Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A071206.9ON40740721620.0
NDAI0K029006.9ON43841511341e-153
TDEL0G046206.9ON39238310961e-148
Ecym_30126.9ON39738510811e-145
ZYRO0F00462g6.9ON39338310671e-143
NCAS0F001906.9ON41139210621e-142
Kpol_1045.786.9ON39238610541e-141
Skud_5.336.9ON40140010481e-140
YEL056W (HAT2)6.9ON40141210441e-140
SAKL0E00814g6.9ON39840810421e-140
Suva_5.126.9ON40141410351e-138
TPHA0M001906.9ON39138910281e-137
CAGL0B03575g6.9ON41940810231e-136
Smik_5.316.9ON42742510221e-136
KNAG0E009806.9ON4143869991e-133
KLLA0D00814g6.9ON4084019961e-132
KLTH0C11550g6.9ON3983979831e-130
KAFR0L003206.9ON3914029791e-130
ACR017W6.9ON4233829821e-130
Kwal_56.223456.9ON3963909471e-125
KLTH0E12694g8.548ON4184293554e-37
YBR195C (MSI1)8.548ON4224203511e-36
Skud_2.3218.548ON4224183466e-36
NDAI0C055108.548ON4194423432e-35
AEL250C8.548ON4174063362e-34
Smik_2.3358.548ON4224213301e-33
Suva_4.4498.548ON4244203231e-32
Ecym_70428.548ON4144073169e-32
TBLA0H036508.548ON4194283142e-31
KLLA0E23541g8.548ON4174113142e-31
Kwal_27.120708.548ON4184223124e-31
KAFR0I008408.548ON4134063114e-31
SAKL0H09900g8.548ON4254223054e-30
CAGL0M05291g8.548ON4194313037e-30
ZYRO0A13068g8.548ON3974203001e-29
TPHA0L017208.548ON4194172941e-28
Kpol_1024.398.548ON4174322871e-27
NCAS0B021708.548ON4144332772e-26
KNAG0A036708.548ON4264352746e-26
TDEL0B029808.548ON4124192739e-26
Skud_13.2912.401ON5093752013e-16
Suva_13.3112.401ON5103731943e-15
Smik_13.3292.401ON5093751934e-15
TPHA0G026502.401ON5163721854e-14
YMR131C (RRB1)2.401ON5113751845e-14
TDEL0G033402.401ON5143951811e-13
KAFR0A003802.401ON5163721792e-13
KNAG0E021802.401ON5173791782e-13
NCAS0F019702.401ON5113741764e-13
Kpol_1041.202.401ON5153711764e-13
CAGL0K03861g2.401ON5133711765e-13
TBLA0B092502.401ON5263741712e-12
Sklu_YGOB_Anc_2.4012.401ON5203761694e-12
KLLA0F17237g2.401ON5233721685e-12
NDAI0H027502.401ON5123751651e-11
Ecym_60672.401ON5223901587e-11
KLLA0E08449g2.283ON4221861561e-10
ZYRO0A08690g2.401ON5163741542e-10
Kwal_47.178272.401ON5233741542e-10
TPHA0C008608.316ON3782931523e-10
KLTH0E09394g2.401ON5223731533e-10
ADR242C2.401ON5213731516e-10
NCAS0G011206.276ON4941691516e-10
TPHA0C033702.283ON4131981498e-10
NCAS0E037507.310ON12761891501e-09
Kpol_1003.342.283ON3881831462e-09
Kpol_1028.416.340ON5123031435e-09
TBLA0F041306.340ON5142991426e-09
Ecym_33212.283ON4091871427e-09
KNAG0I025406.325ON9182241411e-08
Suva_3.936.325ON9202381411e-08
KLLA0C08547g6.340ON5152991392e-08
ZYRO0A01804g2.283ON3761781382e-08
Skud_3.1336.325ON9162291383e-08
Smik_3.1576.325ON9242291383e-08
YCR057C (PWP2)6.325ON9232291374e-08
Ecym_20936.325ON9232291365e-08
AAL157C5.201ON4792051356e-08
KLLA0E04093g8.316ON3721981346e-08
Kpol_1060.246.276ON4863071338e-08
TDEL0G021402.283ON3921731338e-08
KNAG0I009208.316ON3812281329e-08
CAGL0J03476g6.340ON5172991339e-08
TBLA0I022806.325ON9272091349e-08
ZYRO0F05808g7.310ON12822281349e-08
Kpol_1028.546.325ON9052221349e-08
Kwal_33.151365.201ON4731401331e-07
Ecym_42498.316ON3742061321e-07
TBLA0B059202.283ON4031871321e-07
Skud_4.637.310ON12732251331e-07
TDEL0C023607.310ON12642281331e-07
NCAS0G038702.283ON3892481311e-07
SAKL0H15708g8.316ON3682581301e-07
NDAI0I004606.325ON9172291312e-07
KLTH0A06380g6.325ON9152601302e-07
Suva_14.3112.283ON3891771293e-07
TPHA0D038306.325ON9122481303e-07
Smik_4.457.310ON12702161303e-07
TDEL0E042805.201ON4811591293e-07
YDL195W (SEC31)7.310ON12732221303e-07
YNL035C2.283ON3892121283e-07
KAFR0F043506.340ON5153021283e-07
KLTH0B03410g5.201ON4771401284e-07
TDEL0A075506.340ON5152991284e-07
CAGL0B01529g8.316ON3692241274e-07
ZYRO0D05852g8.316ON3712101265e-07
NCAS0D044806.325ON9152331276e-07
CAGL0K09284g6.325ON9112551276e-07
KLTH0G10296g2.283ON4261751257e-07
KAFR0J025506.325ON9062041268e-07
SAKL0E07766g2.283ON3981771258e-07
KAFR0H033402.283ON3671731249e-07
Smik_6.4516.276ON5232411251e-06
AAR057W6.325ON9222291251e-06
KLTH0A06754g6.340ON5143021241e-06
TDEL0A074006.325ON9012241251e-06
SAKL0A01276g6.340ON5153021231e-06
ZYRO0D08206g6.340ON5152991231e-06
Kwal_23.63246.340ON5142971232e-06
KAFR0B057008.316ON3722631222e-06
Kwal_23.62406.325ON9132291242e-06
TDEL0F044308.316ON3672141222e-06
TBLA0F042406.363ON727851232e-06
YPL247C6.276ON5233741232e-06
KLTH0G12430g8.316ON3672571212e-06
AER263C6.340ON5132971222e-06
SAKL0A01738g6.325ON9092331222e-06
Skud_14.2982.283ON3891771212e-06
KNAG0I028406.340ON5193011212e-06
Kpol_1038.203.22ON13132021223e-06
Kwal_27.120538.544ON7551321213e-06
NDAI0I021805.201ON4791641203e-06
NCAS0B035508.316ON3752071203e-06
NCAS0D046106.340ON5153031203e-06
KAFR0L013207.310ON12402171213e-06
Kpol_1036.658.316ON3712031194e-06
TBLA0F021407.310ON13002301214e-06
TPHA0M018306.340ON5153021204e-06
NCAS0D027305.201ON4751611194e-06
Kwal_27.115502.283ON4071721195e-06
KAFR0E031808.544ON8141321205e-06
Suva_3.1216.363ON700941205e-06
KAFR0J009805.201ON4801591195e-06
KLTH0E12606g8.544ON7551321195e-06
Kpol_1058.318.67ON6751401195e-06
KLLA0A08822g4.122ON5821361195e-06
KNAG0A012303.22ON13211971196e-06
TPHA0I018808.544ON10342501196e-06
KLLA0F19734g8.288ON1133631196e-06
AGL190W8.316ON3702221176e-06
SAKL0F10384g7.310ON12612151196e-06
Skud_3.1566.363ON7131101187e-06
TPHA0D035906.276ON5983351187e-06
Kwal_56.238958.316ON3672581177e-06
Suva_4.537.310ON12712151197e-06
KLLA0E20967g3.22ON13212041187e-06
Ecym_25236.363ON646871178e-06
NDAI0J010408.316ON3982091169e-06
TDEL0A068906.276ON4472191161e-05
TDEL0H003707.534ON4652171161e-05
TBLA0C050107.356ON5721761161e-05
TPHA0D011308.651ON4513351151e-05
NCAS0D047806.363ON6211271161e-05
TBLA0A038908.316ON3622021141e-05
KAFR0C031908.67ON6721291152e-05
KAFR0C047406.363ON6651051152e-05
TBLA0F005206.363ON663851152e-05
Kwal_56.244787.310ON12961861152e-05
Kwal_23.64296.363ON7501301152e-05
NCAS0C039908.67ON7301281152e-05
Smik_14.2962.283ON3892121142e-05
CAGL0E00561g6.363ON836871152e-05
Kpol_1019.307.310ON12522071152e-05
Ecym_80617.310ON12282161152e-05
KLTH0G13068g8.288ON11011051152e-05
TDEL0A077806.363ON657871142e-05
Kpol_1048.598.544ON8502241142e-05
KLTH0A07282g6.363ON7251301142e-05
NDAI0K023506.363ON7931001143e-05
KNAG0M017505.201ON4852061133e-05
CAGL0E01485g3.22ON13362131143e-05
Suva_3.1096.340ON5152991133e-05
ZYRO0D08558g6.325ON9122241133e-05
Ecym_24986.340ON5423001123e-05
KLLA0D16390g8.324ON9361381133e-05
KNAG0B028007.310ON13072221133e-05
Suva_16.606.276ON5262461124e-05
KLLA0E23453g8.544ON8261321124e-05
Smik_3.1726.340ON5152991124e-05
Kpol_1028.236.363ON744871124e-05
Smik_3.1836.363ON7091101124e-05
NDAI0F012406.276ON5241671114e-05
SAKL0C13332g3.22ON13532191125e-05
KNAG0H020402.283ON3991761105e-05
Kpol_1024.428.544ON8431321115e-05
NDAI0G033108.67ON8851421115e-05
ADL186C3.22ON13611951115e-05
KNAG0D002506.363ON655871106e-05
ZYRO0D03828g1.247ON7262801106e-05
NCAS0B036908.288ON11451321116e-05
ZYRO0D17292g6.363ON7181051106e-05
KLTH0E15576g1.247ON723601107e-05
KNAG0I010508.288ON11591561107e-05
CAGL0C03608g6.363ON6431561107e-05
NDAI0G006302.283ON3971761097e-05
Skud_12.565.201ON4892071098e-05
SAKL0D04796g1.247ON769601091e-04
KLTH0H02134g7.310ON12992351081e-04
AEL246C8.544ON8151751081e-04
ZYRO0A12980g8.544ON8243861081e-04
TPHA0N018502.663ON4061861071e-04
Suva_11.2681.247ON6452241071e-04
TBLA0D026308.67ON8621341081e-04
Kwal_56.236858.288ON1102581081e-04
Ecym_70388.544ON8001751071e-04
YCR072C (RSA4)6.340ON5152991071e-04
Kwal_27.126671.247ON721601072e-04
NDAI0J011808.288ON11341411072e-04
TBLA0H002303.22ON13332041072e-04
Smik_5.200na 1ON3911281052e-04
TPHA0M020006.363ON699871062e-04
NDAI0B051901.247ON6681031062e-04
YKR036C (CAF4)1.247ON6431771062e-04
NDAI0F033802.73ON5621121062e-04
Kwal_23.50358.67ON7443021062e-04
Skud_4.4018.316ON3761831052e-04
Suva_2.3038.316ON3772531052e-04
YLL011W (SOF1)5.201ON4892071052e-04
KAFR0G018908.651ON4501751043e-04
Smik_11.2981.247ON662601053e-04
TPHA0B011201.247ON719601053e-04
YDR142C (PEX7)8.316ON3752191043e-04
KAFR0I028603.22ON13651981053e-04
Kwal_14.17106.135ON574951043e-04
Skud_3.1456.340ON5152991043e-04
CAGL0G01628g2.283ON3761011033e-04
Skud_16.326.276ON5222461043e-04
NDAI0I003506.340ON5152961034e-04
KLLA0F21406g1.247ON705781044e-04
AEL314W1.247ON7151901044e-04
Kpol_1016.111.247ON669631044e-04
TPHA0A031007.310ON12652471044e-04
Suva_4.4528.544ON8002291044e-04
ADL218C2.283ON4031811034e-04
KNAG0G01080na 1ON7461381044e-04
Ecym_55285.429ON471891035e-04
AEL269C7.534ON4551131025e-04
ADR090W7.310ON12331881035e-04
Ecym_80727.322ON12011461035e-04
KAFR0B055808.288ON1120661035e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07120
         (407 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   837   0.0  
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     441   e-153
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   426   e-148
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   421   e-145
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   415   e-143
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   413   e-142
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   410   e-141
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   408   e-140
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   406   e-140
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   405   e-140
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   403   e-138
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   400   e-137
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   398   e-136
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   398   e-136
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   389   e-133
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   388   e-132
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   383   e-130
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   381   e-130
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   382   e-130
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   369   e-125
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   141   4e-37
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   139   1e-36
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   137   6e-36
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   136   2e-35
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   134   2e-34
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   131   1e-33
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   129   1e-32
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   126   9e-32
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   125   2e-31
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   125   2e-31
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   124   4e-31
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   124   4e-31
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   122   4e-30
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   121   7e-30
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   120   1e-29
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   117   1e-28
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   115   1e-27
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   111   2e-26
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   110   6e-26
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   109   9e-26
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    82   3e-16
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    79   3e-15
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    79   4e-15
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    76   4e-14
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    75   5e-14
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    74   1e-13
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    74   2e-13
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    73   2e-13
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    72   4e-13
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    72   4e-13
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    72   5e-13
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    70   2e-12
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    70   4e-12
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    69   5e-12
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    68   1e-11
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    65   7e-11
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    65   1e-10
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    64   2e-10
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    64   2e-10
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    63   3e-10
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    64   3e-10
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    63   6e-10
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    63   6e-10
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    62   8e-10
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    62   1e-09
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    61   2e-09
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    60   5e-09
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    59   6e-09
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    59   7e-09
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    59   1e-08
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    59   1e-08
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    58   2e-08
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    58   2e-08
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    58   3e-08
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    58   3e-08
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    57   4e-08
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    57   5e-08
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    57   6e-08
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    56   6e-08
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    56   8e-08
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    56   8e-08
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    55   9e-08
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    56   9e-08
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    56   9e-08
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    56   9e-08
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    56   9e-08
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    56   1e-07
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    55   1e-07
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    55   1e-07
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    56   1e-07
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    56   1e-07
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     55   1e-07
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    55   1e-07
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       55   2e-07
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    55   2e-07
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    54   3e-07
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    55   3e-07
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    55   3e-07
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    54   3e-07
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    55   3e-07
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    54   3e-07
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    54   3e-07
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    54   4e-07
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    54   4e-07
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    54   4e-07
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    53   5e-07
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    54   6e-07
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    54   6e-07
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    53   7e-07
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    53   8e-07
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    53   8e-07
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    52   9e-07
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    53   1e-06
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    53   1e-06
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    52   1e-06
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    53   1e-06
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    52   1e-06
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    52   1e-06
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    52   2e-06
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    52   2e-06
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    52   2e-06
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    52   2e-06
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    52   2e-06
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    52   2e-06
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    51   2e-06
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    52   2e-06
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    52   2e-06
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    51   2e-06
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    51   2e-06
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    52   3e-06
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    51   3e-06
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    51   3e-06
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    51   3e-06
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     51   3e-06
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    51   3e-06
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    50   4e-06
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    51   4e-06
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    51   4e-06
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     50   4e-06
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    50   5e-06
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    51   5e-06
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    51   5e-06
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    50   5e-06
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    50   5e-06
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    50   5e-06
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    50   5e-06
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    50   6e-06
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    50   6e-06
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    50   6e-06
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    50   6e-06
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    50   6e-06
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    50   7e-06
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    50   7e-06
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    50   7e-06
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    50   7e-06
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    50   7e-06
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    50   8e-06
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    49   9e-06
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    49   1e-05
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    49   1e-05
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    49   1e-05
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    49   1e-05
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     49   1e-05
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    49   1e-05
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    49   2e-05
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    49   2e-05
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    49   2e-05
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    49   2e-05
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    49   2e-05
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    49   2e-05
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    49   2e-05
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    49   2e-05
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    49   2e-05
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    49   2e-05
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    49   2e-05
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    49   2e-05
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    49   2e-05
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    49   2e-05
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    49   3e-05
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    48   3e-05
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    49   3e-05
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    48   3e-05
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    48   3e-05
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    48   3e-05
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    48   3e-05
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    48   3e-05
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    48   4e-05
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    48   4e-05
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    48   4e-05
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    48   4e-05
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    48   4e-05
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    47   4e-05
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    48   5e-05
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    47   5e-05
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    47   5e-05
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    47   5e-05
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    47   5e-05
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    47   6e-05
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    47   6e-05
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    47   6e-05
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    47   6e-05
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    47   7e-05
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    47   7e-05
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    47   7e-05
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    47   7e-05
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    47   8e-05
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    47   1e-04
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    46   1e-04
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    46   1e-04
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    46   1e-04
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    46   1e-04
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    46   1e-04
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    46   1e-04
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    46   1e-04
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    46   1e-04
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    46   1e-04
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    46   2e-04
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    46   2e-04
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    46   2e-04
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    45   2e-04
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    45   2e-04
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    45   2e-04
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    45   2e-04
NDAI0F03380 Chr6 (813767..815455) [1689 bp, 562 aa] {ON} Anc_2.7...    45   2e-04
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    45   2e-04
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    45   2e-04
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    45   2e-04
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    45   2e-04
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               45   3e-04
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    45   3e-04
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    45   3e-04
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    45   3e-04
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    45   3e-04
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    45   3e-04
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    45   3e-04
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    44   3e-04
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    45   3e-04
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       44   4e-04
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    45   4e-04
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    45   4e-04
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    45   4e-04
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    45   4e-04
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    45   4e-04
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    44   4e-04
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      45   4e-04
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    44   5e-04
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    44   5e-04
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    44   5e-04
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    44   5e-04
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    44   5e-04
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               44   5e-04
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    44   6e-04
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    44   6e-04
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    44   6e-04
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    44   6e-04
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    44   7e-04
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    44   7e-04
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    44   7e-04
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    44   7e-04
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    44   7e-04
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    44   7e-04
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    44   7e-04
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    43   8e-04
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    44   9e-04
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    44   9e-04
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    44   9e-04
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    44   0.001
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    43   0.001
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    44   0.001
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    44   0.001
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    43   0.001
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    43   0.001
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    43   0.001
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    43   0.001
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    43   0.001
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    43   0.001
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    43   0.001
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    43   0.001
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    43   0.001
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    43   0.001
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    43   0.002
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    43   0.002
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    42   0.002
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    42   0.002
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    42   0.002
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    42   0.002
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    42   0.002
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    42   0.002
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    42   0.002
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    42   0.002
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    42   0.002
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    42   0.002
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    42   0.002
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    42   0.002
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    42   0.002
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    42   0.002
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    42   0.002
Skud_15.396 Chr15 (709746..711059) [1314 bp, 437 aa] {ON} YOR230...    42   0.002
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    42   0.002
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    42   0.002
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    42   0.002
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    42   0.002
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    42   0.002
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    42   0.002
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    42   0.002
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    42   0.003
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    42   0.003
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    42   0.003
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    42   0.003
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    42   0.003
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    42   0.003
Smik_15.413 Chr15 (718053..719462) [1410 bp, 469 aa] {ON} YOR229...    42   0.003
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    42   0.003
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    42   0.003
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    42   0.003
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    41   0.003
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    42   0.003
KNAG0A03070 Chr1 complement(378279..379604) [1326 bp, 441 aa] {O...    41   0.003
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    41   0.003
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    41   0.003
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    42   0.003
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    41   0.004
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    42   0.004
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    41   0.004
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    41   0.004
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    41   0.004
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    41   0.004
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    41   0.004
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    41   0.005
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    41   0.005
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    41   0.005
YOR229W Chr15 (768409..769812) [1404 bp, 467 aa] {ON}  WTM2Trans...    41   0.005
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    41   0.006
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    41   0.006
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    41   0.006
SAKL0E12892g Chr5 (1062422..1064002) [1581 bp, 526 aa] {ON} simi...    40   0.006
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    40   0.006
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    40   0.006
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    41   0.006
KLLA0D07282g Chr4 (621115..622467) [1353 bp, 450 aa] {ON} simila...    40   0.006
KNAG0F01250 Chr6 complement(226031..227653) [1623 bp, 540 aa] {O...    40   0.006
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    40   0.006
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    40   0.007
KAFR0A07550 Chr1 (1523221..1524804) [1584 bp, 527 aa] {ON} Anc_2...    40   0.007
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    40   0.007
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    40   0.007
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    40   0.007
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    41   0.007
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    40   0.007
Ecym_6423 Chr6 (822758..824329) [1572 bp, 523 aa] {ON} similar t...    40   0.007
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    40   0.007
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    40   0.007
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    40   0.008
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    40   0.008
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    40   0.008
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    40   0.008
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    40   0.008
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    40   0.009
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    40   0.009
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    40   0.009
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    40   0.009
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    40   0.009
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    40   0.009
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    40   0.009
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     40   0.011
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    40   0.011
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    40   0.011
ACR116W Chr3 (555946..557307) [1362 bp, 453 aa] {ON} Syntenic ho...    40   0.011
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             40   0.011
YDL156W Chr4 (174918..176486) [1569 bp, 522 aa] {ON}  CMR1DNA-bi...    40   0.012
NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON}               40   0.012
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    40   0.012
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    40   0.013
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    40   0.013
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    40   0.013
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    40   0.013
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    39   0.013
ACR194C Chr3 complement(690186..691727) [1542 bp, 513 aa] {ON} S...    40   0.013
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    40   0.013
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    40   0.014
CAGL0J03806g Chr10 (363777..365039) [1263 bp, 420 aa] {ON} simil...    39   0.014
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    40   0.014
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    40   0.015
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    39   0.015
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    39   0.016
Suva_8.280 Chr8 (507390..508796) [1407 bp, 468 aa] {ON} YOR229W ...    39   0.016
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    39   0.016
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    39   0.016
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    39   0.017
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    39   0.017
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    39   0.017
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    39   0.018
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    39   0.019
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    39   0.019
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    39   0.019
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    39   0.019
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    39   0.019
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    39   0.020
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    39   0.020
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    39   0.021
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    39   0.021
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    39   0.022
Skud_15.395 Chr15 (707395..708789) [1395 bp, 464 aa] {ON} YOR229...    39   0.022
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    39   0.022
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    39   0.023
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    39   0.023
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    39   0.024
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    39   0.024
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    38   0.024
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    39   0.025
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    39   0.025
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    39   0.026
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    39   0.026
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    39   0.026
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    39   0.027
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    39   0.028
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    39   0.029
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    39   0.029
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    38   0.033
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    38   0.033
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    38   0.033
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    38   0.033
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    38   0.034
Ecym_8336 Chr8 (677880..679250) [1371 bp, 456 aa] {ON} similar t...    38   0.034
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    38   0.037
Suva_8.281 Chr8 (509873..511183) [1311 bp, 436 aa] {ON} YOR230W ...    38   0.037
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    38   0.038
Suva_8.91 Chr8 complement(165427..168063) [2637 bp, 878 aa] {ON}...    38   0.038
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    38   0.039
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    38   0.039
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    38   0.040
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    38   0.040
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    38   0.042
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    38   0.043
YNL182C Chr14 complement(295960..297627) [1668 bp, 555 aa] {ON} ...    38   0.044
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    38   0.045
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    38   0.046
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    38   0.046
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    38   0.047
NCAS0G01830 Chr7 complement(326874..328520) [1647 bp, 548 aa] {O...    38   0.049
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    38   0.050
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    38   0.053
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    38   0.053
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    38   0.053
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    38   0.054
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    38   0.056
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    37   0.057
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    37   0.057
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    37   0.057
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    38   0.059
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    37   0.059
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    37   0.060
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    37   0.062
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    37   0.063
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    37   0.063
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    37   0.064
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    37   0.067
KLLA0C16533g Chr3 complement(1448866..1450404) [1539 bp, 512 aa]...    37   0.067
Skud_14.152 Chr14 complement(286929..288704) [1776 bp, 591 aa] {...    37   0.070
ACR088W Chr3 (515561..518113) [2553 bp, 850 aa] {ON} Syntenic ho...    37   0.070
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    37   0.070
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    37   0.071
Smik_6.337 Chr6 (533185..534555) [1371 bp, 456 aa] {ON} YPL139C ...    37   0.072
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    37   0.072
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    37   0.073
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    37   0.074
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    37   0.076
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               37   0.077
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    37   0.082
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    37   0.083
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    37   0.084
KAFR0G01900 Chr7 (403294..404574) [1281 bp, 426 aa] {ON}               37   0.087
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    37   0.090
ABL141C Chr2 complement(131670..133226) [1557 bp, 518 aa] {ON} S...    37   0.090
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    37   0.094
Smik_15.414 Chr15 (720454..721767) [1314 bp, 437 aa] {ON} YOR230...    37   0.094
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    37   0.096
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...    37   0.096
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    37   0.098
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    37   0.099
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    37   0.100
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    37   0.10 
Suva_16.171 Chr16 complement(299070..300455) [1386 bp, 461 aa] {...    37   0.10 
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    37   0.11 
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    37   0.11 
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    37   0.11 
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     37   0.11 
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    37   0.12 
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    37   0.12 
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    36   0.12 
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    37   0.13 
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    37   0.13 
CAGL0J03960g Chr10 complement(375780..377087) [1308 bp, 435 aa] ...    36   0.13 
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    36   0.13 
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    37   0.13 
Suva_14.159 Chr14 complement(292113..293789) [1677 bp, 558 aa] {...    36   0.13 
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    36   0.13 
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    36   0.13 
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    36   0.14 
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    36   0.14 
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    36   0.14 
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    36   0.15 
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    36   0.15 
KLTH0B07040g Chr2 (567756..569276) [1521 bp, 506 aa] {ON} simila...    36   0.15 
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    36   0.15 
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    36   0.15 
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    36   0.16 
Smik_14.148 Chr14 complement(275170..276837) [1668 bp, 555 aa] {...    36   0.16 
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    36   0.16 
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    36   0.17 
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    36   0.17 
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    36   0.17 
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    36   0.19 
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    36   0.19 
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    36   0.20 
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    35   0.20 
SAKL0F11154g Chr6 (870446..871981) [1536 bp, 511 aa] {ON} simila...    36   0.22 
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    36   0.22 
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    36   0.22 
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    36   0.22 
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    35   0.22 
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    35   0.22 
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    35   0.22 
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    35   0.23 
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    36   0.23 
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     35   0.23 
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    35   0.23 
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    35   0.23 
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    35   0.23 
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    35   0.23 
Skud_7.283 Chr7 complement(493716..494972) [1257 bp, 418 aa] {ON...    35   0.24 
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    35   0.24 
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    35   0.24 
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       35   0.25 
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    36   0.25 
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    35   0.25 
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    35   0.26 
TBLA0B04000 Chr2 complement(913726..915084) [1359 bp, 452 aa] {O...    35   0.26 
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    35   0.26 
NDAI0E00950 Chr5 complement(192199..193734) [1536 bp, 511 aa] {O...    35   0.27 
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    35   0.27 
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    35   0.27 
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    35   0.27 
KAFR0H02550 Chr8 complement(487226..488521) [1296 bp, 431 aa] {O...    35   0.28 
ACL099W Chr3 (165316..166389) [1074 bp, 357 aa] {ON} Syntenic ho...    35   0.28 
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    35   0.28 
YOR038C Chr15 complement(402761..405388) [2628 bp, 875 aa] {ON} ...    35   0.28 
NCAS0G00690 Chr7 (116505..119162) [2658 bp, 885 aa] {ON} Anc_5.6...    35   0.29 
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    35   0.29 
TPHA0A05040 Chr1 (1137120..1138359,1138450..1139051) [1842 bp, 6...    35   0.30 
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    35   0.30 
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...    35   0.31 
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    35   0.31 
NCAS0A14030 Chr1 complement(2760841..2762415) [1575 bp, 524 aa] ...    35   0.31 
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    35   0.32 
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    35   0.32 
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    35   0.33 
TBLA0C01740 Chr3 (409315..410889) [1575 bp, 524 aa] {ON} Anc_8.6...    35   0.33 
NDAI0C00230 Chr3 (35404..36426) [1023 bp, 340 aa] {ON} Anc_2.657...    35   0.34 
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    35   0.34 
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    35   0.35 
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    35   0.35 
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    35   0.36 
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    35   0.36 
Skud_4.99 Chr4 (170540..172108) [1569 bp, 522 aa] {ON} YDL156W (...    35   0.36 
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    35   0.37 
CAGL0I03542g Chr9 (299881..301485) [1605 bp, 534 aa] {ON} simila...    35   0.39 
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    35   0.39 
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    35   0.40 
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    35   0.42 
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    35   0.44 
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    35   0.45 
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    35   0.46 
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    35   0.46 
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    35   0.46 
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    35   0.47 
TDEL0A01140 Chr1 complement(192604..194151) [1548 bp, 515 aa] {O...    35   0.47 
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    35   0.48 
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    35   0.48 
KAFR0C06010 Chr3 complement(1196930..1199554) [2625 bp, 874 aa] ...    35   0.49 
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    35   0.49 
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    35   0.49 
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    34   0.50 
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    35   0.50 
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    35   0.50 
NCAS0H03450 Chr8 complement(653985..654968) [984 bp, 327 aa] {ON...    34   0.51 
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    35   0.51 
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    35   0.52 
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    33   0.53 
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    34   0.54 
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    34   0.54 
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    34   0.54 
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    35   0.55 
SAKL0G01694g Chr7 (142556..145099) [2544 bp, 847 aa] {ON} simila...    35   0.56 
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     34   0.56 
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    34   0.56 
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    34   0.56 
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    34   0.59 
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    34   0.60 
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    34   0.60 
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    34   0.60 
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    34   0.62 
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    34   0.62 
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    34   0.63 
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    34   0.65 
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    34   0.65 
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    34   0.67 
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    34   0.68 
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    34   0.68 
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    34   0.68 
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    34   0.69 
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    34   0.72 
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    34   0.72 
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    34   0.73 
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    34   0.73 
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      34   0.76 
Kpol_1012.5 s1012 (8531..8920,8923..9909) [1377 bp, 458 aa] {ON}...    34   0.78 
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    34   0.80 
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    34   0.81 
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    34   0.81 
CAGL0L09757g Chr12 complement(1048895..1049875) [981 bp, 326 aa]...    33   0.81 
KLTH0G18348g Chr7 (1581039..1582844) [1806 bp, 601 aa] {ON} simi...    34   0.83 
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    34   0.87 
KLLA0D08371g Chr4 (710885..712411) [1527 bp, 508 aa] {ON} simila...    33   0.89 
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    33   0.89 
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    34   0.90 
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    33   0.90 
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    34   0.91 
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    34   0.92 
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    33   0.93 
Skud_7.561 Chr7 (920014..921196,921300..921898) [1782 bp, 593 aa...    33   0.94 
TBLA0D03490 Chr4 (867909..869399) [1491 bp, 496 aa] {ON} Anc_6.1...    33   0.99 
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    33   1.0  
Skud_15.203 Chr15 complement(362659..365292) [2634 bp, 877 aa] {...    33   1.0  
ZYRO0D00748g Chr4 (56274..57251) [978 bp, 325 aa] {ON} highly si...    33   1.0  
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    33   1.1  
Suva_4.89 Chr4 (162699..164267) [1569 bp, 522 aa] {ON} YDL156W (...    33   1.1  
TBLA0B09730 Chr2 (2309400..2310938) [1539 bp, 512 aa] {ON} Anc_2...    33   1.1  
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    33   1.1  
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...    33   1.1  
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    33   1.1  
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    33   1.2  
KAFR0G01090 Chr7 complement(247902..250883) [2982 bp, 993 aa] {O...    33   1.2  
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    33   1.2  
TDEL0G01280 Chr7 complement(258957..259555,259626..260934) [1908...    33   1.2  
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    33   1.2  
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    33   1.2  
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    33   1.2  
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    33   1.2  
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    33   1.3  
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    33   1.3  
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    33   1.3  
CAGL0K10692g Chr11 (1040242..1041759) [1518 bp, 505 aa] {ON} sim...    33   1.3  
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    33   1.3  
SAKL0G19536g Chr7 complement(1683650..1684636) [987 bp, 328 aa] ...    33   1.4  
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    33   1.4  
Kwal_14.906 s14 (105782..106768) [987 bp, 328 aa] {ON} YKL018W (...    33   1.4  
KAFR0C03870 Chr3 (783131..784120) [990 bp, 329 aa] {ON} Anc_2.65...    33   1.4  
Skud_3.23 Chr3 (40457..42805) [2349 bp, 782 aa] {ON} YCL039W (REAL)    33   1.4  
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    33   1.4  
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    33   1.4  
TDEL0B07520 Chr2 complement(1320439..1321422) [984 bp, 327 aa] {...    33   1.5  
Smik_15.217 Chr15 complement(368813..371440) [2628 bp, 875 aa] {...    33   1.5  
AGR242C Chr7 complement(1203146..1204405) [1260 bp, 419 aa] {ON}...    33   1.5  
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    33   1.6  
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    33   1.6  
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    33   1.6  
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    33   1.6  
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    33   1.6  
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    33   1.7  
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    33   1.7  
NDAI0F00770 Chr6 (185453..188332) [2880 bp, 959 aa] {ON} Anc_5.6...    33   1.7  
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    33   1.7  
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    33   1.7  
Suva_11.210 Chr11 (387997..388986) [990 bp, 329 aa] {ON} YKL018W...    33   1.7  
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    33   1.7  
TBLA0C00970 Chr3 complement(193861..194844) [984 bp, 327 aa] {ON...    33   1.7  
Skud_11.211 Chr11 (384964..385953) [990 bp, 329 aa] {ON} YKL018W...    33   1.7  
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    33   1.7  
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    33   1.8  
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    33   1.8  
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    33   1.8  
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    33   1.8  
KAFR0D00320 Chr4 (46078..48531) [2454 bp, 817 aa] {ON} Anc_1.34 ...    33   1.8  
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    33   1.8  
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    33   1.8  
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    33   1.8  
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    33   1.9  
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    33   1.9  
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    32   1.9  
TPHA0N01800 Chr14 complement(386979..387968) [990 bp, 329 aa] {O...    32   1.9  
SAKL0B01540g Chr2 (150043..151752) [1710 bp, 569 aa] {ON} simila...    33   1.9  
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    33   1.9  
KLLA0D15873g Chr4 (1334131..1335426) [1296 bp, 431 aa] {ON} simi...    33   1.9  
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    33   1.9  
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    33   2.0  
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    33   2.0  
YKL018W Chr11 (404102..405091) [990 bp, 329 aa] {ON}  SWD2Subuni...    32   2.0  
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    33   2.0  
KAFR0F03050 Chr6 (600151..605856) [5706 bp, 1901 aa] {ON} Anc_4....    33   2.0  
TDEL0C03040 Chr3 (542405..545422) [3018 bp, 1005 aa] {ON} Anc_7....    33   2.1  
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    33   2.1  
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    32   2.2  
Smik_11.237 Chr11 (391046..392035) [990 bp, 329 aa] {ON} YKL018W...    32   2.2  
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    32   2.2  
Smik_4.81 Chr4 (151682..153250) [1569 bp, 522 aa] {ON} YDL156W (...    32   2.2  
Smik_2.423 Chr2 complement(750642..753278) [2637 bp, 878 aa] {ON...    33   2.2  
KLTH0F16830g Chr6 complement(1361983..1364532) [2550 bp, 849 aa]...    32   2.3  
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    32   2.3  
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    32   2.3  
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    32   2.3  
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    32   2.3  
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    32   2.3  
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    32   2.4  
NDAI0A01990 Chr1 (442919..444508) [1590 bp, 529 aa] {ON} Anc_7.3...    32   2.4  
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    32   2.4  
AFL041C Chr6 complement(361724..362833) [1110 bp, 369 aa] {ON} S...    32   2.4  
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    32   2.4  
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    32   2.4  
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    32   2.5  
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    32   2.5  
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    32   2.5  
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    32   2.5  
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    32   2.5  
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    32   2.6  
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    32   2.6  
ZYRO0C11308g Chr3 complement(874724..877390) [2667 bp, 888 aa] {...    32   2.6  
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...    32   2.7  
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    32   2.7  
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...    32   2.7  
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    32   2.7  
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    32   2.7  
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    32   2.8  
KLLA0E18877g Chr5 complement(1676876..1680310) [3435 bp, 1144 aa...    32   2.8  
NCAS0E00530 Chr5 (89654..90853) [1200 bp, 399 aa] {ON} Anc_3.526...    32   2.8  
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    32   2.8  
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    32   2.8  
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    32   2.8  
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    32   2.9  
KNAG0J01440 Chr10 complement(265742..268438) [2697 bp, 898 aa] {...    32   2.9  
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    32   2.9  
CAGL0K11638g Chr11 complement(1124172..1125950) [1779 bp, 592 aa...    32   3.0  
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    32   3.0  
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    32   3.0  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    32   3.1  
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    32   3.1  
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    32   3.1  
Kpol_520.18 s520 complement(42438..45452) [3015 bp, 1004 aa] {ON...    32   3.1  
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    32   3.2  
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    32   3.2  
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    32   3.2  
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    32   3.3  
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     32   3.3  
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    32   3.3  
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    32   3.3  
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    32   3.4  
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    32   3.4  
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    32   3.5  
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    32   3.6  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    32   3.6  
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    32   3.6  
KNAG0H00220 Chr8 (32961..33944) [984 bp, 327 aa] {ON} Anc_2.657 ...    32   3.7  
Ecym_5498 Chr5 (1016519..1019092) [2574 bp, 857 aa] {ON} similar...    32   3.7  
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    32   3.8  
Kwal_55.21566 s55 complement(893127..895748) [2622 bp, 873 aa] {...    32   3.8  
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    32   3.8  
Kpol_1044.27 s1044 complement(63632..65197) [1566 bp, 521 aa] {O...    32   3.8  
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    32   4.1  
Ecym_1499 Chr1 complement(1025285..1027051) [1767 bp, 588 aa] {O...    32   4.1  
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    32   4.1  
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    32   4.1  
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      32   4.2  
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    32   4.2  
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    32   4.2  
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    32   4.3  
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    32   4.3  
KLTH0H01628g Chr8 (144953..146488) [1536 bp, 511 aa] {ON} simila...    32   4.3  
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    32   4.5  
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    32   4.6  
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    31   4.7  
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    31   4.7  
SAKL0H05566g Chr8 complement(500251..501663) [1413 bp, 470 aa] {...    31   4.8  
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    31   4.8  
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    31   4.8  
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    32   4.8  
TBLA0I00920 Chr9 complement(174544..177504) [2961 bp, 986 aa] {O...    32   4.9  
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    32   4.9  
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    31   5.0  
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    31   5.1  
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    32   5.1  
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    31   5.2  
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    31   5.3  
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    31   5.4  
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    31   5.5  
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    31   5.7  
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    31   5.7  
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    31   5.7  
KLTH0C00748g Chr3 (72171..73157) [987 bp, 328 aa] {ON} highly si...    31   5.8  
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    31   5.8  
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    31   5.8  
KLLA0E06469g Chr5 complement(581935..584832) [2898 bp, 965 aa] {...    31   5.9  
SAKL0F01804g Chr6 complement(151476..152714,152788..152790) [124...    31   6.1  
Ecym_3389 Chr3 (736712..737695) [984 bp, 327 aa] {ON} similar to...    31   6.1  
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    31   6.1  
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    31   6.2  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    31   6.2  
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    31   6.3  
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    31   6.3  
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    31   6.3  
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    31   6.6  
KLLA0C01177g Chr3 (89978..92131) [2154 bp, 717 aa] {ON} similar ...    31   6.7  
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    31   6.7  
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    31   6.9  
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    31   7.0  
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    31   7.1  
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    31   7.2  
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    31   7.4  
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...    31   7.4  
YBR281C Chr2 complement(764970..767606) [2637 bp, 878 aa] {ON}  ...    31   7.4  
YPL126W Chr16 (310210..312900) [2691 bp, 896 aa] {ON}  NAN1U3 sn...    31   7.6  
KNAG0C01680 Chr3 (335056..337689) [2634 bp, 877 aa] {ON} Anc_1.3...    31   7.6  
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    30   7.8  
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    31   7.8  
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    30   7.8  
CAGL0E00979g Chr5 complement(89783..91048) [1266 bp, 421 aa] {ON...    30   7.9  
YML102W Chr13 (68294..69700) [1407 bp, 468 aa] {ON}  CAC2Subunit...    31   7.9  
SAKL0C12232g Chr3 complement(1093069..1094283) [1215 bp, 404 aa]...    30   8.0  
Kwal_55.19926 s55 (180008..180946) [939 bp, 312 aa] {ON} YOR026W...    30   8.3  
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    30   8.4  
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    30   8.5  
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...    31   8.5  
Skud_2.412 Chr2 complement(733900..736536) [2637 bp, 878 aa] {ON...    31   8.7  
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    30   8.7  
Suva_2.13 Chr2 complement(21441..24557) [3117 bp, 1038 aa] {ON} ...    31   8.8  
CAGL0M13585g Chr13 complement(1337038..1338441) [1404 bp, 467 aa...    30   8.8  
Kpol_530.39 s530 (90456..91340) [885 bp, 294 aa] {ON} (90456..91...    30   8.9  
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    30   8.9  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    30   8.9  
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    30   9.2  
Suva_4.541 Chr4 complement(937148..939775) [2628 bp, 875 aa] {ON...    30   9.5  
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    30   9.7  
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    30   9.7  

