
                +    ++V + L + A +  K++ DIR LA+       E    +++ GSS M  K
Sbjct: 236 TGQTYSRKIDIDVVSPLVSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 362 VNPTQNEAMC 371
            NP + E +C
Sbjct: 293 RNPMRCERVC 302

>NCAS0A09010 Chr1 complement(1783858..1785246) [1389 bp, 462 aa]
           {ON} Anc_1.354 YHR018C
          Length = 462

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 93/240 (38%), Gaps = 21/240 (8%)

Query: 144 ANEVISNRAIELLGGTLGSKQVHPNNHVNQSQSSNDTFPTVMHIAALTEITNTLLPNLIV 203
           ANE    R  E++G  +  K       V+  +S ND   T + I     +   L P L  
Sbjct: 91  ANE---RRLGEIIGRDIAGK-------VHTGRSRNDQCVTDLRIYCRDVLNEKLFPALTS 140

Query: 204 LRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAIKRIEKNLPELQYIA 263
           L + L  + +E   I+  G THLQ A P+      S Y    T  + R+++ L       
Sbjct: 141 LIQVLIKRGEEEIDILMPGYTHLQRAQPIRWSHWLSSYATYFTEDLNRLKQILVRFNKSP 200

Query: 264 QGGTAVGTGLNTKIGFAEQFARQLSNQTNLSF-LTSPNKFESLAAHDAIVNVHASLNTLA 322
            G  A+        G   +F  +      L F     N   +++  D +V +        
Sbjct: 201 LGAGALA---GHPYGIDREFLAE-----GLEFNGVIGNSLVAVSDRDFVVELMFWSTLFM 252

Query: 323 CSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGKVNPTQNEAMCQACVQVMGNNS 382
             + + ++D+  + S    G+ +L+      GSS+MP K N    E +     +V G+ S
Sbjct: 253 NHISRFAEDL-IIYSTAEFGFIKLN-DAYSTGSSLMPQKKNADSLELLRGKSGRVFGDLS 310

>KAFR0A06230 Chr1 complement(1257709..1259157) [1449 bp, 482 aa]
           {ON} Anc_4.197 YLR359W
          Length = 482

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 68/332 (20%), Positives = 137/332 (41%), Gaps = 31/332 (9%)

Query: 190 LTEITNTLLPNLIVLRETLDSKAKEFEKIIKIGRTHLQDATPLTLGQEFSGYTQQLTNAI 249
           L +  + L+P L+ +   L   A   + +  +G TH Q A   TLG+  + + Q+L   +
Sbjct: 121 LRDAYDILIPKLVNVINRLCKFAMANKDLPVLGWTHFQPAQLTTLGKRATLWIQELLWDL 180

Query: 250 KRIEKNLPELQYIAQGGT--------AVGTGLNTKIGFAEQFARQLSNQTNLSFLTSPNK 301
           +  E+   ++      GT        A+  G + K+   ++   +L     L F T    
Sbjct: 181 RNFERARNDIGLRGVKGTTGTQASFLALFHGDHNKVEKLDERVVEL-----LGFDTVYPV 235

Query: 302 FESLAAHDAIVNVHASLNTLACSLFKISQDIRYLASGPRCGYGELSIPENEPGSSIMPGK 361
                +    ++  A L++ A +  K++ DIR LA+       E    +++ GSS M  K
Sbjct: 236 TGQTYSRKIDIDAFAPLSSFAATAHKMATDIRLLANLKEV---EEPFEKSQIGSSAMAYK 292

Query: 362 VNPTQNEAMCQACVQVMGNNSTISFAGASGQFELNTYKPLMIANL-LSSTRLLSDAIFSF 420
            NP + E +C +  + +G+        AS Q+   T     I  + L S  L +D + + 
Sbjct: 293 RNPMRCERVC-SLARHLGSLFNDMVQTASVQWFERTLDDSAIRRISLPSGFLTADILLTT 351

Query: 421 NLHCATGIQANKDKIDRLLHESLMLVTSLNPKIGY--------DAASKVAKNAHHKGITL 472
            L+ ++G+      I+R +   L  + + N  +          +   ++   +H     +
Sbjct: 352 LLNISSGLVVYPKVIERRIKSELPFMATENFIMAMVEKGASRQEVHERIRVLSHQAAAVV 411