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  837 bits (2162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/407 (100%), Positives = 407/407 (100%)

Query: 1   MSKYNTNEQKSTIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNET 60
           MSKYNTNEQKSTIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNET
Sbjct: 1   MSKYNTNEQKSTIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNET 60

Query: 61  TNLPSNEQRLLLGTHTSGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKH 120
           TNLPSNEQRLLLGTHTSGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKH
Sbjct: 61  TNLPSNEQRLLLGTHTSGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKH 120

Query: 121 ELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL 180
           ELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL
Sbjct: 121 ELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL 180

Query: 181 DKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKD 240
           DKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKD
Sbjct: 181 DKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKD 240

Query: 241 VRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMR 300
           VRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMR
Sbjct: 241 VRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMR 300

Query: 301 GHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGH 360
           GHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGH
Sbjct: 301 GHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGH 360

Query: 361 RSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLREDPLVNMNVIR 407
           RSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLREDPLVNMNVIR
Sbjct: 361 RSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLREDPLVNMNVIR 407

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  441 bits (1134), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 223/415 (53%), Positives = 294/415 (70%), Gaps = 30/415 (7%)

Query: 6   TNEQKSTIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPS 65
           TN++++   +E + LT D+EY+LWKSNVPL+YDFVSETKL WP+LTVEWLPS+ ++   S
Sbjct: 23  TNQEETGNGDENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVS 82

Query: 66  NEQRLLLGTHTSGEEQNYLKIAEITLPDQIINEKTED------------NSDKHVKSNIR 113
           N Q L+LGTHTSGEE NYLKIA I LPD+++   T              +  +  +SNI+
Sbjct: 83  NRQELILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQREDDEDEDDQKQKPRSNIK 142

Query: 114 IIKKFKHELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGY 173
           I+KKFKHE E+TRA +MPQ++ IIATING GTVFIY+ S D+  +  +IS L  HKENGY
Sbjct: 143 IVKKFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSA--LISTLRFHKENGY 200

Query: 174 GLAFNPLDKGKLLSSSDDGSVAYWNIQ-------KSIPLLTLQETSIINDVRWNQFNQNL 226
           GL+FNP DKGKLLS SDDG++A W+IQ       K + +       I+ND +WN+FN N+
Sbjct: 201 GLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNV 260

Query: 227 FGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYL 286
           F  V+E S L L D R  N  +     + IKT   FN +AFS HS+YLMAA+G DSL+YL
Sbjct: 261 FASVSEDSTLQLHDQREQNTII-----NSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYL 315

Query: 287 YDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIE 346
           YD+RNL+ PL+ M GHEDS+T+L+F    DG++IS G+D+RV +WD+  IG EQ  D+ E
Sbjct: 316 YDSRNLSVPLYSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAE 375

Query: 347 DGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLREDPLV 401
           DG  PE++MIHAGHRS +NDFS++ N+ WL AS EE+NI+QVWK ++ L   P+V
Sbjct: 376 DG-APEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKL---PIV 426

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  426 bits (1096), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 217/383 (56%), Positives = 273/383 (71%), Gaps = 16/383 (4%)

Query: 17  EEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHT 76
           ++PL+ D+EYELW+SNVPL+YDFVSET L WP+LT+EWLP N      SN Q L+LGTHT
Sbjct: 7   DKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSH----SNRQELILGTHT 62

Query: 77  SGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTI 136
           S EE NYLKIA I LPD+I+  K +   D   KSNI+IIKKFKHE EVTRA YMPQDS +
Sbjct: 63  SEEEPNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDSNL 122

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           IATING GTVF+YD S D ++   ++S L  H++NGYGL+FNP+DKGKLLS SDD  +A 
Sbjct: 123 IATINGSGTVFLYDRSKDGDEG--LLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIAL 180

Query: 197 WNI--QKSIPLLTLQET--SIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVS 252
           W+I    + P+ T +      +ND +W++ N N FG V+E   L L D R     +K   
Sbjct: 181 WDITTNSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQR-----VKDSV 235

Query: 253 NHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFH 312
              IKT +AFN +AFS HS  L AA+G DSLIYLYD+R     LH M GHE +VT+L+F+
Sbjct: 236 TDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFY 295

Query: 313 ALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNN 372
           A  DGIV+S G D+RV +WDL +IG EQ  D+ +DG  PE++MIHAGHRSP+NDFSM+ N
Sbjct: 296 AAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGS-PEVVMIHAGHRSPVNDFSMNPN 354

Query: 373 LNWLCASIEEDNIVQVWKMNNSL 395
           + WL AS EE+NIVQVWK ++ L
Sbjct: 355 IPWLMASAEEENIVQVWKCSSKL 377

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  421 bits (1081), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 206/385 (53%), Positives = 286/385 (74%), Gaps = 11/385 (2%)

Query: 13  IKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLL 72
           I+ +E PLT DQEYELWKSNV L+YDFVSETKL WPSL+++WLPS +  N+P  +Q ++L
Sbjct: 7   IEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDA-NVPLKQQEMIL 65

Query: 73  GTHTSGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQ 132
           GTHTSG+E NYLKIA I LP +++    EDNS + VKS I++ KKF+HE EV RA YMP+
Sbjct: 66  GTHTSGDENNYLKIAAIDLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPK 125

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDG 192
           +  IIATING G +FIYD S  +++S  +   LS+HK+NGYGLAFNP  +G+LLS+SDD 
Sbjct: 126 NDKIIATINGKGKIFIYDRS--KSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDT 183

Query: 193 SVAYWNIQKS-IPL-LTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKI 250
           +VA W+I  +  P+ + +  T I+ND +W++F++N+FG V+E   L + D R+ +N  ++
Sbjct: 184 TVALWDINSTDRPVSIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQV 243

Query: 251 VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLD 310
           +    ++ P   NA+AFS HS+ L+AA+G D+ +YLYD R L++PLH M GH+D+VTS++
Sbjct: 244 LP---VEKP--LNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIE 298

Query: 311 FHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMS 370
           F +  DGI+ S GSD+R+ +WDL QIG EQ  ++ +DG VPEL+M+HAGHRS INDFS +
Sbjct: 299 FSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDG-VPELMMMHAGHRSAINDFSFN 357

Query: 371 NNLNWLCASIEEDNIVQVWKMNNSL 395
             + WL AS EEDN+VQVWK++  L
Sbjct: 358 PQVPWLIASAEEDNVVQVWKISKKL 382

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  415 bits (1067), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 202/383 (52%), Positives = 277/383 (72%), Gaps = 16/383 (4%)

Query: 17  EEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHT 76
           E+PL+ D+EY+LWKSNVPL+YDFVSET L WPSLT+EWLP + +    SN Q ++LGTHT
Sbjct: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRS----SNRQEMILGTHT 63

Query: 77  SGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTI 136
           S EEQNYLKIA I LPD+++ +      ++ +KSN++IIKKF+HE EVTRA YMPQD  +
Sbjct: 64  SDEEQNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQDDNL 123

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           IATI+G GT+++Y+ + +E +S  ++S    H ENGYGL+FNP +KGKLLS SDD ++  
Sbjct: 124 IATISGVGTIYLYNRA-NEVESG-LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVL 181

Query: 197 WNI----QKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVS 252
           W++    Q+ I   T + + I+ND +W+ F+QN+FG V+E S L L D R     ++  +
Sbjct: 182 WDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQR-----IRDAA 236

Query: 253 NHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFH 312
              ++    +N +AFS HS  L AA+G DS++YLYD R  ++PLH M GHED+VTSL+FH
Sbjct: 237 VEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFH 296

Query: 313 ALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNN 372
              DG++IS GSD+R  +WDL +IG EQ  D+ +DG  PE++MIHAGHRS INDFSM+ N
Sbjct: 297 PQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGS-PEVMMIHAGHRSSINDFSMNPN 355

Query: 373 LNWLCASIEEDNIVQVWKMNNSL 395
           + WL A+ EE+NIVQVWK ++ L
Sbjct: 356 IPWLTATAEEENIVQVWKPSSKL 378

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  413 bits (1062), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 209/392 (53%), Positives = 277/392 (70%), Gaps = 20/392 (5%)

Query: 15  EEEEP---LTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLL 71
           EEE+P   L+ D+EYELW+SNVPL+YDFVSET+L WPSL++EWLP  ++   P N Q L+
Sbjct: 14  EEEDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAP-NRQELI 72

Query: 72  LGTHTSGEEQNYLKIAEITLPDQII--NEKTEDN--SDKHVKSNIRIIKKFKHELEVTRA 127
           +GTHTSGEE NYLKIA I LP+ II   EK ED    +   KSNI+IIKKFKHE E+TRA
Sbjct: 73  IGTHTSGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGETTTKSNIKIIKKFKHEEEITRA 132

Query: 128 HYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLS 187
            YMPQ+S ++ATING G VF+YD S D++    ++S   +HKENGYGL+FN  D GKLLS
Sbjct: 133 RYMPQNSNLVATINGSGKVFLYDRSKDKHSG--LVSTFEYHKENGYGLSFNCNDAGKLLS 190

Query: 188 SSDDGSVAYWNIQKS----IPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRN 243
            SDDG++A WN+  S    I + +   + I+ND +W+ F+ N+FG V+E S L L D R 
Sbjct: 191 GSDDGTIALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQRE 250

Query: 244 NNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHE 303
            +      S   +  P  FN +AFS HS+YL AA+G DS +YL+D R++++PLH M GH+
Sbjct: 251 KDT---FTSQFKVDAP--FNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHD 305

Query: 304 DSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSP 363
            +VT+++F    DGI+++ G D+R  +WD+  IG EQ  D+ EDG  PE+LMIHAGHRS 
Sbjct: 306 GAVTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDG-APEVLMIHAGHRSA 364

Query: 364 INDFSMSNNLNWLCASIEEDNIVQVWKMNNSL 395
           INDFSM+ N+ WL AS EE+NI+QVWK ++ L
Sbjct: 365 INDFSMNPNIPWLMASSEEENIIQVWKCSHKL 396

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  410 bits (1054), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 202/386 (52%), Positives = 277/386 (71%), Gaps = 17/386 (4%)

Query: 14  KEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLG 73
           +E+EEPLT DQEYELWK+NVPL+YDFVSET+L WPSLT +WLP +E        Q ++LG
Sbjct: 5   REQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEE----DTRQYMILG 60

Query: 74  THTSGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQD 133
           THTSGEE +YLK+A + LPD+++  +  D+ ++  KSNI+I+KKF+H+ E+ RA YMP+D
Sbjct: 61  THTSGEEVDYLKVAALDLPDEVVTGEANDD-NRRTKSNIKIVKKFEHDGEINRARYMPKD 119

Query: 134 STIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGS 193
           S IIATING+G V IYD S  +++S+ + + L +HKENGYGL+FNP    +L+S SDD +
Sbjct: 120 SNIIATINGEGNVSIYDRS--KSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFT 177

Query: 194 VAYWNI----QKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLK 249
           +A W+I    +    +     + I+ND  W+ F++NLFG V+E S L L D R+ +   K
Sbjct: 178 IALWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTS---K 234

Query: 250 IVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSL 309
           +++   I+  +AFN +AFS HS  L AA+G D+ IYLYD R   +PLH M GHED++T L
Sbjct: 235 VINT--IQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCL 292

Query: 310 DFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSM 369
            FH   DGI++SGG+D+RV +WDL +IG EQ  DE +DG  PE+LMIHAGHRS INDF++
Sbjct: 293 QFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGS-PEILMIHAGHRSAINDFTL 351

Query: 370 SNNLNWLCASIEEDNIVQVWKMNNSL 395
              + WL AS+EEDN+VQVWK + +L
Sbjct: 352 HPTIPWLSASVEEDNVVQVWKCSKNL 377

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  408 bits (1048), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 205/400 (51%), Positives = 280/400 (70%), Gaps = 31/400 (7%)

Query: 13  IKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSN---EQR 69
           ++ +E+PL+ D+EY+LWKSNVPL+YDFVSET+L WPSLTV+WLP+      P     +Q 
Sbjct: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPT--PVQQPKGGFIKQE 58

Query: 70  LLLGTHTSGEEQNYLKIAEITLPDQIIN--------EKTEDNSDKHVKSNIRIIKKFKHE 121
           L++GTHTSGEE+NYLK AEI LP +++N        E  ++ S    +SNIRI  K++HE
Sbjct: 59  LIIGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHE 118

Query: 122 LEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLD 181
            E+TRA YMPQD  ++ATING GTVF+Y      ++S+ + S L  HK+NGY L+F+PL 
Sbjct: 119 EEITRARYMPQDPNMVATINGQGTVFLY------SRSDGLQSTLKFHKDNGYALSFSPLI 172

Query: 182 KGKLLSSSDDGSVAYWNIQ----KSIPLLTLQE--TSIINDVRWNQFNQNLFGYVTESSC 235
           KG LLS SDD SVA W++      + P+ T  +  + I+ND +W+ FN++LFG V+E S 
Sbjct: 173 KGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232

Query: 236 LNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQP 295
           L + D+R  N  +        K P  FN +AFS HS  ++AA+G DS +YLYD RN+ +P
Sbjct: 233 LKINDIRAENTTIDTA-----KCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEP 287

Query: 296 LHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLM 355
           LH+M GHED+VT+L+F    DG+V+S GSD R+ +WDLKQIG EQT D+ EDG VPEL+M
Sbjct: 288 LHHMSGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDG-VPELIM 346

Query: 356 IHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSL 395
           +HAGHRS +NDF ++  + WL AS EE+NI+QVWK ++SL
Sbjct: 347 VHAGHRSAVNDFDLNAQVPWLIASTEEENILQVWKCSHSL 386

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  406 bits (1044), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 211/412 (51%), Positives = 287/412 (69%), Gaps = 30/412 (7%)

Query: 13  IKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSN-ETTNLPSNEQRLL 71
           ++ +E+PL+ D+EY+LWKSNVPL+YDFVSET+L WPSLTV+WLP+  +  +    +Q L+
Sbjct: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI 60

Query: 72  LGTHTSGEEQNYLKIAEITLPDQII-NEKTEDNSDKHV-------KSNIRIIKKFKHELE 123
           +GTHTSGEE+NYLK AEI LP +I+ NE  ++ + +         +SNIRI  K++HE E
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120

Query: 124 VTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKG 183
           +TRA YMPQD  I+ATING GTVF+Y      ++S  + S L  HK+NGY L+F+ L KG
Sbjct: 121 ITRARYMPQDPNIVATINGQGTVFLY------SRSEGLQSTLKFHKDNGYALSFSTLVKG 174

Query: 184 KLLSSSDDGSVAYWNI----QKSIPLLTLQE--TSIINDVRWNQFNQNLFGYVTESSCLN 237
           +LLS SDD +VA W +      + P+ T  +  + IIND +W+ FN++LFG V+E S L 
Sbjct: 175 RLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLK 234

Query: 238 LKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLH 297
           + DVR NN  +  V     K P  FN +AFS HS  L+AA+G DS +YLYD RN+ +PLH
Sbjct: 235 INDVRANNTTIDTV-----KCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLH 289

Query: 298 YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIH 357
           +M GHED+V +L+F    DG+V+S GSD R+ +WDLKQIG EQT D+ EDG VPEL+M+H
Sbjct: 290 HMSGHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDG-VPELIMVH 348

Query: 358 AGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSL---REDPLVNMNVI 406
           AGHRS +NDF ++  + WL AS EE+NI+QVWK ++SL      P VN ++I
Sbjct: 349 AGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDII 400

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  405 bits (1042), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 209/408 (51%), Positives = 279/408 (68%), Gaps = 26/408 (6%)

Query: 12  TIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLL 71
           +I+EE + L+ ++EYELWK+NVPL+YDFVSETKL WPSLT++WLP N +    S +Q ++
Sbjct: 2   SIEEENKLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSS----STKQEMI 57

Query: 72  LGTHTSGEEQNYLKIAEITLPDQIINEK--------TEDNSDKHVKSNIRIIKKFKHELE 123
           LGTHTSGE+ NYLKIA I LP+ I+  +         E    ++V+S I+I KK KHE E
Sbjct: 58  LGTHTSGEDDNYLKIASIELPEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKHEEE 117

Query: 124 VTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKG 183
           +TRA +MPQD   IATING G VF++D S D+N++  ++S+ + HK+NGYGL+FNP  KG
Sbjct: 118 ITRARFMPQDPNFIATINGVGKVFLFDRSKDKNEA--LVSEHAFHKDNGYGLSFNPRTKG 175

Query: 184 KLLSSSDDGSVAYWNIQKS----IPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLK 239
           +LLS SDDG++A WN+  +       +T  E  I+ND  W++FN+NLFG V+E   L + 
Sbjct: 176 ELLSCSDDGTIALWNVMGTNTSPSKAVTTHE-DIVNDCTWHEFNENLFGSVSEDKTLQIH 234

Query: 240 DVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYM 299
           D R N+      + H +   S FN + FS HS+ L AA+G DSL+YLYD RN    LH M
Sbjct: 235 DKRTNS------TVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTM 288

Query: 300 RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAG 359
            GHEDSVTSL+F    DGI+ S GSD+RV +WDL QIG EQ  ++  DG VPEL+M+HAG
Sbjct: 289 SGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADG-VPELMMMHAG 347

Query: 360 HRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLREDPLVNMNVIR 407
           H+S +NDFS + N+ WL AS+EEDNIV VWK++  L    L+    IR
Sbjct: 348 HKSAVNDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPGLIQDYDIR 395

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  403 bits (1035), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 210/414 (50%), Positives = 286/414 (69%), Gaps = 34/414 (8%)

Query: 13  IKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSN---EQR 69
           ++ +E+PL+ D+EY+LWKSNVPL+YDFVSET+L WPSLTV+WLP+      P     +Q 
Sbjct: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPT--PVQEPEGGFIKQE 58

Query: 70  LLLGTHTSGEEQNYLKIAEITLPDQIIN------EKTEDN--SDKHVKSNIRIIKKFKHE 121
           L++GTHTSGEE+NYLK AEI LP +I+N      E  ED+  S    +SNI+I  K+KHE
Sbjct: 59  LIIGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHE 118

Query: 122 LEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLD 181
            E+TRA YMPQ+   +ATING GTVFIY      ++S  + S L  H+ENGY L+F+PL 
Sbjct: 119 EEITRARYMPQNPGTVATINGQGTVFIY------SRSEGLQSTLKFHEENGYALSFSPLV 172

Query: 182 KGKLLSSSDDGSVAYWNI----QKSIPLLTLQE--TSIINDVRWNQFNQNLFGYVTESSC 235
           +G LLS SDD +VA W++      + P+ T  +  + I+ND +W+ FN++LFG V+E S 
Sbjct: 173 EGLLLSGSDDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSL 232

Query: 236 LNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQP 295
           L + D+R  N      +    K P  FN +AFS HS  L+AA+G DS +YLYD RN+ +P
Sbjct: 233 LKINDLRVEN-----TTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEP 287

Query: 296 LHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLM 355
           LH+M GHED+VT+L+F    DG+V+S GSD R+ +WDLKQIG EQT D+ EDG VPEL+M
Sbjct: 288 LHHMSGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDG-VPELIM 346

Query: 356 IHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLR---EDPLVNMNVI 406
           +HAGH+S +NDF ++  + WL AS EE+NI+QVWK ++SL      P V+M++I
Sbjct: 347 VHAGHKSAVNDFDLNAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMI 400

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  400 bits (1028), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 207/389 (53%), Positives = 277/389 (71%), Gaps = 22/389 (5%)

Query: 13  IKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLL 72
           ++++EEPLT DQEY+LWKSNVPLLYDFVSET+L WPSLT++WLP ++T    S  Q L+L
Sbjct: 4   VEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKT----STRQHLIL 59

Query: 73  GTHTSGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQ 132
           GT TSG E +YLKIA + LPD+II  K    SDK VKSN++++KKF H+ E+ RA YMPQ
Sbjct: 60  GTLTSGAETDYLKIAALDLPDEIIIGK---KSDKVVKSNLKVVKKFAHDGEINRARYMPQ 116

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDG 192
           ++ IIAT+NG+GT+FIYD S D+  +  ++S L +HK+N YGLAFNP  +G+L+S SDD 
Sbjct: 117 NTNIIATVNGEGTIFIYDCSRDKQSA--LLSTLKYHKDNAYGLAFNPNAEGELISGSDDS 174

Query: 193 SVAYWN-----IQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN-N 246
           ++A W+     +++ I   T   + I+ND +W+ FN N+FG V+E S L L D RN   +
Sbjct: 175 TIALWDATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKS 234

Query: 247 DLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSV 306
           D+KI S         +N++AFS  SE L AA+G  + IYLYD RN  + LH M GHE+ V
Sbjct: 235 DVKISSK------GQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPV 288

Query: 307 TSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPIND 366
           TSL+F    DGI+ISG SD+RV +WDL +IG EQ  DE +DG +PE++MIHAG RS IND
Sbjct: 289 TSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDG-LPEVMMIHAGSRSAIND 347

Query: 367 FSMSNNLNWLCASIEEDNIVQVWKMNNSL 395
            S   ++ WL AS+EE+NIVQVWK ++ L
Sbjct: 348 ISTHPSIPWLNASVEENNIVQVWKCSSKL 376

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  398 bits (1023), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 209/408 (51%), Positives = 285/408 (69%), Gaps = 34/408 (8%)

Query: 18  EPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTS 77
           EP+T D+EYELWKSNVP+LYDFVSET+L WP+LTVEWLP           Q+L+LGTHTS
Sbjct: 26  EPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLV-AARTRQQLILGTHTS 84

Query: 78  GEEQNYLKIAEITLPDQIINEKTEDNSDKH----------VKSNIRIIKKFKHELEVTRA 127
           GEEQNYLKI  + LP ++      +NS K           V SN++I+KKF H+ E+TRA
Sbjct: 85  GEEQNYLKIGAVDLPVEVT-----ENSKKDREIDEEDEDMVLSNVKIVKKFPHDGEITRA 139

Query: 128 HYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLS 187
            YMPQD  IIATING+G +FIYD S  +N    ++S L +H ENGYGLAFN  +K  LLS
Sbjct: 140 RYMPQDDNIIATINGEGKIFIYDRS--KNGVEALLSTLEYHTENGYGLAFNANEKYSLLS 197

Query: 188 SSDDGSVAYW---NIQKSI-PLLTLQE--TSIINDVRWNQFNQNLFGYVTESSCLNLKDV 241
            SDD ++A W   N +K+I P +T ++  T IINDV+W+    ++FG V+E S + L D 
Sbjct: 198 GSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDK 257

Query: 242 RNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRG 301
           R++    +I+  H+I T   +N +AFS  S  L AA+G D+L+YLYD R+++ PL+ M G
Sbjct: 258 RSS----QII--HNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTG 311

Query: 302 HEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHR 361
           HED+VT+++F   NDGI+ S GSD+R  VWDL++IG EQT DEIEDG  PE+LMIHAGH+
Sbjct: 312 HEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGP-PEVLMIHAGHK 370

Query: 362 SPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLRE---DPLVNMNVI 406
           + IND +++ N+NWL AS EEDNIVQ+WK ++++     +P V+++++
Sbjct: 371 TSINDIAVNPNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSIL 418

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  398 bits (1022), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 208/425 (48%), Positives = 290/425 (68%), Gaps = 42/425 (9%)

Query: 6   TNEQKSTIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPS 65
           T   ++ ++ +E+ L+ D+EY+LWKSNVPL+YDFVSET+L WPSL+V+WLP+      P 
Sbjct: 20  TANNRAAMETQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPT------PI 73

Query: 66  NE-------QRLLLGTHTSGEEQNYLKIAEITLPDQIIN-----EKTEDNSDKHV---KS 110
            E       Q L++GTHTSGEE+NYLK AEI +P +I+N     E+ E++    +   KS
Sbjct: 74  QEAEGGFIRQELIIGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKS 133

Query: 111 NIRIIKKFKHELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKE 170
           NIRI  K+ HE E+TRA YMPQ+   +AT+NG GTVF+Y      ++S  + S L  HK+
Sbjct: 134 NIRITAKYVHEEEITRARYMPQNPDFVATLNGQGTVFLY------SRSGGLQSTLKFHKD 187

Query: 171 NGYGLAFNPLDKGKLLSSSDDGSVAYWNI---QKSI-PLLTLQE--TSIINDVRWNQFNQ 224
           NGY L+FN L +G+LLS SDD +VA W +     SI P+ T  +  + I+ND++W+ FN+
Sbjct: 188 NGYALSFNALVEGQLLSGSDDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNE 247

Query: 225 NLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLI 284
            LFG V+E S L + DVR +N     ++   +K P  FN +AFS HS  L+AA+G DS +
Sbjct: 248 KLFGTVSEDSLLKINDVRAHN-----ITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHV 302

Query: 285 YLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDE 344
           YLYD RN+ +PLH+M GHED+VT+++F    DG+V+S GSD R+ +WDLKQIG EQT D+
Sbjct: 303 YLYDLRNMREPLHHMSGHEDAVTNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDD 362

Query: 345 IEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSL---REDPLV 401
            EDG VPEL+M+HAGHRS +NDF ++  + WL AS EE+NI+QVWK +++L      P V
Sbjct: 363 AEDG-VPELIMVHAGHRSSVNDFDLNAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKV 421

Query: 402 NMNVI 406
           N ++I
Sbjct: 422 NKDII 426

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  389 bits (999), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 198/386 (51%), Positives = 268/386 (69%), Gaps = 17/386 (4%)

Query: 15  EEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGT 74
           +E  PL   +EY+LWKSNVP++YDFVSET+LVWPSLTV+WLP +     P   Q L+LGT
Sbjct: 26  DENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPN--PVTRQELILGT 83

Query: 75  HTSGEEQNYLKIAEITLPDQIINEKTEDNSDK-HVKSNIRIIKKFKHELEVTRAHYMPQD 133
           HTS EEQNYLKIA + LP ++ +      SD+  V+SNIR+ +KFKH+ EVTRA YMPQD
Sbjct: 84  HTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQD 143

Query: 134 STIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGS 193
             I+ATI+G GTV+IYD S   N+ +     L +H +NGYGLAFNPL KG LLS SDD +
Sbjct: 144 PNILATISGTGTVYIYDRS---NERDTASITLQYHTDNGYGLAFNPLIKGHLLSGSDDSN 200

Query: 194 VAYWNI--QKSIPLLTLQ--ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLK 249
           VA W++   ++ P+   +   + I+ND +W+ F ++LFG V+E S L + D R +    K
Sbjct: 201 VALWDVTSDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTRES----K 256

Query: 250 IVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSL 309
            V+   I     FN ++FS HSE L+A  G +S +YLYD R + +PLH M GH D+VTSL
Sbjct: 257 PVAT--INGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSL 314

Query: 310 DFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSM 369
           DF + +DGI++S G+DKRV +WD+  IG EQ  ++ ED    E++MIHAGHRSPINDF++
Sbjct: 315 DFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDA-TSEVMMIHAGHRSPINDFAI 373

Query: 370 SNNLNWLCASIEEDNIVQVWKMNNSL 395
           + ++ WL AS EE+NIVQ+WK ++ L
Sbjct: 374 NPSIPWLVASAEEENIVQLWKCSHKL 399

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  388 bits (996), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 200/401 (49%), Positives = 267/401 (66%), Gaps = 22/401 (5%)

Query: 13  IKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPS----NETTNLPSNEQ 68
           ++E E+P T ++EY+LW SNVP++YDFVSET+L WPSLTV+WLP+     E        Q
Sbjct: 4   VEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQ 63

Query: 69  RLLLGTHTSGEEQNYLKIAEITLPDQIINEK------TEDNSDKHVKSNIRIIKKFKHEL 122
            LL+GT T+  E NYLKIA I LP+ + + K       ++N   H +S I+I++KFKHE 
Sbjct: 64  ELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQ 123

Query: 123 EVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDK 182
           EVTRA YMPQ   IIAT+NG G V+I+D +I E     I S  S+HKENGYGLAFNP   
Sbjct: 124 EVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIAS-FSYHKENGYGLAFNPTVS 182

Query: 183 GKLLSSSDDGSVAYWNIQKSI---PLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNL 238
           G+LLS+SDDG+VA W++  +    P  T    T I+ND +W++F  +LFG V+E + L +
Sbjct: 183 GQLLSASDDGTVALWDVTSTANKSPSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLII 242

Query: 239 KDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHY 298
            D    N+D  I     +   SAFN +AFS  SE L+AA+G DS +YLYD R L +PLH 
Sbjct: 243 HDT---NSDRAI---QKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHS 296

Query: 299 MRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHA 358
           M GHEDSVTSL+F    DG++ S GSD+R+ +WDL  IG EQ  D+  DG VPEL M+H 
Sbjct: 297 MAGHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDG-VPELFMMHG 355

Query: 359 GHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLREDP 399
           GHRSP+N+FS ++N+ WL  S+EE+N++Q+WK  N +   P
Sbjct: 356 GHRSPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPP 396

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  383 bits (983), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 198/397 (49%), Positives = 276/397 (69%), Gaps = 26/397 (6%)

Query: 10  KSTIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQR 69
           ++TI E E  ++ D+EY+LWKSNVPL+YDFVSETKL+WPSLT++WLPSN+     SNEQ 
Sbjct: 2   QATIPENE--VSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDR----SNEQE 55

Query: 70  LLLGTHTSGEEQNYLKIAEITLPDQIINE------KTEDN--SDKHVKSNIRIIKKFKHE 121
           L+LGTHTSG EQNYLKIA + LPD+++++       T+D+  S    +S I+I++KF+H 
Sbjct: 56  LILGTHTSGTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHR 115

Query: 122 LEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLD 181
            EVTRA Y P +  +IATI+G G VF+YD S D + +  + ++ S HKENGYGL F+ + 
Sbjct: 116 DEVTRARYAPFNPNLIATISGSGKVFLYDRSKDSDSA--LTAEFSFHKENGYGLNFSVIS 173

Query: 182 KGKLLSSSDDGSVAYWNI--QKSIPL-LTLQETSIINDVRWNQFNQNLFGYVTESSCLNL 238
            G+LLS SDDGS+A W++   K+ P+ +     +I+N+ +W++ +  LFG V++ S L +
Sbjct: 174 PGELLSCSDDGSIAIWDVCSGKNTPVKVDTSHNNIVNECKWHEKSPFLFGSVSDDSTLII 233

Query: 239 KDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHY 298
            D R +   +KI+ +        +N +AFS HS  L AA+G DS + LYD R    P+H 
Sbjct: 234 HDKRIDKPVVKILQSE------PYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHS 287

Query: 299 MRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHA 358
           M GH DSVTSL+F    DGI+ SG SD+RV +WDL QIG EQ  ++ +DG VPELLM+HA
Sbjct: 288 MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDG-VPELLMMHA 346

Query: 359 GHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSL 395
           GH+SP+NDFS S N+ WL AS+EE+N+VQ+WK +  L
Sbjct: 347 GHKSPVNDFSCSPNIPWLMASVEEENVVQIWKASKKL 383

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  381 bits (979), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 198/402 (49%), Positives = 281/402 (69%), Gaps = 24/402 (5%)

Query: 14  KEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLG 73
           +EEE  L+ D+EY+LWKSNVPL+YDFVSETKL WPSLTVEWLP +     P  +Q +++G
Sbjct: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQA--PLTQQEMIIG 61

Query: 74  THTSGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQD 133
           THTS +E NY+KIA I LP+++I+    + SD  VKSN+RI KKFK E E+TR+ YM QD
Sbjct: 62  THTSDQEPNYVKIASIELPNEVID--PHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQD 119

Query: 134 STIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGS 193
             II+TI+G+GTV I+D     N S+  +   S+HK+NGYGL+FNP+ KG+LLS++DDG 
Sbjct: 120 PNIISTIDGNGTVSIFD----RNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLSAADDGY 175

Query: 194 VAYWNI--QKSIPLLTLQET--SIINDVRWNQFNQNLFGYVTE-SSCLNLKDVRNNNNDL 248
           +A ++I  +   P+ T Q T   IIND++W+ F+  LFG V+E  + L++ D+R  +   
Sbjct: 176 IAMYDINAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKD--- 232

Query: 249 KIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTS 308
           K+ S   I+    FN++AFS HS+ L +A+G D  +YLYD RN  + LH M GHE  VT+
Sbjct: 233 KVTS---IEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTN 289

Query: 309 LDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFS 368
           L+FH   DGI++S   D+R+ +WDL +IG EQ +++ +D   PEL+MIHAGHRS +NDFS
Sbjct: 290 LEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDA-TPELMMIHAGHRSSVNDFS 348

Query: 369 MSNNLNWLCASIEEDNIVQVWKMNNSL----REDPLVNMNVI 406
           +++++ WL AS EE+NI+QVWK ++ L       P +N ++I
Sbjct: 349 LNSSIPWLIASTEEENIIQVWKSSSRLPRISNSKPFINYDLI 390

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  382 bits (982), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 194/382 (50%), Positives = 263/382 (68%), Gaps = 21/382 (5%)

Query: 20  LTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSGE 79
           LT ++EYELW SNVP++Y+FVSETKL WPSLT++WLPS+      S EQ L+ GTHT+GE
Sbjct: 42  LTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQ----SPEQSLIFGTHTAGE 97

Query: 80  EQNYLKIAEITLPDQIIN---EKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTI 136
           E NYLK+A I LP  I        ED ++ H  S+  I  KF H  EV RA YMP +S I
Sbjct: 98  EVNYLKVATINLPAGIAGLDQGDEEDEANDH--SSFAIANKFPHIEEVIRARYMPANSNI 155

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           IATING GT+ I+D +++E+++   +S L+ HKENGYGLAFNP   G+LLS SDD +VA 
Sbjct: 156 IATINGKGTISIFDRTLEESKAQ--VSTLAFHKENGYGLAFNPHISGELLSGSDDTTVAL 213

Query: 197 WNIQ---KSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSN 253
           W+I+   K   +LT  +  I+NDV+W++F  N+FG V+E   L + D R     +++   
Sbjct: 214 WDIEAAKKPKSILTSHD-DIVNDVKWHEFESNVFGTVSEDKTLQVHDKR-----VRLEPV 267

Query: 254 HDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHA 313
             + T S FN ++FS HS  L+AA+G DS IYLYD R+++ PLH M GH+DSVT+++F  
Sbjct: 268 KKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSP 327

Query: 314 LNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNL 373
             DGI+ S GSD+R  +WDL QIG EQ+ D+ +DG  PEL+M+HAGHRSP+N+FS +  +
Sbjct: 328 HTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDG-APELMMMHAGHRSPVNEFSFNPQI 386

Query: 374 NWLCASIEEDNIVQVWKMNNSL 395
            WL AS EEDN++Q WK++  L
Sbjct: 387 PWLLASTEEDNVIQAWKVSMKL 408

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  369 bits (947), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 202/390 (51%), Positives = 273/390 (70%), Gaps = 22/390 (5%)

Query: 15  EEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGT 74
           E E  L+ D EY+LWKSNVPL+YDFVSET+L+WPSLT++WLP  E     S EQ LL+GT
Sbjct: 5   EPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAED----STEQELLVGT 60

Query: 75  HTSGEEQNYLKIAEITLPDQIIN------EKTEDNSDKHVKSNIRIIKKFKHELEVTRAH 128
           HTS  EQNYLKIAEI LP +I++      +   + SD+ V S I+IIKKFKHE EVTRA 
Sbjct: 61  HTSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRAR 120

Query: 129 YMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSS 188
           Y P DS +IATI+G GTVF+YD + D+   N +  K ++HKENGYGL F+    G+L+S 
Sbjct: 121 YAPFDSNLIATISGTGTVFLYDRTKDDE--NALRGKYAYHKENGYGLNFSVASPGELISC 178

Query: 189 SDDGSVAYWNIQ--KSIPL-LTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           SDDGS+A W+I+  K++P  +    + I+N+ +W++ + N++G V+E S L + D R+  
Sbjct: 179 SDDGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEK 238

Query: 246 NDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDS 305
              K++     K P  FN +AFS HS  L AA+G D+++YL+D+R   + LH M GH+++
Sbjct: 239 PLQKLLQ----KEP--FNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292

Query: 306 VTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPIN 365
           VTSL+F    DGI+ SGGSD+RV +WDL QIG EQ  ++ +DG  PELLM+HAGH+S IN
Sbjct: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGG-PELLMMHAGHKSAIN 351

Query: 366 DFSMSNNLNWLCASIEEDNIVQVWKMNNSL 395
           DFS S N+ WL AS+EE+NIVQ+WK +  L
Sbjct: 352 DFSFSPNVPWLMASVEEENIVQIWKPSRKL 381

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  141 bits (355), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 119/429 (27%), Positives = 194/429 (45%), Gaps = 69/429 (16%)

Query: 11  STIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRL 70
           STI EE +     + Y  WK N  L YD+++     WPSLT +  P     +L ++E R+
Sbjct: 15  STIAEERQ-----KRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFPD---LDLATDEHRI 66

Query: 71  LLGTHTSGE--EQNYLKIAEIT----LPDQIIN-------EKTEDNS----DKHVKSNIR 113
           LL + TS +  E   L +A ++    +P   +N       E   DNS     K +  ++R
Sbjct: 67  LLSSFTSSQVPEDESLYVARLSSMKHIPWSSLNNFDMEEKEFKVDNSLKLPSKSLVEDLR 126

Query: 114 IIKKFKHELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISK--------- 164
           I  KF    +  +A Y P +  +I + + +G+++++D +        +IS          
Sbjct: 127 I--KFPAG-DCNKARYCPSNPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHC 183

Query: 165 -----LSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK----SIPLLTLQETSII- 214
                L  HK     LA+N   +G L +S   G V  W+++K    S  L+     S + 
Sbjct: 184 QLSTSLEEHKNEAVSLAWNWQRQGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAMSTVD 243

Query: 215 ----NDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFH 270
               N+V W   + +L  Y +E + + + D+RN        SN      +  N   F++H
Sbjct: 244 PRGSNEVSWMVRHDSLLAYCSEDNLVGIMDIRNPEKGQSSGSN--PHHSNGINTCQFNYH 301

Query: 271 SEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKR-VA 329
            + L+ ++     I L+D RN  QPL  +  H DS++ L ++     ++ +GG D   V 
Sbjct: 302 RDMLLCSADSAGRINLWDIRNFTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVK 360

Query: 330 VWDLKQI-GQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQV 388
           +WDL Q  GQE             L+  H GH   +ND S   +  W+  S+  DN +QV
Sbjct: 361 IWDLSQPEGQE-------------LIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQV 407

Query: 389 WKMNNSLRE 397
           W+ +NSL E
Sbjct: 408 WRPSNSLVE 416

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  139 bits (351), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 119/420 (28%), Positives = 199/420 (47%), Gaps = 70/420 (16%)

Query: 19  PLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSG 78
           P+   + Y  WK N  LLYD+++     WPSLT ++ P  +TT   S+E R+LL + TS 
Sbjct: 16  PIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTT---SDEHRILLSSFTSS 72

Query: 79  E--EQNYLKIAEITLPDQI------------INEKTEDNSDKHVKSNIRIIKKFKHELEV 124
           +  E   + I++I+    I            +  K E+++    K  +  I  F    E 
Sbjct: 73  QKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIFFPNGEC 132

Query: 125 TRAHYMPQDSTIIATINGDGTVFIYD------TSIDENQ-SNPIISKL------------ 165
            RA Y+PQ+  IIA  + DG ++I+D      T I +++ S+P  +KL            
Sbjct: 133 NRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEA 192

Query: 166 ----SHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK--------SIPLLTL-QETS 212
               S        LA+N   +  LLSS  +G V  W+I++         +PL+++  + +
Sbjct: 193 MDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGT 252

Query: 213 IINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSE 272
            +NDV W   + +LF   TE + ++L D+R      K+ SN + K     N+  F++ + 
Sbjct: 253 AVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKE--KLQSNRE-KHDGGVNSCRFNYKNS 309

Query: 273 YLMAASGEDSLIYLYDTRNLNQ-PLHYMRGHEDSVTSLDFHALNDGIVISGGS-DKRVAV 330
            ++A++  +  + L+D RN+N+ P+  M  H  SV++L++    D ++ + G  D  V +
Sbjct: 310 LILASADSNGRLNLWDIRNMNKSPIATME-HGTSVSTLEWSPNFDTVLATAGQEDGLVKL 368

Query: 331 WDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWK 390
           WD        TS E       E +  H GH   +ND S   +  WL  S+  DN V +WK
Sbjct: 369 WD--------TSCE-------ETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWK 413

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  137 bits (346), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 120/418 (28%), Positives = 193/418 (46%), Gaps = 76/418 (18%)

Query: 24  QEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSGE--EQ 81
           + Y  WK N  LLYD+++     WPSLT ++ P  +TT    NE R+LL + TS +  E 
Sbjct: 21  ERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTT---LNEHRILLSSFTSSQKPED 77

Query: 82  NYLKIAEITLPDQI----IN-----------EKTEDNSDKHVKSNIRIIKKFKHELEVTR 126
             + I+ I+    I    +N           E T     KH+  +IRI   F    E  R
Sbjct: 78  ETIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDDIRI---FFPNGECNR 134

Query: 127 AHYMPQDSTIIATINGDGTVFIYD------TSIDENQ-SNPI-ISKLSHHK--------- 169
           A Y+PQ+  IIA  + DG ++I+D      T I +++ S+P  I  L  H          
Sbjct: 135 ARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLGSHGVIQDVETMD 194

Query: 170 ------ENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK--------SIPLLTL-QETSII 214
                      LA+N   +  LLSS  +G +  W+I++         +PL+++  + S +
Sbjct: 195 TSLVDINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDVPLMSIDSDGSSV 254

Query: 215 NDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYL 274
           NDV W   + +LF   TE + ++L D+R     LK  SN  I      N+  F++ +  +
Sbjct: 255 NDVTWMPTHDSLFAACTERNAVSLLDLRTKKEKLK--SNCKIHG-GGVNSCKFNYKNSLI 311

Query: 275 MAASGEDSLIYLYDTRNLNQ-PLHYMRGHEDSVTSLDFHALNDGIVISGGS-DKRVAVWD 332
           +A++  +  + L+D RN+N+ P+  M  H  SV++L++    D ++ + G  D  V +WD
Sbjct: 312 LASADSNGRLNLWDIRNMNENPIATME-HGASVSTLEWSPNFDTVLATAGQEDGLVKLWD 370

Query: 333 LKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWK 390
             +                E +  H GH   +ND S   +  WL  S+  DN V +WK
Sbjct: 371 TTR---------------EESIFTHGGHMFGVNDISWDVHDPWLMCSVANDNSVHIWK 413

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  136 bits (343), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 117/442 (26%), Positives = 210/442 (47%), Gaps = 73/442 (16%)

Query: 1   MSKYNTNEQKSTIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNET 60
           M+  +T +++STI     P    Q Y  WK N  LLYD+++     WPSLT ++ P  +T
Sbjct: 1   MATESTAQEQSTI-----PNDLQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFPDLDT 55

Query: 61  TNLPSNEQRLLLGTHTSGE--EQNYLKIAEITLPDQIINEKTEDNSD------------- 105
           T   S+  R+L+ + TS +  E   + I++I+    + N  + +N D             
Sbjct: 56  T---SDTHRILISSFTSSQLPEDEAIHISKISTLKHL-NWASVNNFDMDEMEFKPDTNLK 111

Query: 106 ---KHVKSNIRIIKKFKHELEVTRAHYMPQDSTIIATINGDGTVFIYD------TSIDEN 156
              KH+ +++ I  KF +  +  RA Y+PQ+  +IA  + +G+V+I+D      + I ++
Sbjct: 112 LPSKHLVNDLTI--KFPNG-DCNRARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQS 168

Query: 157 QS-----------NPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSI-- 203
           ++           +  + +L  +      LA+N   +G L S    G V  W+I++    
Sbjct: 169 KNLKPYDAVLFNNSETVEELHENTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHS 228

Query: 204 ------PLLTLQETSI-INDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDI 256
                 P+L +Q  ++ +NDV W   + +LF    ES  L L D R      +I  N   
Sbjct: 229 NPVLDKPVLNIQFDALGVNDVSWMPSHDSLFVACGESDTLALFDQRIGKEVSRIAQN--- 285

Query: 257 KTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALND 316
           +     N+  F++ +  L+A++  + L+ ++D RNL+Q       H  S+++++++   D
Sbjct: 286 RHNGGVNSCKFNYQNNMLLASADSEGLVNMWDIRNLDQYPIKSINHGSSISTIEWNPNLD 345

Query: 317 GIVISGG-SDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNW 375
            I+ + G +D  V +WD+     E             LL +H GH   +ND S   + +W
Sbjct: 346 TIIATAGQNDGLVKLWDVSNTDNE-------------LLFVHGGHMLGVNDISWDLHDSW 392

Query: 376 LCASIEEDNIVQVWKMNNSLRE 397
           L  S+  DN +Q+WK  ++L E
Sbjct: 393 LMCSVSNDNSIQIWKPAHNLVE 414

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  134 bits (336), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 117/406 (28%), Positives = 188/406 (46%), Gaps = 59/406 (14%)

Query: 24  QEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSGE--EQ 81
           Q Y  WK N  LLYD+++     WPSLT +++P  E   +P+++ RLLL + TS +  E 
Sbjct: 23  QRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMPDLE---VPTDKHRLLLSSFTSSQLPED 79

Query: 82  NYLKIAEIT----LPDQIIN----EKTEDNSDKHVK-SNIRIIKKFKHEL---EVTRAHY 129
             + I+E++    +P   +N    ++ E   D   K  N  +++  + +    +  RA Y
Sbjct: 80  EAVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAKLPNKNLVETVRIQFPSGDCNRACY 139

Query: 130 MPQDSTIIATINGDGTVFIYD-TSIDENQSNPIISKLSHH-------------KENGYGL 175
           MPQ+  II  I   G V I+D T    N+   + S  S+                    L
Sbjct: 140 MPQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPESLGDADSAEALSL 199

Query: 176 AFNPLDKGKLLSSSDDGSVAYWNI---QKSIPLLT------LQETSIINDVRWNQFNQNL 226
           A+N    G + SS  +G +  W+I   QKS P ++      LQ+ +  NDV W   + ++
Sbjct: 200 AWNWQKAGIIASSYSNGLIKVWDITRYQKSQPTISNPELRILQDKAGTNDVSWMVHHSSI 259

Query: 227 FGYVTESSCLNLKDVRNNNN-DLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIY 285
                ES+ + L D R  +       S H        NA+ F++ ++ L+ A+  +  I 
Sbjct: 260 LAACGESNTIGLLDTRAPDAFKPTKASPHT----GGINALQFNYANDMLLCAADSNGGIA 315

Query: 286 LYDTRNLNQPLHYMRGHEDSVTSLDFHA-LNDGIVISGGSDKRVAVWDLKQIGQEQTSDE 344
           L+D R  ++PL     H DSV++L ++  L   +  +G  D  + +WD        TS E
Sbjct: 316 LWDCRAFSKPLSVFN-HGDSVSALQWNPNLPTIVATAGQGDGLIKIWD--------TSRE 366

Query: 345 IEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWK 390
            ED     LL +H GH   +ND + + +  WL  S+  DN V VWK
Sbjct: 367 PED----SLLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWK 408

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  131 bits (330), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 117/421 (27%), Positives = 195/421 (46%), Gaps = 72/421 (17%)

Query: 19  PLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSG 78
           P    + Y  WK N  LLY++++     WPSLT ++ P  +TT    +E R+LL + TS 
Sbjct: 16  PPNLQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFPDLDTT---LDEHRILLSSFTSS 72

Query: 79  E--EQNYLKIAEITLPDQI------------INEKTEDNSDKHVKSNIRIIKKFKHELEV 124
           +  E   + I++I+    I            +  K E+++    K  +  I  F    E 
Sbjct: 73  QKPEDESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISIFFPNGEC 132

Query: 125 TRAHYMPQDSTIIATINGDGTVFIYD------TSIDENQ-SNPIISKL------------ 165
            RA Y+PQ+  IIA  + DG ++I+D      T I +++ S+P  +KL            
Sbjct: 133 NRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHGVIQDVET 192

Query: 166 ----SHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK--------SIPLLTL-QETS 212
               S        +A+N   +  LLSS  +G V  W+I++         +PL+++  + S
Sbjct: 193 MDASSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGS 252

Query: 213 IINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKI-VSNHDIKTPSAFNAMAFSFHS 271
            +NDV W   + +LF   TE + ++L D+R     LK    +H+       N+  F++ +
Sbjct: 253 GVNDVTWMPTHDSLFAACTEGNTVSLLDLRTKKEKLKSNCRSHN----GGVNSCKFNYRN 308

Query: 272 EYLMAASGEDSLIYLYDTRNLNQ-PLHYMRGHEDSVTSLDFHALNDGIVISGGS-DKRVA 329
             ++A++  +  + L+D RN+N  PL  M  H  SV++L++    D ++ + G  D  V 
Sbjct: 309 SLILASADSNGKLNLWDIRNMNDCPLTTME-HGGSVSTLEWSPNFDTVLATAGQEDGLVK 367

Query: 330 VWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
           +WD        TS E       E +  H GH   +ND S   +  WL  S+  DN V +W
Sbjct: 368 LWD--------TSRE-------ENIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIW 412

Query: 390 K 390
           K
Sbjct: 413 K 413

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  129 bits (323), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 112/420 (26%), Positives = 194/420 (46%), Gaps = 70/420 (16%)