Query: 473 KQSALELDILSSKQFDE-----WVRPENMLGP 499
           K+   + D++   + D+     W   +++L P
Sbjct: 412 KEEGGDNDLIERIKKDDFFEPIWTELDSLLDP 443

>CAGL0F06743g Chr6 (661325..663730) [2406 bp, 801 aa] {ON} similar
           to uniprot|P21657 Saccharomyces cerevisiae YIR023w DAL81
           transcriptional activator for allantoin and GABA
           catabolic genes
          Length = 801

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 35/70 (50%), Gaps = 10/70 (14%)

Query: 251 RIEKNLPELQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQTNLSFLT-------SPNKFE 303
           RIE  LPE      GGTA G  L   +GF E +   LS+ +N    T       +PN  E
Sbjct: 39  RIEDLLPEAHDNKDGGTAEGNDL---LGFKENYDSFLSDLSNNGDKTKLHIDDQNPNFAE 95

Query: 304 SLAAHDAIVN 313
            L+ +D++VN
Sbjct: 96  LLSEYDSLVN 105

>Kwal_56.24852 s56 complement(1171208..1172839) [1632 bp, 543 aa]
           {ON} YNL234W - Hypothetical ORF [contig 160] FULL
          Length = 543

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 4/63 (6%)

Query: 168 NNHVNQSQSSNDTFPTVMHIAA-LTEITN---TLLPNLIVLRETLDSKAKEFEKIIKIGR 223
           NN ++ +    +TFPT+ H AA +T++ +   + L +L VL + LDS  K   +I+ +  
Sbjct: 202 NNILDLAPPIENTFPTIKHAAASVTDVISMAISSLEDLSVLNDYLDSLGKHHSRILGVYA 261

Query: 224 THL 226
            H 
Sbjct: 262 VHF 264

>Suva_2.82 Chr2 (147251..150328) [3078 bp, 1025 aa] {ON} YBL037W
           (REAL)
          Length = 1025

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 47/93 (50%), Gaps = 9/93 (9%)

Query: 379 GNNSTISFAGASG------QFELNTYKPLMIANLLSSTRLLSDAIFSFNLHCATGIQANK 432
           G+ +T++   A G        E+N    L +A  +S  R LSDA+     +   GI+ NK
Sbjct: 874 GSTNTVNLKTAIGVTTTIVSSEINPSMHLTLAQFISRWRTLSDALGKDGEYQIYGIKLNK 933

Query: 433 D--KIDRL-LHESLMLVTSLNPKIGYDAASKVA 462
           D  K++ + L + L+L+  +  ++G+D   + +
Sbjct: 934 DFKKVETIDLEDGLVLLRQIFKRLGFDIVEQTS 966

>TDEL0E01330 Chr5 (260599..265572) [4974 bp, 1657 aa] {ON} Anc_4.238
            YDL058W
          Length = 1657

 Score = 31.2 bits (69), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 204  LRETLDSKAKEF----EKIIKIGRTHLQDATPL-TLGQEFSGYTQQLTNAIKRIEKNLPE 258
            LR++L+S+ K F    EK+    + H  DA  + +L  E     ++      ++E+N+ E
Sbjct: 1071 LRQSLESQTKSFGENLEKLSNAEQAHAMDADRINSLQTEIDERKEKYKRESTKLEENIKE 1130

Query: 259  LQYIAQGGTAVGTGLNTKIGFAEQFARQLSNQ 290
            LQ      T    GLN  I    Q   +L+++
Sbjct: 1131 LQRQITNNTTTIAGLNKAIDQERQTNARLASE 1162

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,822,371
Number of extensions: 2104858
Number of successful extensions: 7049
Number of sequences better than 10.0: 88
Number of HSP's gapped: 7237
Number of HSP's successfully gapped: 89
Length of query: 500
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 386
Effective length of database: 40,409,475
Effective search space: 15598057350
Effective search space used: 15598057350
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)