Query: 19  PLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSG 78
           P+   + Y  WK N  LLYD+++     WPSLT ++ P  +TT    +E R+LL + TS 
Sbjct: 16  PIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTT---LDEHRILLSSFTSS 72

Query: 79  E--EQNYLKIAEITLPDQI----INEKTEDNSDKHVKSNIRI--------IKKFKHELEV 124
           +  E   + I++I+    I    +N    D  +   ++  R+        I  F    + 
Sbjct: 73  QKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENTTRLPPSHLVNDISIFFPNGDC 132

Query: 125 TRAHYMPQDSTIIATINGDGTVFIYD------TSIDENQ-SNPIISKL------------ 165
            RA Y+PQ+  IIA  + DG ++I+D      T I +++ S+P  +KL            
Sbjct: 133 NRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDVEA 192

Query: 166 ----SHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK--------SIPLLTLQ-ETS 212
               S        LA+N   +  LLSS  +G V  W+I++          PL++++ + S
Sbjct: 193 MDTSSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIESDAS 252

Query: 213 IINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSE 272
            +NDV W   + +LF   TE + ++L D+R     L+  SN    T    N+  F++ + 
Sbjct: 253 GVNDVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKLR--SNRQNHT-GGVNSCKFNYRNS 309

Query: 273 YLMAASGEDSLIYLYDTRNLNQ-PLHYMRGHEDSVTSLDFHA-LNDGIVISGGSDKRVAV 330
            ++A++  +  + L+D R +N+ P+  M  H  S+++L+++   +  +  +G  D  V +
Sbjct: 310 LVLASADSNGRLNLWDIRKMNESPITTME-HGASISTLEWNPNFSTVLATAGQQDGLVKL 368

Query: 331 WDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWK 390
           WD  +                E +  H GH   +ND S   +  WL  S+  DN V +WK
Sbjct: 369 WDTAR---------------EETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIWK 413

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  126 bits (316), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 109/407 (26%), Positives = 187/407 (45%), Gaps = 56/407 (13%)

Query: 18  EPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTS 77
           EPL   Q Y  WK N  LLY++++     WPSLT +++P     ++ S++ R+LL + TS
Sbjct: 19  EPL--QQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMPD---MDIASDKHRILLSSFTS 73

Query: 78  GE--EQNYLKIAEITLPDQII--------NEKTEDNSDKHVKSNIRIIKKFK---HELEV 124
            +  E   + I+EI+    I          E+ E   D  VK +  + +  K    E + 
Sbjct: 74  AQLPEDEAIYISEISTMKHIAWSSLNNFHMEEMEFKVDNQVKLSKNLTETIKIQFPEGDC 133

Query: 125 TRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHK------ENGY----- 173
            RA YMPQ+  +IA+ +  G+V+I+D +   +    I+     +       E+G      
Sbjct: 134 NRARYMPQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGCNYEAS 193

Query: 174 GLAFNPLDKGKLLSSSDDGSVAYWNIQK--------SIPLLTLQ-ETSIINDVRWNQFNQ 224
            LA+N    G L +S  DG V  W+I K        ++P L  Q +    N+V W   + 
Sbjct: 194 SLAWNYQRSGILAASYSDGDVKIWDITKYNKAQPQLTVPDLRWQVDKEGANEVSWMVHHS 253

Query: 225 NLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLI 284
           ++     E + L + D R           H   T    NA+ F++ +++L+ ++  +  +
Sbjct: 254 SILAVCGEGNGLTILDTRTPTT--FSTKRHSCHT-GGINAVQFNYDNDFLLCSADSEGTL 310

Query: 285 YLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGG-SDKRVAVWDLKQIGQEQTSD 343
            + D R L  P+     H D+V+++ ++     ++ S G +D  V +WDL Q        
Sbjct: 311 NICDIRQLEHPVK-TWSHLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDLAQ-------- 361

Query: 344 EIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWK 390
             ED     L+ IH GH   +ND + +++  W+  S+  DN V +WK
Sbjct: 362 --EDD---PLVFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWK 403

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  125 bits (314), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 115/428 (26%), Positives = 192/428 (44%), Gaps = 74/428 (17%)

Query: 24  QEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSGE---- 79
           Q Y  WK N  LLYD+++     WPSLT ++ P  + +N   +  RLLL T TS +    
Sbjct: 15  QRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSN---DTHRLLLSTFTSSQIPDD 71

Query: 80  ---------EQNYLKIAEITLPDQIINEKTEDNSDKHVKSN-IRIIKKFKHELEVTRAHY 129
                      N+L  + +   D    E   DN  K    N I  I     E +  +A Y
Sbjct: 72  ESIYISHISTLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLITDISITFPEGDCNKARY 131

Query: 130 MPQDSTIIATINGDGTVFIYDTSIDENQ------------SNPIISKLSHHK----ENG- 172
           MPQ+  II   + +G ++I+D +   ++            S    +KL+  +    E+G 
Sbjct: 132 MPQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEAKLAKQRKFVIEDGT 191

Query: 173 -------YGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLL------TLQETSI----IN 215
                    +A+NP  +G+LLS   +G++  W+ QK           T+ +T+      N
Sbjct: 192 KNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDDLGCN 251

Query: 216 DVRWNQFNQNLFGYVTESSCLNLKDVRNNN--NDLKIVSNHDIKTPSAFNAMAFSFHSEY 273
           +V W   + ++F    E++ + + D R     N ++   NH+       N+  F++ +  
Sbjct: 252 EVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIE-QGNHN----GGINSCKFNYENAM 306

Query: 274 LMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGS-DKRVAVWD 332
           L+A+   + +I L+D R LN+P+  +  H  S++++++  L + ++ SGG  D  V +WD
Sbjct: 307 LLASGDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGLVKLWD 365

Query: 333 LKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMN 392
              I  E+           E + IH GH   IND S   +  WL  S+  DN +Q+WK  
Sbjct: 366 ---ISNEE-----------EPIFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQIWKPA 411

Query: 393 NSLREDPL 400
             L E  L
Sbjct: 412 KHLVETKL 419

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  125 bits (314), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 105/411 (25%), Positives = 185/411 (45%), Gaps = 54/411 (13%)

Query: 24  QEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSGE---- 79
           Q Y  WK N  LLYD+++     WPSL+ ++ P    TN   ++QR+LL + TS +    
Sbjct: 22  QRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFPDRTLTN---DKQRILLSSFTSQQLPQD 78

Query: 80  ---------EQNYLKIAEITLPDQIINEKTEDNS----DKHVKSNIRIIKKFKHELEVTR 126
                      N++K + I   D    E   DNS    DK ++  +RI      + +  R
Sbjct: 79  ESIYIGSISTMNHMKWSSINNFDMDEMEFKLDNSLKLNDKTLEEEVRITYP---DGDCNR 135

Query: 127 AHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENG-------YGLAFNP 179
             YMPQ+  II T + +G+V+I+D +   N+ +         + NG         LA+N 
Sbjct: 136 CRYMPQNPDIIGTASSNGSVYIFDRTKHGNKISTGRKFEIECRNNGDDEQDESLSLAWNY 195

Query: 180 LDKGKLLSSSDDGSVAYWNIQK--------SIP-LLTLQETSIINDVRWNQFNQNLFGYV 230
             +G L +   +G V  W++ K         IP   ++ + + +NDV W   + ++    
Sbjct: 196 QLEGTLATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNHTSILASC 255

Query: 231 TESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTR 290
            ES+ + L D+R    D K+ + H        NA+ F++ ++ ++        + ++D R
Sbjct: 256 GESNVIGLIDIR---QDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLKIWDIR 312

Query: 291 NLNQPL-HYMRGHEDSVTSLDFHALNDGIVISGGSDKR-VAVWDLKQIGQEQTSDEIEDG 348
           +  +P+  +  G +D ++++ ++     I+ +       V +WD         S E ED 
Sbjct: 313 DFKEPIKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWD--------ASGEQEDS 364

Query: 349 DVPE--LLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLRE 397
           +     LL +H GH   +ND S S +  W   S+  DN + +WK   +L E
Sbjct: 365 NAENNMLLFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAANLVE 415

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  124 bits (312), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 106/422 (25%), Positives = 183/422 (43%), Gaps = 56/422 (13%)

Query: 12  TIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLL 71
            I     P    Q Y  WK N  LLY++++     WPSLT +  P     +L  +E R+L
Sbjct: 11  AIASSAIPEDRQQRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFPD---LDLAGDEHRIL 67

Query: 72  LGTHTSGE--EQNYLKIAEIT----LPDQIIN-------EKTEDNSDKHVKSNIRIIKKF 118
           L + TS +  E   + +A ++    +P   +N       E   DNS K    NI    + 
Sbjct: 68  LSSFTSSQLPEDEAIYVARLSSMKHIPWSSLNNFDTDEMEFKMDNSLKLPPKNIVEDLRI 127

Query: 119 KHEL-EVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIIS-------------- 163
           K    +  +A Y P +  +I++ + +G+V+++D +   +    +IS              
Sbjct: 128 KFPAGDCNKARYCPSNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLST 187

Query: 164 KLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK---SIPLLTLQETSII------ 214
            L   +     LA+N   +G L +    G V  W++ K   + P L    +S++      
Sbjct: 188 SLEERQNEALNLAWNWQQQGLLATCYSGGEVCVWDLAKYDKASPTLIDPHSSLLADPQGS 247

Query: 215 NDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYL 274
           ND+ W   + +L  Y  E + L + D R      +  SN      +  NA  F+++ + L
Sbjct: 248 NDISWMVNHDSLLAYCGEGNALGVLDTRITKQPPQSFSN--PHHSNGVNACQFNYYKDLL 305

Query: 275 MAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKR-VAVWDL 333
           + ++     I L+D R+ + P+  +  H  SV++L ++  +  I+ + G D   V +WDL
Sbjct: 306 LCSADSAGRINLWDIRDFSSPIRSL-DHHGSVSALQWNPHHPTILATAGQDDGLVKIWDL 364

Query: 334 KQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNN 393
            Q   +            EL   H GH   +ND S   N  W+  S+  DN +Q+WK + 
Sbjct: 365 SQPVDQ------------ELKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQ 412

Query: 394 SL 395
           +L
Sbjct: 413 NL 414

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  124 bits (311), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 114/406 (28%), Positives = 190/406 (46%), Gaps = 59/406 (14%)

Query: 24  QEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSGE--EQ 81
           + Y  WK N  LLY +++     WPSLT ++ P  +TT   ++  R+LL T TS +  E 
Sbjct: 18  ERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFPDLDTT---TDTHRILLSTFTSSQLPED 74

Query: 82  NYLKIAEITLPDQI----IN-------EKTEDNSDKHVKSNIRI-IKKFKHELEVTRAHY 129
             L IA ++  + +    +N       E   DNS K    N+ + I       +  RA Y
Sbjct: 75  ESLYIANLSTSNHLNWSSLNNFDMDEMEFKPDNSTKFPSKNLNVDISIPFPNGDCNRARY 134

Query: 130 MPQDSTIIATINGDGTVFIYDTS------IDENQSNPIISKLSHHK--EN------GYGL 175
           +PQ+  ++A  + +G+++I++ +      ++ NQ +      S  K  EN         +
Sbjct: 135 LPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTDKMDENFTNSNEAVSI 194

Query: 176 AFNPLDKGKLLSSSDDGSVAYWNIQK---SIPLLTLQETSI------INDVRWNQFNQNL 226
           A+N    G L SS   GS+  W+I K   S P L   E +I       N+V W   + ++
Sbjct: 195 AWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTLRENELTIPFDPEGCNEVTWMVNHDSI 254

Query: 227 FGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPS-AFNAMAFSFHSEYLMAASGEDSLIY 285
           F   +ES+ L+L DVR     LK+  N  I T S   N+  F+++++ L+A++     I 
Sbjct: 255 FAACSESNKLSLFDVRTKEEMLKMTEN--IGTHSGGINSCKFNYYNDMLLASADSTGKIN 312

Query: 286 LYDTRNLNQPLHYMRGHEDSVTSLDFHA-LNDGIVISGGSDKRVAVWDLKQIGQEQTSDE 344
           ++D R L++       H  S+++L+++  L   +V +G  D  V +WD    GQ      
Sbjct: 313 MWDIRKLDKEPIKSFNHNSSISTLEWNPNLETILVTAGQDDGLVKIWDTAN-GQN----- 366

Query: 345 IEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWK 390
                    + +H GH   +ND S   +  WL +S+  DN + VWK
Sbjct: 367 ---------IFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWK 403

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  122 bits (305), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 115/422 (27%), Positives = 192/422 (45%), Gaps = 68/422 (16%)

Query: 19  PLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSG 78
           P      Y  WK N  LLYD+++     WPSLT ++ P  +TTN   ++ RLLL + TS 
Sbjct: 27  PEEVQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTN---DQHRLLLSSFTSS 83

Query: 79  E--EQNYLKIAEIT----LPDQIIN-------EKTEDNSDKHVKSNIRIIKKFKHEL--- 122
           +  E   + ++ ++    LP   +N       E   DNS K    N  +IK+        
Sbjct: 84  QLPEDESIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLPSKN--LIKELNISFPMG 141

Query: 123 EVTRAHYMPQDSTIIATINGDGTVFIYDTSID----------------ENQSNPIISKLS 166
           +   A Y+PQ+  +IA  + +G+++++D +                  E QS    S L 
Sbjct: 142 DCNGARYLPQNPDVIAAASSNGSIYVFDRTKHGLTRQKLHDGGSMFELEFQS----SSLE 197

Query: 167 HHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK---SIPLLTLQETS------IINDV 217
            H+E    LA+N   +G L +    G V  W+++K   + P++   + +        NDV
Sbjct: 198 EHQE-VVSLAWNWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTHNADPRGCNDV 256

Query: 218 RWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPS-AFNAMAFSFHSEYLMA 276
            W   + ++     ES+ +N+ D R     L   S  D K  S   N+  F++H++ L+ 
Sbjct: 257 SWMVNHASILACCGESNSINVIDTRAQKGVLS--STKDTKHHSRGINSSQFNYHNDMLLC 314

Query: 277 ASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHA-LNDGIVISGGSDKRVAVWDLKQ 335
           +      + L+D R+L  PL  +  H  S++   ++  L+  +  +  SD  V +WD+ Q
Sbjct: 315 SGDSTGRVNLWDIRDLETPLKSL-DHGSSISKTQWNPNLSTILATADQSDGLVKLWDIAQ 373

Query: 336 IGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSL 395
                     E G+  ELL +H GH   +ND S + +  WL  S+  DN VQ+W+   +L
Sbjct: 374 ----------EPGE--ELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPARNL 421

Query: 396 RE 397
            E
Sbjct: 422 VE 423

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  121 bits (303), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 114/431 (26%), Positives = 207/431 (48%), Gaps = 69/431 (16%)

Query: 16  EEEPLTTDQE-----YELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRL 70
           EE+P++T  E     Y  WK N  LLYD+++     WPSLT ++ P  +T+   S++ RL
Sbjct: 10  EEQPVSTIPEDVQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTS---SDQHRL 66

Query: 71  LLGTHTSGE--EQNYLKIAEITLPDQI----INEKTEDNSDKHVKSNIRIIKK-FKHELE 123
           LL + TS +  E   + I++I+    +    +N    D  +     ++++  K    E+ 
Sbjct: 67  LLSSFTSSQLPEDESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTTEVS 126

Query: 124 V-------TRAHYMPQDSTIIATINGDGTVFIYDTS------IDENQSNPIISKL---SH 167
           +        R+ Y+PQ+  +IA  + DG+V+I++ +      +    S+   ++L   SH
Sbjct: 127 IRFPNGDCNRSRYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFSGSH 186

Query: 168 HKEN------GYGLAFNPLDKGKLLSSSDDGSVAYWNIQK--------SIPLLTLQ-ETS 212
             +N         L++N   +G L  S   G    W+++K        S P LT+  +++
Sbjct: 187 DAQNLDNFNEAVSLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELTVTFDSN 246

Query: 213 IINDVRWNQFNQNLFGYVTESSCLNLKDVR-NNNNDLKIVSNHDIKTPSAFNAMAFSFHS 271
             ND+ W   + ++F    ES+ L L D+R N   ++  +SN+  K     N   F+  +
Sbjct: 247 GCNDLDWMPMHDSMFIACGESNKLGLFDMRLNGEKEVNSISNY--KHEDGINTCKFNPGN 304

Query: 272 EYLMAASGEDSLIYLYDTRNLNQ-PLHYMRGHEDSVTSLDFHALNDGIVIS--GGSDKRV 328
             L+A++     I L+D R L+Q P+  M+ H  S+++++++  N G+V +  G  D  V
Sbjct: 305 SLLVASADTCGRINLWDIRKLDQEPISTMQ-HGSSISTIEWNP-NIGVVFASAGQEDGLV 362

Query: 329 AVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQV 388
            +WD   +G+E              + +H GH   +ND S   +  WL AS+  DN +Q+
Sbjct: 363 KLWD-ASVGKE--------------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQI 407

Query: 389 WKMNNSLREDP 399
           W+   ++   P
Sbjct: 408 WRPAKNIVSKP 418

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  120 bits (300), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 116/420 (27%), Positives = 186/420 (44%), Gaps = 73/420 (17%)

Query: 12  TIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLL 71
           TI E+ +     Q Y LWK N  LLYD+++     WPSL+ ++ P  +T+   S+  RLL
Sbjct: 3   TIPEDRQ-----QRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFPDLDTS---SDTHRLL 54

Query: 72  LGTHTSGE--EQNYLKIAEIT----LPDQIIN-------EKTEDNSDKHVKSN--IRIIK 116
             + TS +  +   + IA I+    +P   +N       E   D S K    N  I++  
Sbjct: 55  FTSFTSSQLPQDENVTIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTI 114

Query: 117 KFKHELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKE------ 170
            F H  +  RA Y+PQ+  +I+T + DG+V+I+D +    +    IS L    E      
Sbjct: 115 NFPHG-DCNRATYLPQNPDLISTASSDGSVYIFDRT---KRGKSPISHLRGPFEAQLLPN 170

Query: 171 -NG------YGLAFNPLDKGKLLSSSDDGSVAYWNI---QKSIPLLTLQETSII------ 214
            NG        L +N   +G L S+  +G +  W+I   +K  P+++      I      
Sbjct: 171 NNGSPIGETVALDWNRQIEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQG 230

Query: 215 -NDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKI--VSNHDIKTPSAFNAMAFSFHS 271
            NDV W   +  L     E + + L D R N N  +    +NH     S  N   F+   
Sbjct: 231 FNDVSWMPSHDCLLSIAREDNIMTLFDTRTNGNIAQTGPSTNHA----SGINCTKFNPSQ 286

Query: 272 EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGS-DKRVAV 330
             L+A +  D L+ L+D R L+ P+  +   E  +++L+++     ++ +GG  D  V +
Sbjct: 287 PLLVATASGDGLVQLWDIRKLHNPIKTINC-ESPLSALEWNPQLPTVLATGGQEDGLVKL 345

Query: 331 WDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWK 390
           W+    GQ              LL  H GH   +ND + S +  WL  S+  DN   +WK
Sbjct: 346 WNASN-GQ--------------LLFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWK 390

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  117 bits (294), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 107/417 (25%), Positives = 195/417 (46%), Gaps = 66/417 (15%)

Query: 24  QEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSG--EEQ 81
           + Y  WK N  LLYD+++     WPSL+ ++    +  N  ++  R+LL + TSG   EQ
Sbjct: 25  ERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFF---QDVNTKNDSHRILLSSFTSGLMPEQ 81

Query: 82  NYLKIAEIT----LPDQIINEKTEDNSDKHVKSNIRIIKKFKH-ELEVT-------RAHY 129
             + I  I+    +P   +N    D  +    +N+++  K  H E  +T       RA Y
Sbjct: 82  ESINIMSISTLKHVPWASLNNFDMDEMEFKPDNNLKLPPKNLHTEQTITFPNGDCNRARY 141

Query: 130 MPQDSTIIATINGDGTVFI-----YDTSIDENQS------------NPIISKLSHHKENG 172
           +PQ+  IIA  + DGTV+I     Y +++ +  S            N + S  S+  E  
Sbjct: 142 LPQNQDIIAGASSDGTVYIFNRTKYGSTLRQTSSFQSYQARFAEPENTVQSVDSNPNE-A 200

Query: 173 YGLAFNPLDKGKLLSSSDDGSVAYWNIQK--------SIPLLT-LQETSIINDVRWNQFN 223
             + +N   +G L +S  DG +  W+++K        + P ++ + +T+  NDV W   +
Sbjct: 201 LSIDWNVQREGLLAASYSDGEIKTWDLKKFSNANTTITTPTVSIMMDTNGANDVTWMPLH 260

Query: 224 QNLFGYVTESSCLNLKDVRNNNNDLKIVSN-HDIKTPSAFNAMAFSFHSEYLMAASGEDS 282
            +L     ES+ L + D+R +     I S  H+       NA  F++ +  ++A++    
Sbjct: 261 DSLLAACGESNKLIIYDIRGSREHTTISSGIHE----DGINACRFNYANNLIVASADTVG 316

Query: 283 LIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKR-VAVWDLKQIGQEQT 341
            ++++D R  N+ +  +  H  S+++++++   D I+ + G D   V +WD+        
Sbjct: 317 NVHIWDIRKSNEIVKTI-PHGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD------ 369

Query: 342 SDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLRED 398
                     EL+  H GH   +ND S + +  WL  S+  DN VQ+W+  ++L E+
Sbjct: 370 ---------SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNLVEE 417

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  115 bits (287), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 121/432 (28%), Positives = 196/432 (45%), Gaps = 70/432 (16%)

Query: 8   EQKSTIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNE 67
           EQ S I +E +       Y  WK N  LLY++++     WPSLT ++ P   T N   + 
Sbjct: 12  EQSSAIPKERQ-----DRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFPDVNTKN---DS 63

Query: 68  QRLLLGTHTSG--EEQNYLKIAEITLPDQII-----NEKTEDNSDKHVKSNIRIIKK-FK 119
            R+LL + TS    E   L I  I+    +      N   ++   K   SNI++  K   
Sbjct: 64  HRILLSSFTSSLVPEDESLYITRISTLKHLSWASLNNFDLDEMEFKPDNSNIKLPPKNLT 123

Query: 120 HEL-------EVTRAHYMPQDSTIIATINGDGTVFIYD-----TSIDENQSNPIIS---K 164
            EL       +  RA Y+PQ+  +IA  + DG+V+I+D     T++   QS    S   K
Sbjct: 124 TELVIRFPNGDCNRARYLPQNPDLIAAASSDGSVYIFDRTKHGTAMHSRQSGFTQSYQAK 183

Query: 165 L-------SHHKEN-GYGLAFNPLDKGKLLSSSDDGSVAYWNI---QKSIPLLTLQE--- 210
           L       S + EN    + +N   +G L+ +  DG V  W+I   ++S P++   E   
Sbjct: 184 LAVNNNSQSLNGENEALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYNY 243

Query: 211 ---TSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKI-VSNHDIKTPSAFNAMA 266
               S  ND  W   + +LF   +E + L+L D R+ +N + I  S H        NA  
Sbjct: 244 KLDESGCNDAVWMPEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHK----GGINACR 299

Query: 267 FSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHA-LNDGIVISGGSD 325
           F+  +  L+A+      I L+D R    P++ +  H  S+++++++  L+  +  +G  D
Sbjct: 300 FNPRNSLLLASGDSIGNICLWDIRKKETPINIL-DHGSSISTIEWNPNLSTVLASAGQDD 358

Query: 326 KRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNI 385
             V +WD                D P  + IH GH   +ND S + +  WL  S+ +DN 
Sbjct: 359 GLVKLWD-------------AGSDKP--VFIHGGHMLGVNDISWNMHDPWLMCSVSKDNS 403

Query: 386 VQVWKMNNSLRE 397
           +Q+WK  ++L E
Sbjct: 404 IQIWKPAHNLVE 415

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  111 bits (277), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 113/433 (26%), Positives = 197/433 (45%), Gaps = 68/433 (15%)

Query: 11  STIKEEEEPLTT-----DQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPS 65
           S I+EE  P ++      Q Y  WK N  LLYD+++     WPSLT ++    +TT   S
Sbjct: 2   SAIEEEHVPQSSIPEDLQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFFHDLDTT---S 58

Query: 66  NEQRLLLGTHTSGE--EQNYLKIAEITLPDQI----INEKTEDNSDKHVKSNIRIIKK-F 118
           +  R+LL   TS +  E   + IA+++    +    IN    D  +   ++NI++  K  
Sbjct: 59  DTHRILLSAFTSSQLPEDEAIYIAKLSTLKHLEWASINNFDMDEMEFKPENNIKLPSKNL 118

Query: 119 KHELEVTR-------AHYMPQDSTIIATINGDGTVFIYDT----SIDENQSN---PIISK 164
            +++ +         A Y+PQ+  +IA  +  G+++I+D     S+   QS    P  + 
Sbjct: 119 TNDISIRFPDGDCNIARYLPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLKPYEAA 178

Query: 165 L---------SHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK--------SIPLLT 207
           L           +      +++N   +G L S    G +  W+++K          PLL 
Sbjct: 179 LYCPPKGIENVENTNEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLN 238

Query: 208 LQETSI-INDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMA 266
           +   ++ +NDV W+  + ++     ES+ + L D R     L+  SN  +      N+  
Sbjct: 239 VDFDALGVNDVNWHPSHDSILAASGESNIIGLFDNRLGTEILR--SNEKMHN-GGINSCK 295

Query: 267 FSFHSEYLMAASGEDSLIYLYDTRNLN-QPLHYMRGHEDSVTSLDFHALNDGIVISGGSD 325
           F+ H + L+ +   +  I L+D R L+ +P+  +  H  S+++L+++   + IV S G D
Sbjct: 296 FNSHCDSLLISGDSEGRINLWDLRKLDGEPIKTLH-HGSSISTLEWNPNLETIVASAGQD 354

Query: 326 KR-VAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDN 384
              V +WD+                  EL+  H GH   +ND S + +  WL  S+  DN
Sbjct: 355 DGLVKLWDVS---------------TDELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDN 399

Query: 385 IVQVWKMNNSLRE 397
            VQVWK  ++L E
Sbjct: 400 SVQVWKPAHNLVE 412

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  110 bits (274), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 110/435 (25%), Positives = 193/435 (44%), Gaps = 84/435 (19%)

Query: 11  STIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRL 70
           STI E+ +       Y  WK N  LLYD+++     WPSLT ++ P  +     ++  R+
Sbjct: 9   STISEDLQ-----TRYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFPDVDAN---TDTHRI 60

Query: 71  LLGTHTSG---EEQNYLKIAEITLPD--------------QIINEKTEDNSDKHVKSNIR 113
           LL ++TS    E++N    +  TL                +   ++T     K++ +N+ 
Sbjct: 61  LLSSYTSCQLPEDENVYVASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVS 120

Query: 114 IIKKFKHELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGY 173
           I        +  RA YMPQ+  +IA  + +G V++++ +  ++ +  I    +   E  Y
Sbjct: 121 ITFP---RGDCNRARYMPQNPDVIAAASSNGAVYVFNRT--KHGTRRIQKHAASDAEQDY 175

Query: 174 G-------------------------LAFNPLDKGKLLSSSDDGSVAYWNIQK-SIPLLT 207
           G                         LA+N   +G L  +   G+V  W++Q+ ++   T
Sbjct: 176 GPYEARFYNEETDEARRTPVDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTT 235

Query: 208 LQETSI---------INDVRWNQFNQNLFGYVTESS-CLNLKDVRNNNNDLKIVSNHDIK 257
           + ET           +NDV W   + ++     E S  L L D R  N   KI   +  K
Sbjct: 236 ISETEWECSNFDSRGVNDVSWMSQHDSILAACGERSDSLALFDTRAQNAVAKI--RNQFK 293

Query: 258 TPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLN-QPLHYMRGHEDSVTSLDFHALND 316
           +    NA  F++ +  L+A++       L+D R L+ +P+ +   H  SV++L+++  + 
Sbjct: 294 S-EGINACKFNWENNLLLASTDSTGRTNLWDVRKLSAEPIVHF-DHGGSVSTLEWNPHDH 351

Query: 317 GIVISGG-SDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNW 375
            ++ + G SD  + +WD        TS EIED    + + +H+GH   +ND +   +  W
Sbjct: 352 SVLATAGQSDGLIKIWD--------TSLEIED----KTIFVHSGHMLGVNDIAWDLHDPW 399

Query: 376 LCASIEEDNIVQVWK 390
           L  S+  DN V VWK
Sbjct: 400 LMCSVSNDNSVHVWK 414

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  109 bits (273), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 107/419 (25%), Positives = 182/419 (43%), Gaps = 72/419 (17%)

Query: 24  QEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSGE--EQ 81
           Q Y  WK N  LLYD+++     WPSLT E+ P  +TT   ++  RLLL + TS +  E 
Sbjct: 17  QRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFPDLDTT---TDSHRLLLSSFTSSQLPED 73

Query: 82  NYLKIAEITLPDQI----IN-------EKTEDNSDKHVKSN------IRIIKKFKHELEV 124
             + I+ I+    +    +N       E   +NS K    N      IRI        + 
Sbjct: 74  ESIYISRISTLKHLHWSSLNNFDMDEMEFKPENSTKLPPRNLTDDISIRIPSG-----DS 128

Query: 125 TRAHYMPQDSTIIATINGDGTVFIYD------TSIDENQSNPIISKLSHHKE-------- 170
            RA Y+PQ+  +I+  + DG+++I+D      T      S P   KL    +        
Sbjct: 129 NRARYLPQNPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSPN 188

Query: 171 NGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSI---PLLTLQETSI-------INDVRWN 220
               L +N   +G L S    G +  W+I + +   P +     SI        ND+ W 
Sbjct: 189 EVVSLDWNKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDITWM 248

Query: 221 QFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSN-HDIKTPSAFNAMAFSFHSEYLMAASG 279
             + +L     ES+ + + D R+ +   KI    H+       N+  F+ H++YL+A++ 
Sbjct: 249 PSHDSLLAACGESNTVAIYDTRSKSQVSKIQPGLHN----GGINSCDFNAHNDYLLASAD 304

Query: 280 EDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHA-LNDGIVISGGSDKRVAVWDLKQIGQ 338
               ++++D R L+Q       H  S++++ ++  +   I ++G  D  V +WD    GQ
Sbjct: 305 SIGTVHMWDIRKLDQDPIQSVSHGSSISTVKWNPNVATIIAVAGQEDGLVKLWDASN-GQ 363

Query: 339 EQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLRE 397
                         L+  H GH   +ND + + +  WL  S+  DN + +W+ ++ L E
Sbjct: 364 --------------LIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHLVE 408

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 93/375 (24%), Positives = 171/375 (45%), Gaps = 64/375 (17%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLP---SNETTNLPSNEQRLLLGTHT--SGEEQNYLKIAE 88
           P +Y+ +    + WP LT++ +P    +E  N P   Q +LL T T  S + +N L +  
Sbjct: 114 PSVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYP---QSILLATATQSSRKRENELMVLA 170

Query: 89  IT-LPDQIINEKTEDNSDKHVKSNIRII--------KKFKHELEVTRAHYMPQDSTIIAT 139
           ++ L   ++ +  E++ D+  + ++  +        K   + L+V+      Q+  + AT
Sbjct: 171 LSNLTKTLLKDDNEEDDDEEEEDDVDAVIENENMPLKDTTNRLKVSPFAASNQE-VLTAT 229

Query: 140 INGDGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNPLDK-GKLL 186
           ++ +G V+IYD +            I ++   PI +  SH    GYGL ++PL K G LL
Sbjct: 230 MSENGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPLIKTGALL 289

Query: 187 SSSDDGSVAY-------WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLK 239
           S    G + +       W   K     T+     I D++W++    +F        + + 
Sbjct: 290 SGDCSGQIYFTQRHTSRWVTDKQP--FTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIW 347

Query: 240 DVRNNNNDLKI---VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLN--- 293
           D R+  +   I    SN D+      N +++S    YL+A+  ++    ++D R      
Sbjct: 348 DTRSKKHKPAISVKASNTDV------NVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSN 401

Query: 294 ----QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------KQIGQEQTSD 343
               QP+     H+ ++TS+ F+ L++ IV  G  D  V +WDL      ++I Q QT++
Sbjct: 402 ADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQ-QTAE 460

Query: 344 EIEDGDV-PELLMIH 357
             E  ++ P+LL +H
Sbjct: 461 TKELQEIPPQLLFVH 475

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 90/373 (24%), Positives = 169/373 (45%), Gaps = 59/373 (15%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLL--GTHTSGEEQNYLKIAEIT- 90
           P +Y+ +    + WP LT++ +P    T   +  Q +LL   T +S +++N L +  ++ 
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGTERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 91  LPDQIINEKTEDNSDKH--------VKSNIRI-IKKFKHELEVTRAHYMPQDSTIIATIN 141
           L   ++ +  E++ ++         V  N  I ++   + L+V+      Q+  + AT++
Sbjct: 174 LTKTLLKDDNEEDDEEGEDEEDVDPVIENENIPLRDTTNRLKVSPFAVSNQE-VLTATMS 232

Query: 142 GDGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNPLDK-GKLLSS 188
            +G V+IYD +            I ++   PI +  +H    GYGL ++PL K G LLS 
Sbjct: 233 ENGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSG 292

Query: 189 SDDGSV-------AYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDV 241
              G +       + W   K     T+     I D++W++    +F        + + D 
Sbjct: 293 DCSGQIYLTQRHTSRWVTDKQ--SFTVSNNESIEDIQWSRTESTVFATAACDGYIRIWDT 350

Query: 242 RNNNNDLKI---VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLN----- 293
           R+  +   I    SN D+      N +++S    YL+A+  ++    ++D R        
Sbjct: 351 RSKKHKPAISVKASNTDV------NVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNAD 404

Query: 294 --QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------KQIGQEQTSDEI 345
             QP+     H+ ++TS+ F+ L++ IV  G  D  V +WDL      ++I Q Q ++  
Sbjct: 405 TVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQ-QAAETK 463

Query: 346 EDGDV-PELLMIH 357
           E  D+ P+LL +H
Sbjct: 464 ELQDIPPQLLFVH 476

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 91/375 (24%), Positives = 171/375 (45%), Gaps = 64/375 (17%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLP---SNETTNLPSNEQRLLL--GTHTSGEEQNYLKIAE 88
           P +Y+ +    + WP LT++ +P    +E  N P   Q +LL   T +S +++N L +  
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYP---QSILLTTATQSSRKKENELMVLA 170

Query: 89  IT-LPDQIINEKTEDNSDKHVKSNIRI--------IKKFKHELEVTRAHYMPQDSTIIAT 139
           ++ L   ++ ++ E+  ++    +I          ++   + L+V+      Q+  + AT
Sbjct: 171 LSNLTKTLLKDENEEEDEEEDDDDIDPIIENENIPLRDTTNRLKVSPFAVSNQE-VLTAT 229

Query: 140 INGDGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNPLDK-GKLL 186
           ++ +G V+IYD +            I ++   PI +  +H    GYGL ++PL K G LL
Sbjct: 230 MSENGDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGSLL 289

Query: 187 SSSDDGSVAY-------WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLK 239
           S    G V +       W   K     T+     I D++W++    +F        + + 
Sbjct: 290 SGDCSGQVYFTQRHTSRWVTDKQP--FTVSNNKSIEDIQWSRSESTVFATAGCDGYIRIW 347

Query: 240 DVRNNNNDLKI---VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLN--- 293
           D R+  +   I    SN D+      N +++S    YL+A+  ++    ++D R      
Sbjct: 348 DTRSKKHKPAISVKASNTDV------NVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSN 401

Query: 294 ----QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------KQIGQEQTSD 343
               QP+     H+ ++TS+ F+ L++ IV  G  D  V +WDL      ++I Q QT++
Sbjct: 402 ADSVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQ-QTAE 460

Query: 344 EIEDGDV-PELLMIH 357
             E  ++ P+LL +H
Sbjct: 461 TKELQEIPPQLLFVH 475

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 75.9 bits (185), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 84/372 (22%), Positives = 159/372 (42%), Gaps = 56/372 (15%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSGEEQN-----YLKIAE 88
           P +Y+ +    L WP LT++ +P N  +   +  Q +L+ T T   ++       LK++ 
Sbjct: 119 PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSILMTTATQASKKKDNELMVLKLSH 178

Query: 89  IT--LPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVT--RAHYMP----QDSTIIATI 140
           +T  L     N   ED+ +   ++   I++     L  T  R    P    Q   + +T+
Sbjct: 179 LTKTLVKDDDNVDNEDDDEDDDEAGEPILENESLPLRDTTNRLRISPYATVQQEILTSTM 238

Query: 141 NGDGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSS 188
           + +G VFIYD +            I +    P+ +  +H    GYGL ++PL K   L +
Sbjct: 239 SENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGLDWSPLIKTGALLT 298

Query: 189 SDDGSVAY--------WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKD 240
            D   + Y        W   K+    T+     I D++W++    +F        + + D
Sbjct: 299 GDCSGMVYLTQRHTSKWVTDKTP--FTVGNNKSIEDIQWSRTESTVFATAGCDGYIRIWD 356

Query: 241 VRNNNNDL---KIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQ--- 294
            R+  +      +VSN D+      N ++++    YL+A+  +     ++D R  +    
Sbjct: 357 TRSKKHKPVISTVVSNTDV------NVISWNEKMGYLLASGDDKGTWGIWDLRQFSPNSE 410

Query: 295 ---PLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------KQIGQEQTSDEI 345
              P+     H+ ++TS+ F+ L++ IV     D  V +WDL      ++I Q++   + 
Sbjct: 411 KALPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQKAEIKE 470

Query: 346 EDGDVPELLMIH 357
            +   P+LL +H
Sbjct: 471 LEQIPPQLLFVH 482

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 89/375 (23%), Positives = 165/375 (44%), Gaps = 63/375 (16%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLP---SNETTNLPSNEQRLLL--GTHTSGEEQNYLKIAE 88
           P +Y+ +    + WP LT++ +P    +E  N P   Q +LL   T +S +++N L +  
Sbjct: 115 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYP---QSILLTTATQSSRKKENELMVLA 171

Query: 89  IT-LPDQIINEKTEDNSDKH--------VKSNIRI-IKKFKHELEVTRAHYMPQDSTIIA 138
           ++ L   ++ +  E   D+         V  N  I ++   + L+V+      Q+  + A
Sbjct: 172 LSNLAKTLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNRLKVSPFAISNQE-VLTA 230

Query: 139 TINGDGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNPLDK-GKL 185
           T++ +G V+IY+ +            I ++   PI +  +H    GYGL ++PL K G L
Sbjct: 231 TMSENGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGAL 290

Query: 186 LSSSDDGSVAY-------WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNL 238
           LS    G + +       W   K     T+     I D++W++    +F        + +
Sbjct: 291 LSGDCSGQIYFTQRHTSRWVTDKQ--PFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRI 348

Query: 239 KDVRNNNNDLKI---VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLN-- 293
            D R+  +   I    SN D+      N +++S    YL+A+  ++    ++D R     
Sbjct: 349 WDTRSKKHKPAISVKASNTDV------NVISWSDKIGYLLASGDDNGTWGVWDLRQFTPS 402

Query: 294 -----QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------KQIGQEQTS 342
                QP+     H+ ++TS+ F+ L++ IV  G  D  V +WDL      ++I Q+   
Sbjct: 403 NADAVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAE 462

Query: 343 DEIEDGDVPELLMIH 357
            +      P+LL +H
Sbjct: 463 TKELQEIPPQLLFVH 477

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 84/395 (21%), Positives = 166/395 (42%), Gaps = 53/395 (13%)

Query: 7   NEQKSTIKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSN 66
           N+Q+  +     PL  D+  E      P +Y+ +    + WP LT++ +P    T   + 
Sbjct: 95  NKQEIYLPHMSRPLGPDEVLEA----DPTVYEMLHNVNMPWPCLTLDIIPDGLGTERRNY 150

Query: 67  EQRLLLGTHT--SGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEV 124
            Q +L+ T T  S +++N L + +++  ++ + +   D  +                 E+
Sbjct: 151 PQSILMATATQASKKKENELMVLKLSQLNKTLVKDDADEEEDDEDDEDNDSDPIIENEEI 210

Query: 125 T------RAHYMPQDST---IIATINGDGTVFIYDTS------------IDENQSNPIIS 163
           +      R    P  S+   + AT++ +G V+I+D              I ++   P+ +
Sbjct: 211 SLRDTTNRLKISPFASSQEVLTATMSENGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHT 270

Query: 164 KLSHHKENGYGLAFNPLDK-GKLLSSSDDGSV-------AYWNIQKSIPLLTLQETSIIN 215
             +H    GYGL ++PL K G LL+    G V       + W   K     T      I 
Sbjct: 271 IRNHGNVEGYGLDWSPLIKTGALLTGDCSGQVYLTQRHTSKWVTDKQ--PFTFSNNKSIE 328

Query: 216 DVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLM 275
           D++W++    +F        + + D R+  +   I +     + +  N ++++    YL+
Sbjct: 329 DIQWSRTESTVFATSGCDGYIRIWDTRSKKHKPAISTR---ASATDVNVISWNEKIGYLL 385

Query: 276 AASGEDSLIYLYDTRNLN-------QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRV 328
           A+  +D    ++D R L+       QP+     H+ ++TS+ F+ L++ I+     D  V
Sbjct: 386 ASGDDDGRWGVWDLRQLSPNNSENVQPVAQYDFHKGAITSISFNPLDESIIAVASEDNTV 445

Query: 329 AVWDL------KQIGQEQTSDEIEDGDVPELLMIH 357
            +WDL      ++I Q+    +      P+LL +H
Sbjct: 446 TLWDLSVEADDEEIKQQAAETKELQQIPPQLLFVH 480

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 84/372 (22%), Positives = 162/372 (43%), Gaps = 56/372 (15%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHT--SGEEQNYLKIAEIT- 90
           P +YD +    + WP LT++ +P N  +   +  Q LL+ T T  S +++N L +  ++ 
Sbjct: 119 PTVYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYPQSLLMTTATQASRKKENELMVLSLSQ 178

Query: 91  LPDQIINEKTEDNSDKHVKSNIR---IIKKFKHELEVT--RAHYMP----QDSTIIATIN 141
           L   ++ +  E NSD+  +       II+     L  T  R    P        + AT++
Sbjct: 179 LAKTLVKDDDEVNSDEEDEDRDETDPIIENENISLRDTTNRLRVSPFAQSNKEVLTATMS 238

Query: 142 GDGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNPLDK-GKLLSS 188
            +G V+I+D              + ++   P+ +  +H    GY L ++PL K G LL+ 
Sbjct: 239 ENGEVYIFDLGPQSKAFSSPGYQVPKSSKRPVHTIKNHGNVEGYALDWSPLIKTGALLTG 298

Query: 189 SDDGSV-------AYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDV 241
              G +       + W   K     T+     + D++W++    +F        + + D 
Sbjct: 299 DCSGQIYLTQRNTSKWVTDKQP--FTVGNNKSVEDIQWSRTEATVFASCGCDGYVRIWDT 356

Query: 242 RNNNNDLKI---VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTR-----NLN 293
           R+  +   +    SN D+      N ++++    YL+A+  ++    ++D R     N+N
Sbjct: 357 RSKQHKPALSVKASNTDV------NVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNIN 410

Query: 294 --QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------KQIGQEQTSDEI 345
             QP+     H+ ++TS+ F+ L + I+     D  V +WDL      ++I Q+    + 
Sbjct: 411 NVQPVAQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKE 470

Query: 346 EDGDVPELLMIH 357
            +   P+LL +H
Sbjct: 471 LESIPPQLLFVH 482

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 88/379 (23%), Positives = 167/379 (44%), Gaps = 70/379 (18%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLP---SNETTNLPSNEQRLLLGTHT--SGEEQNYLKIAE 88
           P +Y+ +    L WP +T++ +P    +E  N P   Q +L+ T T  S +++N L +  
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDVIPDKLGSERRNYP---QSILMTTATQASKKKENELMVLS 176

Query: 89  ITLPDQIINEKTEDNSDKHVKSNIR----IIKKFKHELEVT--RAHYMPQDST----IIA 138
           ++  ++ + +  ED  +            II+    +L  T  R    P  ST    + A
Sbjct: 177 LSQLNKTLVKSEEDEDEDEDSDEEDDSDPIIENENIKLNDTTNRLKVSPFASTDKEVLTA 236

Query: 139 TINGDGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNPLDK-GKL 185
           T++ +G V+I+D +            I +    PI +  +H    GY L ++P+ K G L
Sbjct: 237 TMSENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMIKNGAL 296

Query: 186 LSSSDDGSVAY-------WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNL 238
           L+    G + +       W   K     T +    + D++W++    +F        + +
Sbjct: 297 LTGDCSGQIYFTQRHTSKWITDKQP--FTAENNKSVEDIQWSRTESTVFASAGCDGYIRI 354

Query: 239 KDVRNNNNDLKI---VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTR----- 290
            D R+  +   +    SN D+      N +++S    YL+A+  ++ L  ++D R     
Sbjct: 355 WDTRSKKHKPALSVKASNTDV------NVISWSEKIGYLLASGDDNGLWGVWDLRQFSPD 408

Query: 291 NLN--QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL----------KQIGQ 338
           N+N  QP+     H+ ++TS++F+ L+D I+     D  V +WDL          +QI +
Sbjct: 409 NINDVQPVAQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQIAE 468

Query: 339 EQTSDEIEDGDVPELLMIH 357
            +  ++I     P+LL +H
Sbjct: 469 TKELEKIP----PQLLFVH 483

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 82/374 (21%), Positives = 161/374 (43%), Gaps = 58/374 (15%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHT--SGEEQNYLKIAEIT- 90
           P +Y+ +    + WP +T++ +P N  +   +  Q LL+ T T  S +++N L +  ++ 
Sbjct: 112 PSVYEMLHNVNVPWPCMTLDIIPDNLGSERRNYPQSLLMATATQASRKKENELMVLSLSN 171

Query: 91  -----LPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVT--RAHYMP----QDSTIIAT 139
                + D    E+ + +++     +  II+     L  T  R    P    ++  + AT
Sbjct: 172 LVKTLVKDDEEEEEEDVDNEDDRDDSDPIIENENIPLRDTTNRLKISPFASSKEEVLAAT 231

Query: 140 INGDGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNPLDK-GKLL 186
           ++ +G V+I+D              + +    PI +  +H    GY L ++PL K G LL
Sbjct: 232 MSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYALDWSPLTKTGALL 291

Query: 187 SSSDDGSVAY-------WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLK 239
           +    G + +       W   K     T+     I D++W++    +F        + + 
Sbjct: 292 TGDCSGQIYFTQRHTSKWITDKQP--FTVANNQSIEDIQWSRTESTVFASAGCDGYIRIW 349

Query: 240 DVRNNNNDLKI---VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLN--- 293
           D R+  +   I    SN D+      N +++S    YL+A+  ++    ++D R  +   
Sbjct: 350 DTRSKKHKPAISVKASNTDV------NVISWSEKLGYLLASGDDNGTWGVWDLRQFSPEN 403

Query: 294 ----QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------KQIGQEQTSD 343
               QP+     H+ ++TS+ F+ L++ I+  G  D  V +WDL      ++I Q+    
Sbjct: 404 AGSVQPVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQQAAET 463

Query: 344 EIEDGDVPELLMIH 357
           +      P+LL +H
Sbjct: 464 KELQQIPPQLLFVH 477

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 72.4 bits (176), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 85/371 (22%), Positives = 163/371 (43%), Gaps = 56/371 (15%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSGEEQN-----YLKIAE 88
           P +Y+ +    L WP +T++ +P    +   +  Q +L+ T T   ++       LK+++
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDIIPDTYGSERRNYPQSILMTTATQAAKKKDNELMVLKLSQ 179

Query: 89  ITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVT--RAHYMPQDST----IIATING 142
           ++      NE+ E++ D     +  I++     L+ T  R    P  S+    + AT++ 
Sbjct: 180 LSKTLVKENEEEEEDEDNSDNESDPILEDENVPLKDTTNRLRVSPFASSGQEVLTATMSE 239

Query: 143 DGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNPLDK-GKLLSSS 189
           +G V+I+D +            I +    PI +  +H    GY L ++PL + G LL+  
Sbjct: 240 NGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNVEGYALDWSPLIRSGALLTGD 299

Query: 190 DDGSVAY-------WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
             G V +       W   K     T+     I D++W++    +F        + + D R
Sbjct: 300 CSGQVYFTQRHTSKWVTDKQ--PFTVSNNKSIEDIQWSRTEATVFATAGCDGYIRVWDTR 357

Query: 243 NNNNDLKI---VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLN------ 293
           +  +   I    SN D+      N ++++    YL+A+  ++    ++D R  +      
Sbjct: 358 SKKHKPAISTKASNTDV------NVISWNEKMGYLLASGDDNGTWGVWDLRQFSPSNENA 411

Query: 294 QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------KQIGQEQTSDEIED 347
           QP+     H+ ++TS+ FH  ++ IV     D  V +WDL      ++I Q QT++  E 
Sbjct: 412 QPVAQYDFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEEIKQ-QTAETKEL 470

Query: 348 GDV-PELLMIH 357
             + P+LL +H
Sbjct: 471 AQIPPQLLFVH 481

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 89/371 (23%), Positives = 164/371 (44%), Gaps = 57/371 (15%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLP---SNETTNLPSNEQRLLLGTHT--SGEEQNYLKIAE 88
           P +Y+ +    + WP L+++ +P    +E  N P   Q +L+ T T  S +++N L +  
Sbjct: 119 PTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYP---QSILMTTATQASKKKENELMVLS 175

Query: 89  IT-LPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVT--RAHYMPQDS----TIIATIN 141
           ++ L   ++ ++ E+  ++       II+     L  T  R    P  S     + AT++
Sbjct: 176 LSNLTKTLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNRIKVSPFASQSQEVLTATMS 235

Query: 142 GDGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNPLDK-GKLLSS 188
            +G V+I+D              I +    P+ +  +H    GYGL ++PL K G LLS 
Sbjct: 236 ENGEVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLDWSPLIKSGALLSG 295

Query: 189 SDDGSVAYWNIQKSIPLLTLQETSI-----INDVRWNQFNQNLFGYVTESSCLNLKDVRN 243
              G +       S  +   Q  S+     I D++W++    +F        + + D R+
Sbjct: 296 DCSGQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFATAGCDGYIRVWDTRS 355

Query: 244 NNNDLKI---VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLN------- 293
             +   I    SN D+      N ++++    YL+A+  ++    ++D R          
Sbjct: 356 KKHKPAISVKASNTDV------NVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNAANI 409

Query: 294 QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------KQIGQEQTSDEIED 347
           QP+     H+ ++TS+ F+ L + IV  G  D  V +WDL      ++I Q QT +  E 
Sbjct: 410 QPVAQYNFHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQ-QTEETKEL 468

Query: 348 GDV-PELLMIH 357
            ++ P+LL +H
Sbjct: 469 KEIPPQLLFVH 479

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 86/374 (22%), Positives = 165/374 (44%), Gaps = 62/374 (16%)

Query: 36  LYDFVSETKLVWPSLTVEWLP---SNETTNLPSNEQRLLLGTHT--SGEEQNYLKIAEIT 90
           +Y+ +    L WP ++++ +P    NE  N P   Q +LL T T  S ++ N L I +++
Sbjct: 129 VYEMLHNVNLSWPCMSLDIIPDSLGNERRNYP---QSILLTTATQASKKKDNELMILQLS 185

Query: 91  -LPDQIINEKTEDNSDKHVK-------------SNIRIIKKFKHELEVTRAHYMPQDSTI 136
            L   ++ E  +DN D+  +             +N+  ++   + L+VT          +
Sbjct: 186 QLTKTLLKEDDDDNDDEDDEDDEDRESDPILEDANV-ALRDTTNRLKVTPFATNNNQEIL 244

Query: 137 IATINGDGTVFIYDT------------SIDENQSNPIISKLSHHKENGYGLAFNPLDK-G 183
            AT++ +G V+I+D              + +    PI +  SH    G+GL ++PL K G
Sbjct: 245 TATMSENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLDWSPLIKSG 304

Query: 184 KLLSSSDDGSVAYWNIQKSIPLLTLQETSI-----INDVRWNQFNQNLFGYVTESSCLNL 238
            LL+    G +   +   S  +   Q  S+     I D++W++  Q +F        + +
Sbjct: 305 ALLTGDCSGEIFLTSRHTSKWITEKQSFSVGNNKSIEDIQWSKTEQTVFATAGCDGYIRI 364

Query: 239 KDVRNNNNDLKI---VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLN-- 293
            D R+  +   I    SN D+      N ++++   EYL+A+  +  +  ++D R  +  
Sbjct: 365 WDTRSKKHKPAISTRASNVDV------NVISWNEKMEYLLASGDDKGVWGVWDLRQFSPS 418

Query: 294 ----QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------KQIGQEQTSD 343
                P+     H+ ++TS+ F+ L++  V     D  V +WDL      ++I Q+    
Sbjct: 419 QENASPVAQYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDEEIKQQTHET 478

Query: 344 EIEDGDVPELLMIH 357
           +  +   P+LL +H
Sbjct: 479 KELEQIPPQLLFVH 492

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 84/376 (22%), Positives = 159/376 (42%), Gaps = 63/376 (16%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLP---SNETTNLPSNEQRLLLGTHTSGEEQN-----YLK 85
           P +Y+ +    + WP +T++ +P    +E  N P   Q +L+ T T   ++       LK
Sbjct: 122 PTVYEMLHNVNMPWPCMTLDIIPDSLGSERRNYP---QSILMTTATQASKKKDNELMVLK 178

Query: 86  IAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVT--RAHYMPQDST------II 137
           ++++T      +   ++  +    +   II+    +L  T  R    P  S+      + 
Sbjct: 179 LSQLTKTLAKEDNGEDEEEEDDDDTVDPIIENENIQLRDTTNRLKVSPFASSSNSQEILT 238

Query: 138 ATINGDGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNPLDK-GK 184
           AT++ +G V+I+D +            I +    PI +  SH    GY L ++PL K G 
Sbjct: 239 ATMSENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDWSPLIKTGA 298

Query: 185 LLSSSDDGSV-------AYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLN 237
           LL+    G V       + W I    P  T+     + D++W++    +F        + 
Sbjct: 299 LLTGDCSGQVYLTQRHTSKW-ISDKEPF-TVANNQSVEDIQWSRTESTVFASCGCDGYIR 356

Query: 238 LKDVRNNNNDLKI---VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLN- 293
           + D R+  +   I    SN D+      N +++S    YL+A+  ++    ++D R  + 
Sbjct: 357 VWDTRSKKHKPAISVKASNTDV------NVISWSEKIGYLLASGDDNGTWGVWDLRQFSP 410

Query: 294 ------QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------KQIGQEQT 341
                  P+     H+ ++TS+ F+ L++ IV     D  V +WDL      ++I Q+  
Sbjct: 411 SNSNNTSPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAA 470

Query: 342 SDEIEDGDVPELLMIH 357
             +      P+LL +H
Sbjct: 471 ETKELQQIPPQLLFVH 486

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 82/372 (22%), Positives = 160/372 (43%), Gaps = 57/372 (15%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHT--SGEEQNYLKIAEIT- 90
           P +Y+ +    + WP +T++ +P    +   +  Q LL+ T T  S + QN L + +++ 
Sbjct: 127 PTVYEMLHTVNVPWPCMTLDVIPDTLGSGRRNYPQSLLMATATQASKKNQNELMVLKMSQ 186

Query: 91  LPDQIINEKTEDNSDKH--------VKSNIRI-IKKFKHELEVTRAHYMPQDSTIIATIN 141
           L   ++ E  ++N  +         V  N  I +K   + L+V+      Q+  + +T++
Sbjct: 187 LAKTLVKEDEDENEGEDEDEDGTDPVIENENISLKDTTNRLKVSPFANAAQE-VLCSTMS 245

Query: 142 GDGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNPLDK-GKLLSS 188
            +G V+I+D +            I +    PI +  +H    GY   ++P+ K G +LS 
Sbjct: 246 ENGEVYIFDLASQVKAFETPGYQIPKQAKRPIHTVRNHGSVEGYANDWSPIIKTGAMLSG 305

Query: 189 SDDGSV-------AYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDV 241
              G V       + W   K     T+     I D++W++    +F        + + D 
Sbjct: 306 DCSGQVFLTQRHTSKWITDKQA--FTVANNKSIEDLQWSRTESTVFASCGIDGYIRIWDT 363

Query: 242 RNNNNDLKI---VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLN----- 293
           R+  +   I    SN D+      N +++S    YL+A+  +D    ++D R        
Sbjct: 364 RSKKHKPAISVKASNTDV------NVISWSEKIGYLLASGDDDGTWGVWDLRQFTPQNAS 417

Query: 294 --QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------KQIGQEQTSDEI 345
              P+   + H+ ++TS+ F+ L++ I+     D  V +WDL      ++I Q+    + 
Sbjct: 418 TASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKE 477

Query: 346 EDGDVPELLMIH 357
                P+LL +H
Sbjct: 478 LQQIPPQLLFVH 489

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 85/375 (22%), Positives = 164/375 (43%), Gaps = 60/375 (16%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHT--SGEEQNYLKIAEIT- 90
           P +Y+ +    + WP LT++ +P +  +   +  Q LL+ T T  S +++N L +  ++ 
Sbjct: 113 PTVYEMLHNVNVPWPCLTLDIIPDSLGSERRNYPQSLLMTTATQASKKKENELMVLSLSN 172

Query: 91  LPDQIINEKTEDNSDKH-----------VKSNIRI-IKKFKHELEVTRAHYMPQDSTIIA 138
           L   ++NE  ED+ D+            V  N  I ++   + L+V+      ++  + A
Sbjct: 173 LTKTLVNEDKEDDEDEDDEDNEDNDKDPVMENENIPLRDTTNRLKVSPFANSSKE-VLTA 231

Query: 139 TINGDGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNP-LDKGKL 185
           T++ +G V+I+D              I +    PI +  SH    GY L ++P +  G L
Sbjct: 232 TMSENGEVYIFDLGPQSKAFSTPGYKIPKTAKRPIHTIKSHGNVEGYALDWSPSIQTGAL 291

Query: 186 LSSSDDGSVAY-------WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNL 238
           L+    G + +       W   K     T+     I D++W++    +F        + +
Sbjct: 292 LTGDCSGQIYFTQRHTSKWVTDKQP--FTVSNNKSIEDIQWSRTEGTVFASAGCDGYIRI 349

Query: 239 KDVRNNNNDLKI---VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLN-- 293
            D R+  +   I    SN D+      N +++S    YL+A+  ++ +  ++D R  +  
Sbjct: 350 WDTRSKKHKPAISVKASNTDV------NVISWSDKLGYLLASGDDNGVWGVWDLRQFSPD 403

Query: 294 -----QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------KQIGQEQTS 342
                QP+     H+ ++TS+ F+ L++ IV     D  V +WDL      ++I Q+   
Sbjct: 404 TANSVQPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAE 463

Query: 343 DEIEDGDVPELLMIH 357
            +      P+LL +H
Sbjct: 464 TKELQQIPPQLLFVH 478

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 65.5 bits (158), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 91/390 (23%), Positives = 162/390 (41%), Gaps = 92/390 (23%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLP---SNETTNLPSNEQRLLLGTHTSGEEQN-----YLK 85
           P +Y+ +    L W  +T++ +P    +E  N P   Q +L+ T T   ++       LK
Sbjct: 125 PTVYEMLHNVNLPWSCMTLDIIPDLLGSERRNYP---QSILMTTATQASKKKDNELLVLK 181

Query: 86  IAEITLP--------------------DQIINEKTEDNSDKHVKSNIRIIKKFKHELEVT 125
           ++++T                      D II  + E  S K   + I+I        EV 
Sbjct: 182 MSQLTKTLVKEEEDENDEEEDNEDNDLDPII--ENESISLKDTTNRIKISPFAAESPEV- 238

Query: 126 RAHYMPQDSTIIATINGDGTVFIYDTS------------IDENQSNPIISKLSHHKENGY 173
                     + AT++ +G  +IYD              I +    P+ S  +H    GY
Sbjct: 239 ----------LAATMSENGEAYIYDLGPQVKAFTSPGYQIPKTAQKPLHSIRNHGNVEGY 288

Query: 174 GLAFNPLDK-GKLLSSSDDGSV-------AYWNIQKSIPLLTLQETSIINDVRWNQFNQN 225
           GL ++PL K G +L+    G V       + W   K     T+     I D++W++    
Sbjct: 289 GLDWSPLIKTGSILTGDCSGRVYLTQRTASRWVTDKQP--FTVGNNKSIEDIQWSRAEMT 346

Query: 226 LFGYVTESSCLNLKDVRNNNNDLKI---VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDS 282
           +F        + + D R+  +   +   VS+ D+      N M+++    YL+A SG+DS
Sbjct: 347 VFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDV------NVMSWNEKIGYLLA-SGDDS 399

Query: 283 LIY-LYDTRNLNQ-------PLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL- 333
             + ++D R  +        P+     H+ ++TS+ F+ L++ I+     D  V +WDL 
Sbjct: 400 GTWGVWDLRQFSAQNTEKTTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLS 459

Query: 334 -----KQIGQEQTSDEIEDGDV-PELLMIH 357
                ++I Q QT++  E   + P+LL +H
Sbjct: 460 VEADDEEIKQ-QTAETAELQQIPPQLLFVH 488

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/186 (27%), Positives = 89/186 (47%), Gaps = 19/186 (10%)

Query: 164 KLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIINDVRW-- 219
           K  + +EN + L   PL +  L++S  DGSV    W   K+I  +    TSI ND++   
Sbjct: 7   KCRYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSIQCHTTSI-NDMKVIN 65

Query: 220 NQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASG 279
           + F+            + + D+R  NN   +   +D  +P       FS  S + M A G
Sbjct: 66  SDFDTGAVFATAAEDGVKVWDIRARNNVASL--QNDKASP------FFSLDSRHNMLACG 117

Query: 280 E-----DSLIYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL 333
                 D+ +++YD RN  +P+  ++  H D +T + FH  +  +++SG +D  V ++DL
Sbjct: 118 TELKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDL 177

Query: 334 KQIGQE 339
            Q  +E
Sbjct: 178 TQDDEE 183

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 85/374 (22%), Positives = 153/374 (40%), Gaps = 59/374 (15%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSGEEQN-----YLKIAE 88
           P +Y+ +    + WP +T++ +P    +   S  Q LLL T T    +       LK+++
Sbjct: 118 PSVYEMLHNVNMPWPCMTLDVIPDTLGSERRSYPQSLLLTTATQATRKKDNELMVLKLSQ 177

Query: 89  I--TLPDQIINEKTEDNSDKHVKSNIRII-------KKFKHELEVTRAHYMPQDSTIIAT 139
           +  TL      E  ED+ D     +  II       K   + L+V+      Q+  + AT
Sbjct: 178 LSKTLVKDDTEENDEDDEDDEDADSDPIIENENIALKDTTNRLKVSPFATHGQE-VLTAT 236

Query: 140 INGDGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNPLDK-GKLL 186
           +  +G V+++D              + +     I +  +H    GYGL ++PL K G LL
Sbjct: 237 MCENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNVEGYGLDWSPLIKTGALL 296

Query: 187 SSSDDGSV-------AYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLK 239
           +    G +       + W   K     T      + D++W+     +F        + + 
Sbjct: 297 TGDCSGQIFLTQRHTSKWITDKQP--FTAANNQSVEDIQWSPTESTVFATSGTDGYVRIW 354

Query: 240 DVRNNNNDLKI---VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLN--- 293
           D R+  +   I    SN D+      N ++++    YL+A+  ++    ++D R  +   
Sbjct: 355 DTRSKKHKPAISTRASNTDV------NVISWNEKLGYLLASGDDNGSWGVWDLRQFSPAN 408

Query: 294 ----QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIG-----QEQTSDE 344
               QP+     H   +TS+ F+ L+D +V     D  V +WDL         Q+QT + 
Sbjct: 409 SEGVQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLSVEADDDEIQQQTKEY 468

Query: 345 IEDGDV-PELLMIH 357
            E   + P+LL +H
Sbjct: 469 KELQKIPPQLLFVH 482

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 82/374 (21%), Positives = 162/374 (43%), Gaps = 61/374 (16%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLP---SNETTNLPSNEQRLLLGTHTSGEEQN-----YLK 85
           P +Y+ +    L WP L+++ +P    +E  N P   Q LLL T T   ++       LK
Sbjct: 127 PTVYEMLHNVNLPWPCLSLDIVPDRLGSERRNYP---QSLLLTTATQASKKKDNELLLLK 183

Query: 86  IAEIT-------LPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTR-AHYMPQDSTII 137
           ++++T         D   ++  +++ D  V++    ++   + L+V+  A   P+  T  
Sbjct: 184 MSQLTKTLVKEDEDDDEEDDDEDEDQDPIVENENIPLRDTTNRLKVSPFASESPEKLT-- 241

Query: 138 ATINGDGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNPLDK-GK 184
           A+++ +G V+I+D              I +    PI +  +H    GY L ++PL+K G 
Sbjct: 242 ASMSENGEVYIFDLGPQVKGFETPGYQIPKTAKKPIHTVKAHGNVEGYALDWSPLNKSGS 301

Query: 185 LLSSSDDGSV-------AYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLN 237
           LL+    G V       + W   K+    +      I D+++++    +F        + 
Sbjct: 302 LLTGDCSGRVYLTQRHTSKWITDKTA--FSAGNNQSIEDIQFSRTEATVFATCGCDGYIR 359

Query: 238 LKDVRNNNNDLKIVSNHDIKTPSA-FNAMAFSFHSEYLMAASGEDSLIYLYDTRNLN--- 293
           + D R+  +   I     +K  S   N ++++    YL+A+  ++    ++D R  +   
Sbjct: 360 IWDTRSKKHKPAI----SVKASSTDVNVISWNEKIGYLLASGDDNGTWGVWDLRQFSPNN 415

Query: 294 ----QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------KQIGQEQTSD 343
                P+     H+ ++TS+ F+ L+D I+     D  V +WDL      ++I Q+    
Sbjct: 416 AASVSPVAQYSFHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAAET 475

Query: 344 EIEDGDVPELLMIH 357
           +      P+LL +H
Sbjct: 476 KELQQIPPQLLFVH 489

>TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.316
           YDR142C
          Length = 378

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 73/293 (24%), Positives = 124/293 (42%), Gaps = 29/293 (9%)

Query: 102 DNSDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPI 161
           D   K  ++NI I +    +L     H   ++  ++A   GDG++ ++DT++   Q  PI
Sbjct: 47  DERGKIKENNIFITQDCLFDLSWNELH---ENQVLVA--QGDGSLRLFDTTL---QKYPI 98

Query: 162 ISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQ 221
                 HK+      +N + KG  +SSS DG+V  W+  +   LLTL   S     + ++
Sbjct: 99  -GIFKEHKKEVLSCNWNLITKGTFVSSSWDGAVKMWSPLREQSLLTLLPKS---SEQSSK 154

Query: 222 FNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGED 281
            N N    +            NNN    I+ N D      + A  FS H   L+A    +
Sbjct: 155 INHNQIAKIPPHV--------NNNQSTPILQNKDC----VYQAQ-FSPHDNNLIACCSGN 201

Query: 282 SLIYLYDTRNLNQPLH---YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQ 338
           S I L+DTR  N   +   ++        +LDF+     ++ S G+D  + +WD++ I  
Sbjct: 202 SYITLFDTREQNNRFNNNSFIAHSGLETLTLDFNKYRPTVLASSGADNSIKIWDMRMIRN 261

Query: 339 EQTSDEIEDGDVPELL-MIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWK 390
             +++ +     P  +  I   H   +     S + + L  S   D   +VWK
Sbjct: 262 NNSNNTVMPTSNPICMNEIRKAHDLAVRRVVWSPHQSNLLLSTSYDMTSKVWK 314

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 79/373 (21%), Positives = 161/373 (43%), Gaps = 59/373 (15%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLP---SNETTNLPSNEQRLLLGTHTSGEEQN-----YLK 85
           P +Y+ +    L WP L+++ +P    +E  N P   Q LLL T T   ++       LK
Sbjct: 126 PTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYP---QSLLLTTATQASKKKDNELLLLK 182

Query: 86  IAEIT-------LPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTR-AHYMPQDSTII 137
           ++++          ++  ++  +++ D  V++    +K   + L+V+  A   P+   + 
Sbjct: 183 MSQLAKTLVKDDNNEEEDDDDEDEDQDPIVENENIPLKDTTNRLKVSPFASESPE--KLT 240

Query: 138 ATINGDGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNPLDK-GK 184
           AT++ +G V+I+D              + +    PI +  SH    GY L ++PL+K G 
Sbjct: 241 ATMSENGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRSHGNVEGYALDWSPLNKSGS 300

Query: 185 LLSSSDDGSV-------AYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLN 237
           LL+    G V       + W   K+    +      I D+++++    +F        + 
Sbjct: 301 LLTGDCSGRVYLTQRHTSKWITDKTA--FSAGNNQSIEDIQFSRTEATVFASCGCDGYIR 358

Query: 238 LKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLN---- 293
           + D R+  +   I       + +  N ++++    YL+A+  ++    ++D R  +    
Sbjct: 359 IWDTRSKKHKPAISVK---ASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFSPNTA 415

Query: 294 ---QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------KQIGQEQTSDE 344
               P+     H+ ++TS+ F+ L+D I+     D  V++WDL      ++I Q+     
Sbjct: 416 ASTSPVAQYNFHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQQAAETR 475

Query: 345 IEDGDVPELLMIH 357
                 P+LL +H
Sbjct: 476 ELQEIPPQLLFVH 488

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 78/373 (20%), Positives = 158/373 (42%), Gaps = 59/373 (15%)

Query: 34  PLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSGEEQN-----YLKIAE 88
           P +Y+ +    L WP +T++ +P N  +   +  Q +L+ T T   ++       LK+++
Sbjct: 125 PTVYEMLHNVNLPWPCMTLDLIPDNLGSERRNYPQSILMTTATQASKKKDNELLVLKLSQ 184

Query: 89  I--TLPDQIINEKTEDNSDKHVKS-------NIRIIKKFKHELEVTRAHYMPQDSTIIAT 139
           +  TL     +   +D  D+   +       NI++ +   + ++V+      Q+  + AT
Sbjct: 185 LAKTLAKDEDDGAEDDEDDEDEDADPIIENENIKL-RDTTNRMQVSPFAAESQE-VLAAT 242

Query: 140 INGDGTVFIYDTS------------IDENQSNPIISKLSHHKENGYGLAFNPLDK-GKLL 186
           ++ +G   I+D              + +    P  +  +H    GYGL ++PL K G LL
Sbjct: 243 MSENGEAHIFDLGPQVKAFSSPGYQVPKAAQRPQYTIKNHGNVEGYGLDWSPLIKTGALL 302

Query: 187 SSSDDGSV-------AYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLK 239
           +    G V       + W   K     T+     I D++W+     +F        + + 
Sbjct: 303 TGDCSGRVFLTQRTSSKWITDKQP--FTVDNNKSIEDIKWSPSENTVFATCGVDGHVRIW 360

Query: 240 DVRNNNNDLKI---VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLN--- 293
           D+R+  +   +   VS+ D+      N M+++    YL+A   ++    ++D R  +   
Sbjct: 361 DIRSKKHKPALSVKVSDTDV------NVMSWNQKISYLLATGDDNGTWGVWDLRQFSNQQ 414

Query: 294 ---QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------KQIGQEQTSDE 344
               P+     H+ ++TS+ F+ L++ I+     D  V +WDL      ++I Q+    +
Sbjct: 415 GGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAEVK 474

Query: 345 IEDGDVPELLMIH 357
                 P+LL +H
Sbjct: 475 ELQQIPPQLLFVH 487

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 80/169 (47%), Gaps = 10/169 (5%)

Query: 177 FNPLDKGKLLSSSDDGSVAYWNIQKS--IPLLTLQETSIINDVRWNQFNQNLFGYVTESS 234
           +NP+D   L+SSS D +   W++Q S  +    +   S + DVR+   +  LF       
Sbjct: 240 WNPIDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDG 299

Query: 235 CLNLKDVRNNNNDLKI----VSNHDIKTPSAFNAMAF--SFHSEYLMAASGEDS-LIYLY 287
            + + D+R+  +   I    VS+ +  T S F  +    S H   +MA    DS  I + 
Sbjct: 300 SVRVFDLRSLAHSTIIYEPPVSDLNPDT-SQFALLRLEPSPHDPNVMATFAADSNKILIL 358

Query: 288 DTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQI 336
           D RN   PL  + GH  SV  + +H +   +++SGG D +V  WDL + 
Sbjct: 359 DMRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNKC 407

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 46/101 (45%), Gaps = 9/101 (8%)

Query: 121 ELEVTRAHYMPQDSTIIATINGDG-TVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNP 179
           +  + R    P D  ++AT   D   + I D     N  +P++  L  H  +   + ++P
Sbjct: 329 QFALLRLEPSPHDPNVMATFAADSNKILILDM---RNPESPLM-ILEGHSASVNQIKWHP 384

Query: 180 LDKGKLLSSSDDGSVAYWNIQK----SIPLLTLQETSIIND 216
           + +  LLS  DD  V YW++ K    S P+ T ++  I  D
Sbjct: 385 IKRNVLLSGGDDCQVLYWDLNKCTASSDPVATTKDDDIAMD 425

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 94/198 (47%), Gaps = 19/198 (9%)

Query: 158 SNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIIN 215
           S  ++++++   +N + L   PL    LL SS +GSV    WN    I    + ET+I N
Sbjct: 2   SAKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNI-N 59

Query: 216 DVRW--NQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEY 273
            +R   N F        T  + + + DVRN ++ +  + N         N++  S  S +
Sbjct: 60  SLRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDK-------NSVFLSLESRH 112

Query: 274 LMAASGE-----DSLIYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKR 327
            M   G      D+ +++YD R  ++P+  ++  H D +T + FH  +  I++SG +D  
Sbjct: 113 DMLVCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGY 172

Query: 328 VAVWDLKQIGQEQTSDEI 345
             ++DL Q  +++   ++
Sbjct: 173 TNIYDLAQEDEDEALHQV 190

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 87/189 (46%), Gaps = 17/189 (8%)

Query: 162 ISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK---------SIPLLTLQETS 212
           + K   H      L FNP  +  L S+ ++G +  W+I K         S P + +    
Sbjct: 106 LGKFKKHTTAVNTLRFNPKQQNVLASAGNNGEILIWDINKTLSSTDYSPSAPGIAMSTQD 165

Query: 213 IINDVRWNQFNQNLFGYVTESSC-LNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHS 271
            I  V WN+   ++F    +++   ++ D++     + + +    KT    N     +H 
Sbjct: 166 EIKSVSWNKSLAHVFASAGDTTTYASIWDLKAKKEVIHL-NYTSPKTGLKPNLAVVEWHP 224

Query: 272 E---YLMAASGEDS--LIYLYDTRNLNQPLHYMRG-HEDSVTSLDFHALNDGIVISGGSD 325
           +   Y+  ASG DS  +I ++D RN N P+  + G H   + SLD+   ++ +++S G D
Sbjct: 225 KVTTYVATASGSDSDPVILIWDLRNSNMPMTTLEGPHTKGIMSLDWCTKDESLLLSSGRD 284

Query: 326 KRVAVWDLK 334
             VA+WD K
Sbjct: 285 GIVALWDTK 293

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 86/183 (46%), Gaps = 17/183 (9%)

Query: 173 YGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIINDVRW--NQFNQNLFG 228
           + L   PL +  LLSS  +G V    WN    I  +    TSI N +R   + ++     
Sbjct: 17  WCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSI-NRMRVLDSDYDNGSVF 75

Query: 229 YVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAA-----SGEDSL 283
            V  +  + + D+R   N +    N++ KTP        S  S + M A     SG D+ 
Sbjct: 76  SVAMNDAVKVLDLRVQGNSIVAELNNEKKTP------FLSLDSRHGMLACGTELSGVDAE 129

Query: 284 IYLYDTRNLNQPLHYM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTS 342
           I++YD RN ++P+  +   H D VT + FH  +  +++SG +D    V+DL Q+ +E   
Sbjct: 130 IHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDAL 189

Query: 343 DEI 345
            ++
Sbjct: 190 HQV 192

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 62/303 (20%), Positives = 120/303 (39%), Gaps = 66/303 (21%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D  +IAT + D TV ++++        P    L  H +    L++ P+      ++ +L 
Sbjct: 194 DGELIATGSMDNTVRLWES----KTGKPFGDALRGHGKWITSLSWEPIHLVTPGERPRLA 249

Query: 187 SSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           +SS DG++  W+  + +  +TL   TS ++ V+W    QN     +    + + D++N+ 
Sbjct: 250 TSSKDGTIKIWDTTRRVCTMTLSGHTSSVSCVKWG--GQNFLYSGSHDKTVRVWDMKNSG 307

Query: 246 NDLKIVSNH-------DIKTPSAFNAMAFSFHSEY------------------------- 273
             + I+ NH        + T  A     F +  E                          
Sbjct: 308 RCINILKNHAHWVNHLSLSTDYALRVGPFDYTGEQPATPEIAKAKALKNYEKVAKRNGKE 367

Query: 274 --LMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGI-VISGGSDKRVAV 330
             LM  + +D  ++L+D     +P+  M GH+  V  + F    DG  ++S   D  + +
Sbjct: 368 TELMVTASDDFTMFLWDPLRTTKPIARMTGHQKLVNHVAFSP--DGRHIVSASFDNSIKL 425

Query: 331 WDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWK 390
           WD +            DG   + +    GH + +   + S++   L  S  +D  ++VW 
Sbjct: 426 WDSR------------DG---KFITTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVWD 469

Query: 391 MNN 393
           +  
Sbjct: 470 IRT 472

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 41/200 (20%), Positives = 87/200 (43%), Gaps = 55/200 (27%)

Query: 132 QDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDD 191
           +++ ++ T + D T+F++D      ++   I++++ H++    +AF+P D   ++S+S D
Sbjct: 366 KETELMVTASDDFTMFLWD----PLRTTKPIARMTGHQKLVNHVAFSP-DGRHIVSASFD 420

Query: 192 GSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIV 251
            S+  W                  D R  +F     G+V                     
Sbjct: 421 NSIKLW------------------DSRDGKFITTFRGHV--------------------- 441

Query: 252 SNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDF 311
                   ++   +A+S     L++ S +D+ + ++D R     +  + GH+D V ++D+
Sbjct: 442 --------ASVYQVAWSSDCRLLVSCS-KDTTLKVWDIRTRKLSVD-LPGHKDEVYTVDW 491

Query: 312 HALNDGIVISGGSDKRVAVW 331
            +++   V SGG DK V +W
Sbjct: 492 -SVDGKRVCSGGKDKMVRIW 510

>TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa]
           {ON} Anc_6.340 YCR072C
          Length = 514

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 119/299 (39%), Gaps = 66/299 (22%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D+ +IAT + D T+ +++         PI   L  H +    LA+ PL       K +L 
Sbjct: 196 DAEVIATGSMDNTIRLWNGI----NGKPIGDSLRGHSKWITSLAWEPLHLVKVGQKPRLA 251

Query: 187 SSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           S+S DG++  W+    + L TL   TS ++ VRW    QN+    +    + + D+ +N 
Sbjct: 252 SASKDGTIKVWDTTGRVCLYTLSGHTSSVSCVRWG--GQNMLYTGSHDKTIRVWDMNSNG 309

Query: 246 NDLKIVSNH-------DIKTPSAFNAMAFSF---------------------------HS 271
             + I+ +H        + T  A     F                             H+
Sbjct: 310 RCINILKSHAHWVNHLSLSTDYALRIGPFDHSGAKPAIAEEARDKALKNYEKIVKKNGHT 369

Query: 272 EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGI-VISGGSDKRVAV 330
           E LM  + +D  ++L++     +PL  M GH+  V  + F    DG  ++S   D  + +
Sbjct: 370 EELMVTASDDFTMFLWNPLKSTKPLARMTGHQKLVNHVAFSP--DGRHIVSASFDNSIKL 427

Query: 331 WDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
           WD +            DG   + +    GH + +   + S++   L  S  +D  ++VW
Sbjct: 428 WDGR------------DG---KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 470

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 77/149 (51%), Gaps = 11/149 (7%)

Query: 185 LLSSSDDGSVAYWNIQKSI-PLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           ++++SDD ++  WN  KS  PL  +     ++N V ++   +++     ++S + L D R
Sbjct: 373 MVTASDDFTMFLWNPLKSTKPLARMTGHQKLVNHVAFSPDGRHIVSASFDNS-IKLWDGR 431

Query: 243 NNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGH 302
               D K +S       S +  +A+S     L++ S +D+ + ++D R     +  + GH
Sbjct: 432 ----DGKFISTFRGHVASVYQ-VAWSSDCRLLVSCS-KDTTLKVWDVRTKKLSVD-LPGH 484

Query: 303 EDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           +D V ++D+ +++   V SGG DK V +W
Sbjct: 485 QDEVFTVDW-SVDGKRVCSGGKDKMVRLW 512

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 89/187 (47%), Gaps = 27/187 (14%)

Query: 173 YGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSII------NDVRWNQFNQ 224
           + L   PL    LLS+  +G V    WN   SI  + +  TSI       NDV     + 
Sbjct: 16  WCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISALKVLDNDVD----SG 71

Query: 225 NLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAA-----SG 279
           N F   +E S + + D+R N   +  V N       A N+   S  S + M A     SG
Sbjct: 72  NTFVTASEDS-VKIFDLRLNQC-VATVQN-------AKNSPFISLDSRHGMLACGTELSG 122

Query: 280 EDSLIYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQ 338
            D+ I+LYD + ++ P+  +   H D +T + FHA +  +++SG +D  V V+DLKQ  +
Sbjct: 123 TDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQEE 182

Query: 339 EQTSDEI 345
           E+   ++
Sbjct: 183 EEALHQV 189

>KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.325
           YCR057C
          Length = 918

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 101/224 (45%), Gaps = 17/224 (7%)

Query: 130 MPQDSTIIATINGDGTVFIYDTS------IDENQSNPIISKLSHHKENGYGLAFNPLDKG 183
           M Q+     T+N  G    + +S      + E QS   I K   H ++   L ++P D  
Sbjct: 296 MGQNPVNTVTVNSTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLTYSP-DGS 354

Query: 184 KLLSSSDDGSVAYWNIQKSIPLLTLQE-TSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           +++++++DG +  W++     L TL E T+ +  V++ +  Q LF    + +      +R
Sbjct: 355 RVVTAAEDGKIKVWDVVSGFCLATLDEHTAAVTQVQFAKKGQVLFSASLDGTVKAWDLIR 414

Query: 243 NNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGH 302
             N  +   +         FN++A     E + A S ++  I+++  +   Q L  + GH
Sbjct: 415 YRNFRVFTAAER-----IQFNSLAVDPSGEVVCAGSMDNFDIHVWSVQT-GQLLDSLSGH 468

Query: 303 EDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIE 346
           E  V+ L F   N G++ S   DK + +W +   G+ Q  D IE
Sbjct: 469 EGPVSCLAFSQEN-GVLASASWDKTIRIWYI--FGRSQQVDPIE 509

>Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}
           YCR057C (REAL)
          Length = 920

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 104/238 (43%), Gaps = 27/238 (11%)

Query: 121 ELEVTRAHYMPQDSTIIATINGDGTVFIYDTS------IDENQSNPIISKLSHHKENGYG 174
           E  + +   M Q+     T+N  G    + +S      + E QS   I K   H ++   
Sbjct: 291 EFTLIQQLSMGQNPVNTVTVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNS 350

Query: 175 LAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQE-TSIINDVRWNQFNQNLF-----G 228
           LA++P D  +++++SDDG +  W++     L T +E TS +  V++ +  Q +F     G
Sbjct: 351 LAYSP-DGSRVVTASDDGKIKVWDVTSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSMDG 409

Query: 229 YVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYD 288
            V     +  ++ R      +I           FN +A     E + A S ++  I+++ 
Sbjct: 410 TVRAWDLIRYRNFRTFTGTERI----------QFNCLAVDPSGEVVCAGSLDNFDIHVWS 459

Query: 289 TRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIE 346
            +   Q L  + GHE  V+ L F   N  ++ S   DK + +W +   G+ Q  + +E
Sbjct: 460 VQT-GQLLDALSGHEGPVSCLSFSQEN-SVLASASWDKTIRIWSI--FGRSQQVEPLE 513

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/299 (21%), Positives = 120/299 (40%), Gaps = 66/299 (22%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D  +IAT + D T+ ++++S    +  P    L  H +    L++ P+      DK +L 
Sbjct: 197 DGELIATGSMDNTIRLWESS----KGKPYGDALRGHSKWITSLSWEPIHLVKPGDKPRLA 252

Query: 187 SSSDDGSVAYWNIQKSIPLLTL-QETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           ++S DG++  W+  + + LLTL   TS ++ V+W    +N+    +    +   D+  N 
Sbjct: 253 TASKDGTIKIWDTTRRVCLLTLCGHTSSVSCVKWG--GKNVLYSGSHDKTIRCWDMNLNG 310

Query: 246 NDLKIVSNH-------DIKTPSAFNAMAFSFHSEY------------------------- 273
             + I+ +H        + T  A    AF    E                          
Sbjct: 311 KCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQQKALKNYEKVAKRKGDF 370

Query: 274 --LMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKRVAV 330
             LM  + +D  +YL++     +P+  M GH+  V  + F    DG  ++S   D  + +
Sbjct: 371 EELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSP--DGRYIVSASFDNSIKL 428

Query: 331 WDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
           WD +            DG   + L    GH + +   + S++   L  S  +D  ++VW
Sbjct: 429 WDGR------------DG---KFLSTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 471

 Score = 38.1 bits (87), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 76/158 (48%), Gaps = 29/158 (18%)

Query: 185 LLSSSDDGSVAYWNIQKSIPLLTLQ--ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           ++++SDD ++  WN  KS   +T       ++N V ++   +    Y+  +S        
Sbjct: 374 MVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGR----YIVSAS-------- 421

Query: 243 NNNNDLKIVSNHDIKTPSAFNA-------MAFSFHSEYLMAASGEDSLIYLYD--TRNLN 293
             +N +K+    D K  S F         +A+S     L++ S +D+ + ++D  TR L+
Sbjct: 422 -FDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCS-KDTTLKVWDVKTRKLS 479

Query: 294 QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVW 331
             L    GH+D V ++D+ +++   V SGG DK V +W
Sbjct: 480 VDLP---GHQDEVYTVDW-SVDGKRVCSGGKDKMVRIW 513

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/178 (28%), Positives = 83/178 (46%), Gaps = 17/178 (9%)

Query: 171 NGYGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIINDVRWNQFNQNLFG 228
           N + L   P  +  LL+S  +G V    W   KSI  +   E ++      N  ++N   
Sbjct: 14  NNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNKLKLINNDHENEST 73

Query: 229 YVTES-SCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAA-----SGEDS 282
           Y T +   + + D+R+NN  L  +SN         NA   S  S + M A     SG D+
Sbjct: 74  YATATMGAVKIWDIRSNNC-LATISNDK-------NAPFLSLDSRHNMLACGTELSGSDA 125

Query: 283 LIYLYDTRNLNQPLHYM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQE 339
            +++YD R  + PL  +   H D +T + FH  +  +++SG +D    ++DL+Q  +E
Sbjct: 126 ELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQAEEE 183

>Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON}
           YCR057C (REAL)
          Length = 916

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 101/229 (44%), Gaps = 27/229 (11%)

Query: 130 MPQDSTIIATINGDGTVFIYDTS------IDENQSNPIISKLSHHKENGYGLAFNPLDKG 183
           M Q+     ++N  G    + +S      + E QS   I K   H ++   LA++P D  
Sbjct: 295 MGQNPVNTVSVNSTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNCLAYSP-DGS 353

Query: 184 KLLSSSDDGSVAYWNIQKSIPLLTLQE-TSIINDVRWNQFNQNLF-----GYVTESSCLN 237
           +++++SDDG +  W+I     L T +E TS +  V++ +  Q +F     G V     + 
Sbjct: 354 RVVTASDDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIR 413

Query: 238 LKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLH 297
            ++ R      +I           FN +A     E + A S ++  I+++  +   Q L 
Sbjct: 414 YRNFRTFTGTERI----------QFNCLAVDPSGEVVCAGSLDNFDIHVWSVQT-GQLLD 462

Query: 298 YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIE 346
            + GHE  V+ L F   N  ++ S   DK + +W +   G+ Q  + +E
Sbjct: 463 ALSGHEGPVSCLSFSQEN-SVLASASWDKTIRIWSI--FGRSQQVEPLE 508

>Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON}
           YCR057C (REAL)
          Length = 924

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 101/229 (44%), Gaps = 27/229 (11%)

Query: 130 MPQDSTIIATINGDGTVFIYDTS------IDENQSNPIISKLSHHKENGYGLAFNPLDKG 183
           M Q+     ++N  G    + +S      + E QS   I K   H ++   LA++P D  
Sbjct: 298 MGQNPVNTVSVNNTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSP-DGS 356

Query: 184 KLLSSSDDGSVAYWNIQKSIPLLTLQE-TSIINDVRWNQFNQNLF-----GYVTESSCLN 237
           +++++SDDG +  W+I     L T +E TS +  V++ +  Q +F     G V     + 
Sbjct: 357 RVVTASDDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIR 416

Query: 238 LKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLH 297
            ++ R      +I           FN +A     E + A S ++  I+++  +   Q L 
Sbjct: 417 YRNFRTFTGTERI----------QFNCLAVDPSGEVVCAGSLDNFDIHVWSVQT-GQLLD 465

Query: 298 YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIE 346
            + GHE  V+ L F   N  ++ S   DK + +W +   G+ Q  + +E
Sbjct: 466 ALSGHEGPVSCLSFSQEN-SVLASASWDKTIRIWSI--FGRSQQVEPLE 511

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 5/104 (4%)

Query: 99  KTED-NSDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQ 157
           KT D N D+     +R      H  ++T   +  QDS  I T + D +  I+  S+D  +
Sbjct: 123 KTPDVNRDRQFAPFVRYRVHAGHFQDITSLTW-SQDSRFILTTSKDLSAKIW--SVDSEE 179

Query: 158 SNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK 201
            +   +  + H++   G AF   D+ K+ + S DG+V  W   K
Sbjct: 180 KSLAATTFNGHRDYVMG-AFFSHDQEKIYTVSKDGAVFVWEFTK 222

>YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}
           PWP2Conserved 90S pre-ribosomal component essential for
           proper endonucleolytic cleavage of the 35 S rRNA
           precursor at A0, A1, and A2 sites; contains eight
           WD-repeats; PWP2 deletion leads to defects in cell cycle
           and bud morphogenesis
          Length = 923

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 101/229 (44%), Gaps = 27/229 (11%)

Query: 130 MPQDSTIIATINGDGTVFIYDTS------IDENQSNPIISKLSHHKENGYGLAFNPLDKG 183
           M Q+     ++N  G    + +S      + E QS   I K   H ++   LA++P D  
Sbjct: 300 MGQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLAYSP-DGS 358

Query: 184 KLLSSSDDGSVAYWNIQKSIPLLTLQE-TSIINDVRWNQFNQNLF-----GYVTESSCLN 237
           +++++S+DG +  W+I     L T +E TS +  V++ +  Q +F     G V     + 
Sbjct: 359 RVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIR 418

Query: 238 LKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLH 297
            ++ R      +I           FN +A     E + A S ++  I+++  +   Q L 
Sbjct: 419 YRNFRTFTGTERI----------QFNCLAVDPSGEVVCAGSLDNFDIHVWSVQT-GQLLD 467

Query: 298 YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIE 346
            + GHE  V+ L F   N  ++ S   DK + +W +   G+ Q  + IE
Sbjct: 468 ALSGHEGPVSCLSFSQEN-SVLASASWDKTIRIWSI--FGRSQQVEPIE 513

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 59/259 (22%), Positives = 103/259 (39%), Gaps = 31/259 (11%)

Query: 99  KTED-NSDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQ 157
           KT D N D+     +R      H  ++T   +  QDS  I T + D +  I+  S+D  +
Sbjct: 123 KTPDVNKDRQFAPFVRHRVHAGHFQDITSLTW-SQDSRFILTTSKDLSAKIW--SVDSEE 179

Query: 158 SNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK--------SIPLLTLQ 209
            N   +  + H++   G AF   D+ K+ + S DG+V  W   K               Q
Sbjct: 180 KNLAATTFNGHRDYVMG-AFFSHDQEKIYTVSKDGAVFVWEFTKRPSDDDDNESEDDDKQ 238

Query: 210 ETSIINDVRWNQFNQNLF-------GYVTESSCLNLKDVRNNNNDLKIVSNHDIK----- 257
           E   I+   W    ++ F         VT      L  V   + + ++    D       
Sbjct: 239 EEVDISKYSWRITKKHFFYANQAKVKCVTFHPATRLLAVGFTSGEFRLYDLPDFTLIQQL 298

Query: 258 --TPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALN 315
               +  N ++ +   E+L   S +   + +Y+ ++ +  L   +GH DS  SL +    
Sbjct: 299 SMGQNPVNTVSVNQTGEWLAFGSSKLGQLLVYEWQSESYILK-QQGHFDSTNSLAYSP-- 355

Query: 316 DGI-VISGGSDKRVAVWDL 333
           DG  V++   D ++ VWD+
Sbjct: 356 DGSRVVTASEDGKIKVWDI 374

>Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar to
           Ashbya gossypii AAR057W
          Length = 923

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 102/229 (44%), Gaps = 27/229 (11%)

Query: 130 MPQDSTIIATINGDGTVFIYDTS------IDENQSNPIISKLSHHKENGYGLAFNPLDKG 183
           M Q+     ++N  G    + +S      + E QS   I K   H +    LA++P D  
Sbjct: 312 MGQNPVNTVSVNKSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDTMNDLAYSP-DGS 370

Query: 184 KLLSSSDDGSVAYWNIQKSIPLLTLQE-TSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           +++++S DG +  W+I     L T +E  S +  V++ +  Q +F     S+CL+     
Sbjct: 371 RIVTASSDGKIKIWDIVSGFCLATFEEHVSAVTAVQFAKKGQIMF-----SACLD----- 420

Query: 243 NNNNDLKIVSNHDIKTPSA-----FNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLH 297
                  ++   + +T +A     FN +A     E + A S +D  I+++  +   Q L 
Sbjct: 421 GTVKAWDLIRYRNFRTFTATERIQFNCLAVDPSGEIVCAGSLDDFNIHVWSVQT-GQLLD 479

Query: 298 YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIE 346
            + GHE  V+ L F   N  ++ S   DK + +W +   G+ Q  + IE
Sbjct: 480 TLSGHEGPVSCLSFSNEN-SVLASASWDKTIRIWSI--FGRSQQVEPIE 525

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 92/205 (44%), Gaps = 27/205 (13%)

Query: 132 QDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDD 191
           +D T I +  GDG +    T   E+        + HH+ N      N +  G        
Sbjct: 155 KDDTKIVSDTGDGALL--KTFYGEH----AFQSIDHHRRNP-----NFVTGG-------- 195

Query: 192 GSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKI 250
             +  W++ +  PL  L      ++ VR+NQ  +++       + + L D+R N+   K+
Sbjct: 196 AQIQLWDVNRKKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNSIVLYDLRTNSPTQKV 255

Query: 251 VSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLD 310
           V    ++T    NA+ ++    +  A + ED   Y YD RN+++ LH  + H  +V  +D
Sbjct: 256 VQR--MRT----NALCWNPMEPFNFAIANEDHNAYYYDMRNMSRALHVFKDHVSAVMDVD 309

Query: 311 FHALNDGIVISGGSDKRVAVWDLKQ 335
           F    + IV +G  DK + +++LK 
Sbjct: 310 FSPTGEEIV-TGSYDKTIRIFNLKH 333

 Score = 37.0 bits (84), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 48/211 (22%), Positives = 87/211 (41%), Gaps = 38/211 (18%)

Query: 151 TSIDENQSNPIISKLSH-HKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQ 209
           T ++   + P + +L + H++  Y LA N     KL S S DG V YWN+     L + +
Sbjct: 48  TKLERMFAKPFVGQLGYGHRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFR 107

Query: 210 ETS------IINDVRWNQFNQNLFGYVTESSC----------LNLKDVRNNNNDLKIVSN 253
                     +     +   ++ F      SC          +N  D  +  +D KIVS+
Sbjct: 108 AHYGLVTGLCVTPTHLSPTKKDSFML----SCGDDKTIKLWSVNSDDFNSIKDDTKIVSD 163

Query: 254 HDIKTPSAFNAMAFSFHSEYLMAASGE----------DSLIYLYDTRNLNQPLHYMRGHE 303
                 +   A+  +F+ E+   +              + I L+D  N  +PL  +    
Sbjct: 164 ------TGDGALLKTFYGEHAFQSIDHHRRNPNFVTGGAQIQLWDV-NRKKPLSNLSWGV 216

Query: 304 DSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
           D+V+ + F+   + I+ S GSD  + ++DL+
Sbjct: 217 DNVSFVRFNQNEEDILASTGSDNSIVLYDLR 247

>KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 372

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 84/198 (42%), Gaps = 21/198 (10%)

Query: 142 GDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK 201
           GDG++ ++D  + +    PI     H +E  +   +N + K   +SSS DG V  W++ +
Sbjct: 81  GDGSLRLFDIKLKDY---PIAIYKEHQREV-FSCNWNMIQKQMFVSSSWDGKVKLWSLMR 136

Query: 202 SIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSA 261
              L+T+      ND              T S    +  VR   ++ K   + D      
Sbjct: 137 PQSLMTMSP----NDTN---------AASTLSRTSAVAPVRVPMSNQKEHQHADGNKECI 183

Query: 262 FNAMAFSFHSEYLMAASGEDSLIYLYDTR--NLNQPLHYMRGHED-SVTSLDFHALNDGI 318
           + A  FS H   L+  S  +S I LYD R  N   P H   GH      + DF+     I
Sbjct: 184 YQA-TFSPHDPNLVLCSSGNSFISLYDLRVPNNGLPQHQFLGHGGFEALTCDFNKYRPHI 242

Query: 319 VISGGSDKRVAVWDLKQI 336
           + +GG DK + VWDL+  
Sbjct: 243 IATGGVDKMIKVWDLRMC 260

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 69/307 (22%), Positives = 127/307 (41%), Gaps = 52/307 (16%)

Query: 35  LLYDFVSETKLVWPSLTVEWLPS-NETTNLPSNEQRLLLGT----HTSGEEQNYLKIAEI 89
           L +D V+E  +++P   ++WLPS  +     ++   L + +     +S  EQ  L + + 
Sbjct: 142 LSWDKVAEHNIIYPVSNIQWLPSVQQPRKFATSSDSLRIWSLNEEDSSLTEQVNLSLCKY 201

Query: 90  TLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTIIATINGDGTVFIY 149
                 +++ T  +SD        I+ +F     VT  H+ P D+ ++ + + D T  ++
Sbjct: 202 NDQHHSLSKNTTSSSD--------ILGQFP---PVTSFHWNPIDTNLLISSSIDTTCIVW 250

Query: 150 DTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQ 209
           D       SN + ++L  H    + + F         S   DGSV  ++++      +L 
Sbjct: 251 DL----QSSNYVRTQLIAHDSEVFDVKFLAHSTQLFASCGGDGSVRVFDLR------SLA 300

Query: 210 ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSF 269
            ++II +   +Q               N  D   +N           K+PSA   +  S 
Sbjct: 301 HSTIIYESNSDQ---------------NGSDTLTDNE----------KSPSALLRLQPSP 335

Query: 270 HSEYLMAASGEDSL-IYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRV 328
               +MA    DS  I + D RN   P+  + GH  +V  + +H     +++S G D +V
Sbjct: 336 SDPNVMATFALDSKSILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQV 395

Query: 329 AVWDLKQ 335
             WDL +
Sbjct: 396 LYWDLNE 402

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 85/173 (49%), Gaps = 19/173 (10%)

Query: 173 YGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIINDVRW--NQFNQNLFG 228
           + L   P     LL+S  +G V +  W   KS+ +     +SI N ++   + FN+    
Sbjct: 17  WCLGLQPFYNHHLLTSLSNGEVHHIDWVTGKSVRVDQAGNSSI-NKLKIIDSNFNEGSSY 75

Query: 229 YVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAA-----SGEDSL 283
            V  +  +N+ DVR+ +   K+ S  + K     NA   S  S + M A     SG D+ 
Sbjct: 76  AVASNDSVNILDVRSRD---KLASLKNDK-----NAPFLSLDSRHGMLACGTELSGVDAE 127

Query: 284 IYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQ 335
           +++YD RN + P+  ++  H D VT + FH  +  +++SG +D    V+DLKQ
Sbjct: 128 LHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLKQ 180

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 143 DGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK 201
           D  + IYD     N S PI S +  H ++   + F+P D+  LLS S DG    +++++
Sbjct: 125 DAELHIYDV---RNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLKQ 180

>KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.316
           YDR142C
          Length = 381

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 90/228 (39%), Gaps = 47/228 (20%)

Query: 124 VTRAHYMPQDSTI-----------IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENG 172
           VTR  Y+ QD                   GDG++ ++DT++D+      ++    H++  
Sbjct: 52  VTRRDYLTQDCLFDLAWSELNENQCLVAQGDGSLRLFDTTLDKYP----VAVYQEHRDEV 107

Query: 173 YGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTE 232
               ++ + +   +SS  DG V  W++ +   ++TL+  +  N                 
Sbjct: 108 ASCNWSLIGRNTFVSSGWDGLVKVWSVGRPNSVMTLKPRTRSNTA--------------- 152

Query: 233 SSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNL 292
                   V +  N     +  D      + A  FS H + LM     DS + L+D R  
Sbjct: 153 --------VLDRPNGTGTTNGKDC----VYQA-KFSPHDDSLMVCCSGDSTVSLFDLRAS 199

Query: 293 N---QPLHYMRGHEDSVT-SLDFHALNDGIVISGGSDKRVAVWDLKQI 336
                P H    H  S T S+DF+     ++ +GG D ++ +WDL+ +
Sbjct: 200 QPGQGPTHQFMAHSGSETLSVDFNKYRTNVIATGGVDNKIKIWDLRML 247

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/134 (17%), Positives = 52/134 (38%), Gaps = 2/134 (1%)

Query: 74  THTSGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQD 133
           T  S      +K+  +  P+ ++  K    S+  V            +  V +A + P D
Sbjct: 119 TFVSSGWDGLVKVWSVGRPNSVMTLKPRTRSNTAVLDRPNGTGTTNGKDCVYQAKFSPHD 178

Query: 134 STIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGS 193
            +++   +GD TV ++D    +    P    ++H       + FN      + +   D  
Sbjct: 179 DSLMVCCSGDSTVSLFDLRASQPGQGPTHQFMAHSGSETLSVDFNKYRTNVIATGGVDNK 238

Query: 194 VAYWNIQ--KSIPL 205
           +  W+++  ++ PL
Sbjct: 239 IKIWDLRMLRTGPL 252

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 2/88 (2%)

Query: 249 KIVSNHDIKTPSAFNAMAFS-FHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVT 307
           ++V+  D  T      +A+S  +    + A G+ SL  L+DT     P+   + H D V 
Sbjct: 50  QMVTRRDYLTQDCLFDLAWSELNENQCLVAQGDGSL-RLFDTTLDKYPVAVYQEHRDEVA 108

Query: 308 SLDFHALNDGIVISGGSDKRVAVWDLKQ 335
           S ++  +     +S G D  V VW + +
Sbjct: 109 SCNWSLIGRNTFVSSGWDGLVKVWSVGR 136

>CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072c
          Length = 517

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 62/299 (20%), Positives = 117/299 (39%), Gaps = 66/299 (22%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D  +IAT + D T+ ++D         P+   L  H +    L + P+       K +L 
Sbjct: 199 DGEVIATGSMDNTIRLWDA----ESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLA 254

Query: 187 SSSDDGSVAYWNIQKSIPLLTL-QETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           S+S DG++  W+  + + L+TL   T+ ++ V+W    + +    +    +   D++ N 
Sbjct: 255 SASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKWG--GEGILYSGSHDKTVRAWDMKQNG 312

Query: 246 NDLKIVSNH-------DIKTPSAFNAMAFSFHS--------------------------- 271
             + I+ +H        + T  A    AF +                             
Sbjct: 313 KCINILKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKALQNYEKVARKNGKH 372

Query: 272 EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKRVAV 330
           E LM  + +D  ++L++     +P+  M GH+  V  + F    DG  ++S   D  + +
Sbjct: 373 EELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSP--DGKYIVSASFDNSIKL 430

Query: 331 WDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
           WD    G+E T            L    GH + +   + S++   L  S  +D  ++VW
Sbjct: 431 WD----GKEGT-----------FLSTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 473

>TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {ON}
           Anc_6.325 YCR057C
          Length = 927

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 97/209 (46%), Gaps = 26/209 (12%)

Query: 144 GTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSI 203
           G + +Y     E QS   I K   H +   GL ++P D  +++++S+DG +  W++    
Sbjct: 321 GQLLVY-----EWQSESYILKQQGHFDTLNGLTYSP-DGSRVVTASEDGKIKIWDVVSGF 374

Query: 204 PLLTLQE-TSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSA- 261
            L T +E TS ++ V++++  Q LF    + +      +R  N           +T +A 
Sbjct: 375 CLATFEEHTSAVSAVQFSKRGQVLFSASLDGTVRAWDLIRYRN----------FRTFTAA 424

Query: 262 ----FNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG 317
               FN++A     E + A S ++  I ++  +   Q L  + GHE  V+ L F   N+ 
Sbjct: 425 ERIQFNSLAVDPSGEVVCAGSIDNYEIQVWSVQT-GQLLDCLAGHEGPVSCLAFSQENN- 482

Query: 318 IVISGGSDKRVAVWDLKQIGQEQTSDEIE 346
           ++ S   DK + VW +   G+ Q  + I+
Sbjct: 483 VLASASWDKTIRVWSI--FGRSQQVEPID 509

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 98/228 (42%), Gaps = 27/228 (11%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDG 192
           D+ IIA    +G+V ++  + D  +S    +K   HK       FN      L +    G
Sbjct: 73  DNKIIAGALDNGSVELFSYNADSLKSE---AKFQRHKTTAKVARFNAKQFNVLATGGTKG 129

Query: 193 SVAYWNIQKSI----------PLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
            +  W++ K +          P  ++     I  + WNQ   ++F     +S  ++ D++
Sbjct: 130 EIFIWDVNKCLENPNDYTPLTPGNSMTPVEEITSLAWNQSLAHVFASAGSTSYASIWDLK 189

Query: 243 NNNNDLKIV---SNHDIKTPSAFNAMAFSFH---SEYLMAASGED--SLIYLYDTRNLNQ 294
                + +     N  +K P +       +H   S  +  A+G D    I ++D RN N 
Sbjct: 190 AKKEVIHLSYTSPNTGLKAPLSV----VEWHPKNSTRVATATGSDNDPSILVWDLRNANT 245

Query: 295 PLHYM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQT 341
           PL  + +GH   V SLD+   ++ +++S G D  V +W+  Q GQE T
Sbjct: 246 PLQVLSQGHSKGVLSLDWCNQDENLLLSSGRDNTVVLWN-PQEGQELT 292

>Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON}
           (125940..128657) [2718 nt, 906 aa]
          Length = 905

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 53/222 (23%), Positives = 97/222 (43%), Gaps = 25/222 (11%)

Query: 130 MPQDSTIIATINGDGTVFIYDTS------IDENQSNPIISKLSHHKENGYGLAFNPLDKG 183
           M Q++    +IN  G    + +S      + E QS   I K   H ++  GL ++P D  
Sbjct: 293 MGQNAVNTVSINNTGEWLAFGSSALGQLLVYEWQSESYILKQQGHFDSLNGLTYSP-DGA 351

Query: 184 KLLSSSDDGSVAYWNIQKSIPLLTLQE-TSIINDVRWNQFNQNLF-----GYVTESSCLN 237
           +++++++DG +  W++     L T  E TS +  V++ +  Q LF     G V     + 
Sbjct: 352 RVVTAANDGKIKVWDVVSGFCLATFSEHTSSVTAVQFAKRGQVLFSSSLDGTVRAWDLIR 411

Query: 238 LKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLH 297
            ++ R   +  +I           FN +A     E + A S +   I+++  +   Q L 
Sbjct: 412 FRNFRTFTSTQRI----------PFNCLAVDPSGEVVCAGSSDSFEIHVWSVQT-GQLLD 460

Query: 298 YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQE 339
            + GHE  V+ L F   N  ++ S   DK + +W +    Q+
Sbjct: 461 SLDGHEGPVSCLAFSQENS-VLASASWDKTIRIWSIFSRSQQ 501

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 68/140 (48%), Gaps = 8/140 (5%)

Query: 197 WNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHD 255
           W+  +S P+  L      ++ V++NQ   ++F      + + L D+R N+   K V    
Sbjct: 199 WDSTRSRPITNLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQKFVQK-- 256

Query: 256 IKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALN 315
           ++T    NA+ ++    Y    + ED   Y YD RNL++ LH  + H  +V  +DF    
Sbjct: 257 MRT----NALCWNPMEAYNFVVANEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTG 312

Query: 316 DGIVISGGSDKRVAVWDLKQ 335
           D IV +G  DK + ++ +K 
Sbjct: 313 DEIV-TGSYDKTIRIYQVKH 331

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 88/204 (43%), Gaps = 26/204 (12%)

Query: 151 TSIDENQSNPIISKLSH-HKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQ 209
           T I+   + P + +L + H++  Y +A N     KL ++S DG V YWN+     + + +
Sbjct: 48  TKIERMFAKPFVGQLGYGHRDGVYTIAKNYHVLNKLATASADGVVKYWNMSTREEVCSFK 107

Query: 210 -ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRN------NNNDLKIVSNHDIKTPSAF 262
               +I+ +      Q+L     E+  L+  D R       N +D       D +   + 
Sbjct: 108 AHYGLIHGLCVTP--QHLSQNKNENYMLSCGDDRTVKLWSVNTDDFS-SERGDEEVIKSG 164

Query: 263 NAMAFSFHSEYL------------MAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLD 310
           N +  +FH E+                 G +  I L+D+   ++P+  +    D+V+++ 
Sbjct: 165 NGLIKTFHGEHAFLGIDHHRSNSNFVTGGAE--INLWDS-TRSRPITNLSWGADNVSTVK 221

Query: 311 FHALNDGIVISGGSDKRVAVWDLK 334
           F+     I  S GSD  V ++DL+
Sbjct: 222 FNQNETDIFASAGSDNSVVLYDLR 245

>Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}
           similar to Ashbya gossypii AGL190W
          Length = 374

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 90/206 (43%), Gaps = 26/206 (12%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           +    GDG++ ++D ++   Q  P+ +    H+   +   +N +DK   LSSS DG+V  
Sbjct: 77  VLAAQGDGSLRLFDINL---QKYPV-AIFQEHEREVFSCNWNLIDKQTFLSSSWDGTVKI 132

Query: 197 WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDI 256
           W+  +   L TL  T   N V            + +S+ L      +N    K  SN+  
Sbjct: 133 WSPARKQSLRTLLPTPTNNTV------------LVDSTVLKQDVPVSNQAQHKYSSNNK- 179

Query: 257 KTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNL----NQPLHYMRGHEDSVTSLDFH 312
                + A+     S  +M+ SG +S + ++D R       Q     RG E    + DF+
Sbjct: 180 --DCIYQALYSPHDSNLVMSCSG-NSYVSIFDIRQPVNTEQQSFIAHRGLE--ALTCDFN 234

Query: 313 ALNDGIVISGGSDKRVAVWDLKQIGQ 338
                IV +GG DK + VWDL+ + Q
Sbjct: 235 KYRPHIVATGGVDKLIKVWDLRMVRQ 260

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 89/187 (47%), Gaps = 19/187 (10%)

Query: 165 LSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIINDVRW--N 220
           L+    N + L F PL    LL+S  +G ++   W   +    + + ETSI ND     N
Sbjct: 8   LTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSI-NDFEIVNN 66

Query: 221 QFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAA--- 277
            +N         +  + + D+++N+  +K ++N         N+   S  S + M A   
Sbjct: 67  NYNGGSLMVTATNESVKIYDLKSNDC-IKTITNEK-------NSPFLSLDSLHNMMACGT 118

Query: 278 --SGEDSLIYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
             SG D+ +Y+YD R+ + P+  ++  H D +T + FH  +  +++SG +D    ++DL 
Sbjct: 119 ELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLT 178

Query: 335 QIGQEQT 341
           +  +E +
Sbjct: 179 ETEEEDS 185

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 101/225 (44%), Gaps = 30/225 (13%)

Query: 136 IIATINGDGTVFIYDTSIDENQSNPIIS---KLSHHKENGYGLAFNPLDKGKLLSSSDDG 192
           IIA    +GT+ +Y T    N++N  IS   K   H  +   + FN      L S  ++G
Sbjct: 76  IIAGALDNGTLELYST----NEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNG 131

Query: 193 SVAYWNIQKSI-------PLLTLQETSIINDV---RWNQFNQNLFGYVTESSCLNLKDVR 242
            +  W++ K         PL   Q  S +++V    WNQ   ++F     S+  ++ D++
Sbjct: 132 EIFIWDMNKCTESPSTYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

Query: 243 NNNNDLKIVSNHDIKTPSAFNAMAFSF------HSEYLMAASGED--SLIYLYDTRNLNQ 294
                 K V +    +PS+      S       +S  +  A+G D    I ++D RN N 
Sbjct: 192 AK----KEVIHLSYTSPSSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANT 247

Query: 295 PLHYM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQ 338
           P+  + +GH+  + SLD+   ++ +++S G D  V +W+ +   Q
Sbjct: 248 PMQTLNQGHQKGILSLDWCDQDENLLLSSGRDNTVLLWNPESAEQ 292

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 36/157 (22%), Positives = 70/157 (44%), Gaps = 13/157 (8%)

Query: 189 SDDGSVAYWNIQKS---IPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           S D S+  W++  +    PL +LQ  S  ND+ W+  N+ + G + ++  L L      N
Sbjct: 37  STDSSLELWSLLATDSEKPLASLQVDSKFNDLDWSHNNEIIAGAL-DNGTLELYSTNEAN 95

Query: 246 NDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQ------PLHYM 299
           + +   +     + S+   + F+   + ++A+ G +  I+++D     +      PL   
Sbjct: 96  DTISSTAKFGSHS-SSVKTVKFNARQDNVLASGGNNGEIFIWDMNKCTESPSTYTPLTPG 154

Query: 300 RGHE--DSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
           +     D V SL ++     +  S GS    ++WDLK
Sbjct: 155 QSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 260 SAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLH---YMRGHEDSVTSLDFHALND 316
           S FN + +S H+  ++A + ++  + LY T   N  +        H  SV ++ F+A  D
Sbjct: 63  SKFNDLDWS-HNNEIIAGALDNGTLELYSTNEANDTISSTAKFGSHSSSVKTVKFNARQD 121

Query: 317 GIVISGGSDKRVAVWDLKQIGQEQTS 342
            ++ SGG++  + +WD+ +  +  ++
Sbjct: 122 NVLASGGNNGEIFIWDMNKCTESPST 147

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 100/228 (43%), Gaps = 27/228 (11%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDG 192
           D  IIA     G V ++ ++ D  +S    ++   H+     + FN      L S    G
Sbjct: 73  DDKIIAGALDSGVVELFSSTGDSLKSE---ARFQQHQGAAKTVKFNSKQNNVLASGGSKG 129

Query: 193 SVAYWNIQKSI-------PLLTLQETSIINDV---RWNQFNQNLFGYVTESSCLNLKDVR 242
            +  W++   +       PL     ++ I +V    WNQ   ++F     +S  ++ D++
Sbjct: 130 EIYIWDLNTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGSTSYASIWDLK 189

Query: 243 NNNNDLKIVSNHDIKTPSAFNAMAFSF------HSEYLMAASGEDS--LIYLYDTRNLNQ 294
                 K V +    +PS       S       +S  +  A+G D+  LI ++D RN N 
Sbjct: 190 AK----KEVIHLSYASPSTGLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANT 245

Query: 295 PLHYM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQT 341
           PL  + +GH   + SLD+ + ++ +++S G D  + +W+  + GQE T
Sbjct: 246 PLQVLSKGHSKGILSLDWCSQDEELLLSSGRDNTIVLWN-PESGQELT 292

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 113/248 (45%), Gaps = 31/248 (12%)

Query: 171 NGYGLAFNPLDKGK--LLSSSDDGSVAYWNIQKSIPLLTLQETSI----INDVRW---NQ 221
           N + L   PL  G   LL+S  +G V Y +      L T+Q+ +I    IND++    N 
Sbjct: 16  NNWALKLQPLQHGNNGLLTSLSNGEVHYLDPST---LTTIQKYNISETSINDLQLINHNP 72

Query: 222 FNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGED 281
            +  LF   T +S + + D+ +      I S  ++  PS  +          L    G D
Sbjct: 73  TSSPLFTTATSNS-VKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTEL---KGVD 128

Query: 282 SLIYLYDTRNLNQPLHYM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQ 340
           + IY+YD R  +QP+  +   H D VT L +H  +  I++SG +D    V+DL +  +E 
Sbjct: 129 AAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEED 188

Query: 341 TSDEIEDGDVPELLMIH-AGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLREDP 399
           +  ++ +        IH  G  SP   F++S+        +E   I ++   +++L+E  
Sbjct: 189 SLHQVIN-----FASIHSCGWLSPRRIFTLSH--------METFAIHELNDKSDTLKEPQ 235

Query: 400 LVNMNVIR 407
            ++M  +R
Sbjct: 236 PIDMGDVR 243

>SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|Q750X9 Ashbya gossypii AGL190W
           AGL190Wp and similar to YDR142C uniprot|P39108
           Saccharomyces cerevisiae YDR142C PEX7 May serve as
           intraperoxisomal receptor for type 2 peroxisomal
           proteins (such as thiolase) Member of
           beta-transducin-related (WD- 40) protein family
          Length = 368

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 105/258 (40%), Gaps = 35/258 (13%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           +    GDG++ ++D ++ +      IS    H++  +   +N ++K   +SSS DG+V  
Sbjct: 76  VLAAQGDGSLRLFDINLPQYP----ISIFQEHQKEVFSCNWNLVNKQTFVSSSWDGTVKI 131

Query: 197 WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDI 256
           W+  +   L TL    +                  E S   L + +     L    NH I
Sbjct: 132 WSPMRQESLTTLVPIPM------------------ERS--PLVEAKAGGIPLSNQQNHSI 171

Query: 257 --KTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTR---NLNQPLHYMRGHEDSVTSLDF 311
             K         FS H   L+     +S + L+D R   N NQ      G  +++T  DF
Sbjct: 172 ISKNKDCIYQAQFSPHDPNLIMCCAGNSYVTLFDLRQPTNTNQQNFMSHGGLETLTC-DF 230

Query: 312 HALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSN 371
           +     IV +GG DK V +WDL+ +   + S+ ++    P  +    GH   I   S S 
Sbjct: 231 NKYRPHIVATGGVDKLVKIWDLRMV--RKFSNPLQQ---PMSINEIPGHELAIRKVSWSP 285

Query: 372 NLNWLCASIEEDNIVQVW 389
           + + L  S   D   +VW
Sbjct: 286 HHSNLVLSTSYDMTCRVW 303

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 53/123 (43%), Gaps = 31/123 (25%)

Query: 105 DKHVKS-NIRIIKKFK--------------HELEVTRAHYMPQDSTIIATINGDGTVFIY 149
           DK VK  ++R+++KF               HEL + +  + P  S ++ + + D T  ++
Sbjct: 244 DKLVKIWDLRMVRKFSNPLQQPMSINEIPGHELAIRKVSWSPHHSNLVLSTSYDMTCRVW 303

Query: 150 D-------------TSIDENQSNPIISKLSHHKENGYGLAFNPLDK-GKLLSSSDDGSVA 195
           D              SID  +    I    HH E  +G  ++   + G + S++ DG+V 
Sbjct: 304 DDLSDSNGRPTGKTNSIDPTKGCRFI--FPHHTEFVFGADWSLWGQPGYVASTAWDGNVC 361

Query: 196 YWN 198
            W+
Sbjct: 362 IWH 364

>NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325
          Length = 917

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 97/229 (42%), Gaps = 27/229 (11%)

Query: 130 MPQDSTIIATINGDGTVFIYDTS------IDENQSNPIISKLSHHKENGYGLAFNPLDKG 183
           M Q+     T+N  G    + +S      + E QS   I K   H ++   L ++P D  
Sbjct: 296 MGQNPVNTVTVNSTGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSTNSLTYSP-DGS 354

Query: 184 KLLSSSDDGSVAYWNIQKSIPLLTLQE-TSIINDVRWNQFNQNLF-----GYVTESSCLN 237
           ++++++DDG +  W++     L T  E TS +  V++ +  Q LF     G V     + 
Sbjct: 355 RVVTAADDGKIKVWDVVSGFCLATFTEHTSSVTQVQFAKKGQVLFSSSLDGTVRAWDLIR 414

Query: 238 LKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLH 297
            ++ R      +I           FN +A     E + A S +   I+++  +   Q L 
Sbjct: 415 YRNFRTFTAAERI----------QFNCLAVDPSGEVVCAGSIDSFDIHVWSVQT-GQLLD 463

Query: 298 YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIE 346
            + GHE  V+ L F   N  ++ S   DK V +W +   G+ Q  +  E
Sbjct: 464 TLSGHEGPVSCLSFSQEN-SVLASASWDKTVRIWSI--FGRSQQVEPFE 509

>KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {ON}
           highly similar to uniprot|P25636 Saccharomyces
           cerevisiae YCR057C PWP2 part of small (ribosomal)
           subunit (SSU) processosome (contains U3 snoRNA) Eight
           WD-repeats with homology with G protein beta subunits
           flanked by nonhomologous N-terminal and C-terminal
           extensions regulatory protein
          Length = 915

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 115/260 (44%), Gaps = 35/260 (13%)

Query: 107 HVKSNIRIIK----KFK-HEL---EVTRAHYMPQDSTIIATINGDGTVFIYDTS------ 152
           H KSN+ I+     +F+ +EL    + +   M Q++    ++N  G    + +S      
Sbjct: 265 HAKSNMLIVGFNNGEFRLYELPGFTLLQQLSMGQNAVNAVSVNNTGEWLAFGSSKLGQLL 324

Query: 153 IDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQE-T 211
           + E QS   I K   H +    + ++P D  +++++S+DG +  W++     L+T QE T
Sbjct: 325 VYEWQSESYILKQQGHFDATNAVTYSP-DGSRVVTASEDGKIKIWDVVSGFCLVTFQEHT 383

Query: 212 SIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSA-----FNAMA 266
           S +  + + +  Q LF    + +      VR  N           +T +A     FN +A
Sbjct: 384 SAVTGLAFAKKGQVLFSASLDGTVRAWDLVRYRN----------FRTFTAAERIQFNCLA 433

Query: 267 FSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDK 326
                E + A S +   I+++  +   Q +  + GHE  V+ L F   N  ++ S   DK
Sbjct: 434 ADPSGEVVCAGSVDSFAIHVWSVQT-GQLVETLDGHEGPVSCLSFSRENS-VLASASWDK 491

Query: 327 RVAVWDLKQIGQEQTSDEIE 346
            + VW +   G+ Q  + +E
Sbjct: 492 TIRVWSI--FGRSQQVEPLE 509

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 85/177 (48%), Gaps = 19/177 (10%)

Query: 173 YGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYV 230
           + L   P  K  LL+   +G +    WN  K +  +   ET+I ND++    +      +
Sbjct: 17  WCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQKIRASETAI-NDMKIIDSDFVAGNLI 75

Query: 231 TESSCLNLK--DVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE-----DSL 283
           + +S  ++K  D+R+N+   KI  N++  +P        S  S + + A G      D+ 
Sbjct: 76  SSASIDSVKVFDIRSNDCVAKI--NNETNSP------FLSLDSRHGLLACGTELQGIDAA 127

Query: 284 IYLYDTRNLNQPLHYM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQE 339
           I++YD R  + PL  +   H D VT + FH  +  +++SG +D    ++DLKQ  +E
Sbjct: 128 IHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDDEE 184

>TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {ON}
           Anc_6.325 YCR057C
          Length = 912

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/248 (24%), Positives = 112/248 (45%), Gaps = 23/248 (9%)

Query: 107 HVKSNIRIIK----KFK-HEL---EVTRAHYMPQDSTIIATINGDGTVFIYDTS------ 152
           H KSN+ I+     +F+ +EL    + +   M Q+     ++N  G    + +S      
Sbjct: 260 HAKSNMLIVGFSNGEFRLYELPSFALLQQLSMGQNPVNTVSVNETGEWLAFGSSSLGQLL 319

Query: 153 IDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQE-T 211
           + E QS   I K   H +    L ++P D  ++++SS+DG +  W++     L T +E T
Sbjct: 320 VYEWQSESYILKQQGHFDALNDLTYSP-DGSRVVTSSEDGKIKIWDVVSGFCLATFEEHT 378

Query: 212 SIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHS 271
           S +  V++ +  Q LF    + +      +R  N   +  ++ D      FN +A     
Sbjct: 379 SSVTAVQFAKRGQVLFSASLDGTVRAWDLIRYRN--FRTFTSTD---RIQFNCLAVDPSG 433

Query: 272 EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           E + A S ++  I+++  +   Q L  + GHE  V+ L F   N G++ S   DK + +W
Sbjct: 434 EVVCAGSLDNFEIHVWSVQT-GQLLDTLAGHEGPVSCLAFSQEN-GVLASASWDKTIRIW 491

Query: 332 DLKQIGQE 339
            +    Q+
Sbjct: 492 SIFARSQQ 499

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 99/216 (45%), Gaps = 24/216 (11%)

Query: 136 IIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVA 195
           IIA    +G++ +Y T+ + N +   ++K S+H  +   + FN      L S  ++G + 
Sbjct: 76  IIAGALDNGSLELYSTN-EVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNGEIF 134

Query: 196 YWNIQKSI-------PLLTLQETSIINDV---RWNQFNQNLFGYVTESSCLNLKDVRNNN 245
            W++ K         PL   Q  S +++V    WNQ   ++F     S+  ++ D++   
Sbjct: 135 IWDMNKCTESPANYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKK 194

Query: 246 NDLKIV---SNHDIKTPSAFNAMAFSFH---SEYLMAASGED--SLIYLYDTRNLNQPLH 297
             + +     N  IK           +H   S  +  A+G D    I ++D RN N PL 
Sbjct: 195 EVIHLCYTSPNSGIKQ----QLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQ 250

Query: 298 YM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWD 332
            + +GH+  + SLD+   ++ +++S G D  V +W+
Sbjct: 251 TLNQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 71/159 (44%), Gaps = 17/159 (10%)

Query: 189 SDDGSVAYWNIQKS---IPLLTLQETSIINDVRWNQFNQNLFGYVTESSC--LNLKDVRN 243
           S D S+  W++  S    P+ +LQ  S  ND+ W+  N+ + G +   S    +  +V +
Sbjct: 37  SSDSSLELWSLLASDSEKPIASLQVDSKFNDLDWSHNNKIIAGALDNGSLELYSTNEVND 96

Query: 244 NNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQ-PLHYMR-- 300
             + +   SNH     S+   + F+   + ++A+ G +  I+++D     + P +Y    
Sbjct: 97  AISSMAKFSNHS----SSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTESPANYTPLT 152

Query: 301 -----GHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
                   D V SL ++     +  S GS    ++WDLK
Sbjct: 153 PGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query: 260 SAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYM---RGHEDSVTSLDFHALND 316
           S FN + +S H+  ++A + ++  + LY T  +N  +  M     H  SV ++ F+A  D
Sbjct: 63  SKFNDLDWS-HNNKIIAGALDNGSLELYSTNEVNDAISSMAKFSNHSSSVKTVKFNAKQD 121

Query: 317 GIVISGGSDKRVAVWDLKQI 336
            ++ SGG++  + +WD+ + 
Sbjct: 122 NVLASGGNNGEIFIWDMNKC 141

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 76/159 (47%), Gaps = 10/159 (6%)

Query: 176 AFNPLDKGKLLSSSDDG--SVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTE 232
           AF  +D  K+ ++   G  ++  W+  +S PL  L      I  V++NQ   ++      
Sbjct: 175 AFQGIDHHKVKTTFVTGGPTIQLWDTARSKPLSNLSWGADNITSVKFNQTETDILASTGS 234

Query: 233 SSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNL 292
            + + L DVR N+   KIV    ++T    NA+ ++    +    + ED   Y YD RN+
Sbjct: 235 DNSIVLYDVRTNSPTQKIVQR--LRT----NAICWNPMEAFNFVTANEDHNAYYYDMRNM 288

Query: 293 NQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           ++ L+  + H  +V  +DF    D IV +G  DK + ++
Sbjct: 289 SRALNVFKDHVSAVMDVDFAPTGDEIV-TGSYDKTIRIF 326

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 43/203 (21%), Positives = 91/203 (44%), Gaps = 25/203 (12%)

Query: 151 TSIDENQSNPIISKLSH-HKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQ 209
           T ++   + P + +L + H++  Y +A +  D  K+ S S DG + YWN+     + + +
Sbjct: 48  TKLERVFAKPFVGQLGYGHRDGVYVIAKDYHDLNKVASGSGDGVIKYWNMSSRDEICSFK 107

Query: 210 E-----TSIINDVRWNQFNQNLFGYVTESSCLNLKDVR---NNNNDLKIVSNHDIKTPSA 261
                 T +    + +  N++    +   SC + K V+    N +D   V   D +  ++
Sbjct: 108 AHYGLITGLCVSPQRSPLNRDQHFML---SCGDDKTVKLWSMNGDDFANVK--DDQNLNS 162

Query: 262 FNAMAFSFHSEYLMAASGEDSL----------IYLYDTRNLNQPLHYMRGHEDSVTSLDF 311
            + +  +F+ E+         +          I L+DT   ++PL  +    D++TS+ F
Sbjct: 163 QDGLLKTFYGEHAFQGIDHHKVKTTFVTGGPTIQLWDTAR-SKPLSNLSWGADNITSVKF 221

Query: 312 HALNDGIVISGGSDKRVAVWDLK 334
           +     I+ S GSD  + ++D++
Sbjct: 222 NQTETDILASTGSDNSIVLYDVR 244

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 102/222 (45%), Gaps = 24/222 (10%)

Query: 136 IIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVA 195
           IIA    +G++ +Y T+   N  N  +++ S+H  +   + FN      L S  ++G + 
Sbjct: 76  IIAGALDNGSLELYSTNEANNAIN-SMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIF 134

Query: 196 YWNIQKSI-------PLLTLQETSIINDV---RWNQFNQNLFGYVTESSCLNLKDVRNNN 245
            W++ K         PL   Q  S +++V    WNQ   ++F     S+  ++ D++   
Sbjct: 135 IWDMNKCTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFASAGSSNFASIWDLKAK- 193

Query: 246 NDLKIVSNHDIKTPSAFNAMAFSF------HSEYLMAASGED--SLIYLYDTRNLNQPLH 297
              K V +    +P++      S       +S  +  A+G D    I ++D RN N PL 
Sbjct: 194 ---KEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQ 250

Query: 298 YM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQ 338
            + +GH+  + SLD+   ++ +++S G D  V +W+ +   Q
Sbjct: 251 TLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWNPESAEQ 292

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 70/159 (44%), Gaps = 17/159 (10%)

Query: 189 SDDGSVAYWNIQKS---IPLLTLQETSIINDVRWNQFNQNLFGYVTESSC--LNLKDVRN 243
           S D S+  W++  +    P+ +LQ  S  ND+ W+  N+ + G +   S    +  +  N
Sbjct: 37  STDSSLELWSLLAADSEKPIASLQVDSKFNDLDWSHNNKIIAGALDNGSLELYSTNEANN 96

Query: 244 NNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQ-PLHYMR-- 300
             N +   SNH     S+   + F+   + ++A+ G +  I+++D     + P +Y    
Sbjct: 97  AINSMARFSNHS----SSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTESPSNYTPLT 152

Query: 301 -----GHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
                   D V SL ++     +  S GS    ++WDLK
Sbjct: 153 PGQSMSSVDEVISLAWNQSLAHVFASAGSSNFASIWDLK 191

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query: 260 SAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYM---RGHEDSVTSLDFHALND 316
           S FN + +S H+  ++A + ++  + LY T   N  ++ M     H  SV ++ F+A  D
Sbjct: 63  SKFNDLDWS-HNNKIIAGALDNGSLELYSTNEANNAINSMARFSNHSSSVKTVKFNAKQD 121

Query: 317 GIVISGGSDKRVAVWDLKQI 336
            ++ SGG++  + +WD+ + 
Sbjct: 122 NVLASGGNNGEIFIWDMNKC 141

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 93/212 (43%), Gaps = 29/212 (13%)

Query: 173 YGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIINDVR--WNQFNQNLFG 228
           + L   P  K  LL+   +G +    W+  KS+  +   ET+I ND++   + F+     
Sbjct: 17  WCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKASETAI-NDMKVIGSDFSAGHLV 75

Query: 229 YVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE-----DSL 283
                  + + D+R N+   +I +          N+   S  S + + A G      D+ 
Sbjct: 76  SSASIDAVKVFDIRTNDRIAQIQNEA--------NSPFISLDSRHGLLACGTELQGIDAA 127

Query: 284 IYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTS 342
           +Y+YD R  + PL   +  H D VT + FH  +  I++SG +D    ++DLKQ       
Sbjct: 128 VYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ------- 180

Query: 343 DEIEDG--DVPELLMIH-AGHRSPINDFSMSN 371
           DE ED    V     IH  G  SP   F++S+
Sbjct: 181 DEEEDALHQVINYASIHSCGWLSPKRIFTLSH 212

>KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.340
           YCR072C
          Length = 515

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/302 (22%), Positives = 128/302 (42%), Gaps = 72/302 (23%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D  IIAT + D T+ ++++    ++  P+   L  H +    L++ PL      +K +L 
Sbjct: 197 DGEIIATGSMDNTIRLWES----DRGKPLGEPLRGHLKWITSLSWEPLHLVKAGEKPRLA 252

Query: 187 SSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQ---------------FNQNLFGYV 230
           S+S DG++  W+  + + + TL   T+ ++ V+W                 ++ NL G  
Sbjct: 253 SASKDGTIKIWDTVRRVCVYTLSGHTNSVSCVKWGGQGVLYSGSHDKTVRVWDMNLGG-- 310

Query: 231 TESSCLN-LKDVRNNNNDLKIVSNHDIK------------TPSAFNAMAFSFH------- 270
               C+N LK+  +  N L + +++ ++            +P      A   +       
Sbjct: 311 ---KCINILKNHAHWVNHLSLSTDYALRRGPFDHTGTKMASPEEAREKALKNYEKVVKKN 367

Query: 271 --SEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKR 327
             +E LM  + +D  ++L++    N+PL  M GH+  V  + F    DG  ++S   D  
Sbjct: 368 GTTEELMVTASDDFTMFLWNPLKSNKPLARMTGHQKLVNHVAFSP--DGRYIVSASFDNS 425

Query: 328 VAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQ 387
           + +WD +            DG   + L    GH S +   + S++   L  S  +D  ++
Sbjct: 426 IKLWDGR------------DG---KFLSTFRGHVSSVYQVAWSSDCR-LLVSCSKDTTLK 469

Query: 388 VW 389
           VW
Sbjct: 470 VW 471

 Score = 36.6 bits (83), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 75/156 (48%), Gaps = 25/156 (16%)

Query: 185 LLSSSDDGSVAYWNIQKS-IPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           ++++SDD ++  WN  KS  PL  +     ++N V ++   +    Y+  +S        
Sbjct: 374 MVTASDDFTMFLWNPLKSNKPLARMTGHQKLVNHVAFSPDGR----YIVSASF------- 422

Query: 243 NNNNDLKIVSNHDIKTPSAFNA-------MAFSFHSEYLMAASGEDSLIYLYDTRNLNQP 295
             +N +K+    D K  S F         +A+S     L++ S +D+ + ++D R     
Sbjct: 423 --DNSIKLWDGRDGKFLSTFRGHVSSVYQVAWSSDCRLLVSCS-KDTTLKVWDVRTRKLS 479

Query: 296 LHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           +  + GH+D V ++D+ +++   V SGG DK + +W
Sbjct: 480 VD-LPGHQDEVYTVDW-SVDGKRVCSGGKDKMIRLW 513

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 66/140 (47%), Gaps = 8/140 (5%)

Query: 197 WNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHD 255
           W+  +S P   L      ++ V++NQ   ++F      + + L D+R N+   K      
Sbjct: 198 WDSSRSRPTANLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQKFTQR-- 255

Query: 256 IKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALN 315
           ++T    NA+ ++    Y    + ED   Y YD RNL++ LH  + H  +V  +DF    
Sbjct: 256 MRT----NALCWNPMEAYNFVVASEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTG 311

Query: 316 DGIVISGGSDKRVAVWDLKQ 335
           D IV +G  DK + ++ +K 
Sbjct: 312 DEIV-TGSYDKTIRIYQVKH 330

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 88/217 (40%), Gaps = 53/217 (24%)

Query: 151 TSIDENQSNPIISKLSH-HKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQ 209
           T ++   + P I +L + H++  Y +A N     KL S+S DG V YWN+     + + +
Sbjct: 48  TKMERMFAKPFIGQLGYGHRDGVYTIAKNYHALNKLASASADGVVKYWNMSTREEICSFK 107

Query: 210 ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKT----------- 258
                            +G V    C+  + +  N N+  ++S  D KT           
Sbjct: 108 AH---------------YGLV-HGLCVTPQHLSANKNENYMLSCGDDKTVKLWSVNTEDF 151

Query: 259 --------PSAFNAMAFSFHSE-------------YLMAASGEDSLIYLYDTRNLNQPLH 297
                    S+ + +  +FH +             Y + A  E   I L+D+ + ++P  
Sbjct: 152 SSSKNDEEQSSTDGLIKTFHGDYAFLGIDHHRSKPYFVTAGAE---INLWDS-SRSRPTA 207

Query: 298 YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
            +    D+V+++ F+     I  S GSD  V ++DL+
Sbjct: 208 NLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLR 244

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 74/181 (40%), Gaps = 7/181 (3%)

Query: 154 DENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSI 213
           D ++S P  + LS   +N   + FN  +     S+  D SV  ++++ + P     +   
Sbjct: 199 DSSRSRPT-ANLSWGADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQKFTQRMR 257

Query: 214 INDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEY 273
            N + WN      F   +E       D+RN +  L +  +H     SA   + FS   + 
Sbjct: 258 TNALCWNPMEAYNFVVASEDHNAYYYDMRNLSRALHVFKDH----VSAVMDVDFSPTGDE 313

Query: 274 LMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL 333
           ++  S  D  I +Y  ++ +    Y       V  + + +++   ++SG  D  + +W  
Sbjct: 314 IVTGS-YDKTIRIYQVKHGHSREVYHTKRMQHVFQVKY-SMDSKYIMSGSDDGNIRMWRA 371

Query: 334 K 334
           K
Sbjct: 372 K 372

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 65/299 (21%), Positives = 119/299 (39%), Gaps = 66/299 (22%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D   IAT + D TV ++D+   +    P+   L  H++    L + PL      DK +L 
Sbjct: 197 DGETIATGSMDCTVRLWDSKAGQ----PLGDALKGHQKWITSLVWEPLHLVKPGDKPRLA 252

Query: 187 SSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           S+S DG++  W+  + + + TL   T+ ++ V+W    Q L    +    + + D+    
Sbjct: 253 SASKDGTIKIWDTSRRVCIYTLSGHTNSVSCVKWG--GQGLLYSGSHDKTVRVWDMNVGG 310

Query: 246 NDLKIVSNH-------DIKTPSA-----FNAMAFSFHS---------------------- 271
             + I+ +H        + T  A     F+  A  F S                      
Sbjct: 311 KCINILKSHAHWVNHLSLSTEYALRVGPFDHTATKFTSAEEARKKALENYEKIAKRNGKA 370

Query: 272 EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKRVAV 330
           E L+  + +D  ++L+D     +PL  + GH+  V  + F    DG  ++S   D  + +
Sbjct: 371 EELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAFSP--DGRFIVSASFDNSIKL 428

Query: 331 WDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
           WD    G+  T            +    GH + +   + S++   L  S  +D  ++VW
Sbjct: 429 WD----GRNGT-----------FISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 471

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 84/196 (42%), Gaps = 55/196 (28%)

Query: 136 IIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVA 195
           +I T + D T+F++D +    +S   +++L+ H++    +AF+P D   ++S+S D S+ 
Sbjct: 373 LIVTASDDFTMFLWDPT----KSGKPLARLTGHQKLVNHVAFSP-DGRFIVSASFDNSIK 427

Query: 196 YWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHD 255
            W                  D R   F     G+V                         
Sbjct: 428 LW------------------DGRNGTFISTFRGHV------------------------- 444

Query: 256 IKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALN 315
               ++   +A+S     L++ S +D+ + ++D R     +  + GH+D V ++D+ +++
Sbjct: 445 ----ASVYQVAWSSDCRLLVSCS-KDTTLKVWDVRTRKLSVD-LPGHKDEVYTVDW-SVD 497

Query: 316 DGIVISGGSDKRVAVW 331
              V SGG DK V +W
Sbjct: 498 GKRVCSGGKDKMVRLW 513

>CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P39108 Saccharomyces cerevisiae
           YDR142c PAS7 peroxisomal import protein -peroxin
          Length = 369

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 90/224 (40%), Gaps = 26/224 (11%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           +    GDG++ ++DT++   Q  PI     H KE  Y   +N + K   +SSS DG V  
Sbjct: 76  VVVAQGDGSLRLFDTTL---QKFPIAMFHEHSKEV-YSCNWNLVSKSNFVSSSWDGQVKI 131

Query: 197 WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDI 256
           W+  +   L+T     I  DV                +  NL +V   +   K+  N   
Sbjct: 132 WSPNRKASLITFSPHPI--DV--------------SRALDNLPEVSQRD---KLSPNQVA 172

Query: 257 KTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRN--LNQPLHYMRGHEDSVTSLDFHAL 314
           +  +      FS H + L+     +S + L+D R    N   +++        S DF+  
Sbjct: 173 QNRNCIYQATFSPHDDNLILCCAGNSYVTLFDLRQNPGNNQKNFIAHRGKGALSCDFNKY 232

Query: 315 NDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGD-VPELLMIH 357
              I+ + G D  + +WD++ +         + G  V E++  H
Sbjct: 233 RPNIIATSGVDNSIGIWDIRMLPNSSNQQGFQTGTLVNEIVNAH 276

>ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 371

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 89/210 (42%), Gaps = 28/210 (13%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           +    GDGT+ ++DT + +      I+  + H++  +   +N + K   +SSS DG+V  
Sbjct: 76  VLVAQGDGTLRLFDTKLKQYP----IAIFNEHQKEVFSCNWNLVGKQNFVSSSWDGAVKI 131

Query: 197 WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLK-DVRNNNNDLKIVSNHD 255
           W+ Q+   LLT+    +                V+  +C   +  + N      I  N +
Sbjct: 132 WSPQRKESLLTVVPRPMD---------------VSTMACAGPQVPMSNQKGHADIAKNKN 176

Query: 256 IKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLH---YMRGHEDSVTSLDFH 312
                 + A+ FS H   L+     +S + L+D+R    P +   ++        + DF+
Sbjct: 177 C----IYQAL-FSPHDPNLVMCCSGNSYVTLFDSRQPPTPANQKSFLAHSGLEALTCDFN 231

Query: 313 ALNDGIVISGGSDKRVAVWDLKQIGQEQTS 342
                 +++GG D  + +WDL+ +G    S
Sbjct: 232 KYRPHSLVTGGVDNCIRIWDLRMVGPSAAS 261

>NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {ON}
           Anc_6.325
          Length = 915

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 101/233 (43%), Gaps = 30/233 (12%)

Query: 130 MPQDSTIIATINGDGTVFIYDTS------IDENQSNPIISKLSHHKENGYGLAFNPLDKG 183
           M Q+      +N  G    + +S      + E QS   I K   H +    L ++P D  
Sbjct: 298 MGQNPINTVAVNSSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNSLTYSP-DGS 356

Query: 184 KLLSSSDDGSVAYWNIQKSIPLLTLQE-TSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           +++++++DG +  W++     L T QE TS +  V++ +  Q LF    + +      +R
Sbjct: 357 RVVTAAEDGKIKVWDVVSGFCLATFQEHTSSVTQVQFAKRGQVLFSSSLDGTVRAWDLIR 416

Query: 243 NNNNDLKIVSNHDIKTPSA-----FNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLH 297
             N           +T +A     FN +A     E + A S ++  I+++  +   Q L 
Sbjct: 417 YRN----------FRTFTAAERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQT-GQLLD 465

Query: 298 YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDV 350
            + GHE  V+ L F   N  ++ S   DK V VW +   G+ Q   ++E  DV
Sbjct: 466 TLSGHEGPVSCLAFSQEN-SVLASASWDKTVRVWSI--FGRSQ---QVEPFDV 512

>CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highly
           similar to uniprot|P25635 Saccharomyces cerevisiae
           YCR057c PWP2 periodic tryptophan protein
          Length = 911

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 54/255 (21%), Positives = 111/255 (43%), Gaps = 25/255 (9%)

Query: 107 HVKSNIRIIK----KFK----HELEVTRAHYMPQDSTIIATINGDGTVFIYDTS------ 152
           H+ SN+ I+     +F+     E  + +   M Q+     ++N  G    + +S      
Sbjct: 265 HINSNLLIVGFSNGEFRLYEMPEFVMVQQLSMGQNPVNTVSVNNSGEWLAFGSSKLGQLL 324

Query: 153 IDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQE-T 211
           + E QS   I K   H +    L ++P D  +++++++DG +  W++     L T +E T
Sbjct: 325 VYEWQSESYILKQQGHFDATNSLTYSP-DGSRVVTAAEDGKIKVWDVASGFCLATFEEHT 383

Query: 212 SIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHS 271
           S +  V++ +  Q LF    + +      +R  N  +   +         F  +A     
Sbjct: 384 SAVTAVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTATER-----VQFTCLAVEPSG 438

Query: 272 EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           E + A S +   ++++  +   Q L  + GHE  V+ L F ++ + ++ S   DK + +W
Sbjct: 439 EVVSAGSTDSFDVFVWSVQT-GQLLDTLSGHEGPVSCLAF-SMENAVLASASWDKTIRIW 496

Query: 332 DLKQIGQEQTSDEIE 346
            +   G+ Q  + +E
Sbjct: 497 SI--FGRSQQVEPLE 509

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 83/175 (47%), Gaps = 19/175 (10%)

Query: 171 NGYGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIINDVRWN--QFNQNL 226
           N + L   P+    LL+S  +G V    W   KSI  +    TS+ + V  N  + N +L
Sbjct: 33  NNWCLKLQPIYNSGLLTSLSNGRVELIDWATHKSILQIQTHATSVNDMVIINNDRMNGSL 92

Query: 227 FGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAA-----SGED 281
                E + + + D+++N+  +  + N         +A   S  S + +       SG D
Sbjct: 93  IATAAEDA-VKIYDLKSNDC-VATLKN-------GKSAPFLSLDSRHGLLGCGTELSGVD 143

Query: 282 SLIYLYDTRNLNQPLHYM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQ 335
           + +++YD R+  QPL  +   H D +TS+ FH  +  +++SG +D  V ++DL Q
Sbjct: 144 AELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQ 198

>KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {ON}
           Anc_6.325 YCR057C
          Length = 906

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 92/204 (45%), Gaps = 16/204 (7%)

Query: 144 GTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSI 203
           G + +Y     E QS   I K   H ++   L ++P D  +++++++DG +  W++    
Sbjct: 320 GQLLVY-----EWQSESYILKQQGHFDSTNSLTYSP-DGSRVVTAAEDGKIKVWDVVSGF 373

Query: 204 PLLTLQE-TSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAF 262
            L T +E TS +  V++ +  Q LF    + +      +R  N  +   +         F
Sbjct: 374 CLATFEEHTSSVTQVQFAKKGQVLFSASLDGTVRAWDLIRYRNFRVFTAAER-----IQF 428

Query: 263 NAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISG 322
           N++A     E + A S +   I+++  +   Q L  + GHE  ++ L F   N  I+ S 
Sbjct: 429 NSLAVDPSGEVVCAGSVDSFDIHVWSVQT-GQLLDTLAGHEGPISCLAFSQENS-ILASA 486

Query: 323 GSDKRVAVWDLKQIGQEQTSDEIE 346
             DK + +W +   G+ Q  + IE
Sbjct: 487 SWDKTIRIWSI--FGRSQQVEPIE 508

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 86/177 (48%), Gaps = 19/177 (10%)

Query: 173 YGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIIN-DVRWNQF-NQNLFG 228
           + L   PL    LL+S  +G +    W   + I        SI N  V  N+F N +LF 
Sbjct: 16  WCLQLQPLYNRGLLTSLSNGHIHLVDWCTGEIIHEFAAHSASISNLKVLNNEFTNSDLFA 75

Query: 229 YVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAA-----SGEDSL 283
             ++ S + + DVR ++    + + H+ K+     A   S  S + M A     SG D+ 
Sbjct: 76  SASKDS-VKIFDVRTSSC---VATLHNDKS-----APFLSLDSRHDMLACGTELSGVDAE 126

Query: 284 IYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQE 339
           +++YD + L++PL  ++  H D +T   FH  + G+++SG +D  V ++DL    +E
Sbjct: 127 LHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTNSDEE 183

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 48/173 (27%), Positives = 83/173 (47%), Gaps = 19/173 (10%)

Query: 173 YGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSI-INDVRW--NQFN-QNLFG 228
           + L F PL    LL+S  +G V   + +   P+   +   + IN ++   N +N  +LF 
Sbjct: 16  WCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINSMKLINNDYNNASLFA 75

Query: 229 YVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE-----DSL 283
             T +S + + D+++N  D      +D K+P        S  S + M A G      D+ 
Sbjct: 76  TATLNS-VKIYDIKSN--DCIATITNDKKSP------FLSLDSRHDMLACGTELQGVDAE 126

Query: 284 IYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQ 335
           +Y+YD RN + P+  ++  H D +T + FH  +   ++SG +D    V+DL Q
Sbjct: 127 LYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQ 179

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 143 DGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDG 192
           D  ++IYD     N S+P+ S +  H ++   + F+P D   LLS S DG
Sbjct: 124 DAELYIYDV---RNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDG 170

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/241 (23%), Positives = 101/241 (41%), Gaps = 34/241 (14%)

Query: 177 FNPLDKGKLLSSSDDGSVAYWNIQKS--IPLLTLQETSIINDVRWNQFNQNLFGYVTESS 234
           +N +D   ++SSS D +   W++Q S  +    +   S + DVR+   +  LF       
Sbjct: 251 WNMVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDG 310

Query: 235 CLNLKDVRNNNNDLKIVS---------NHDIKTPSAFNAMAF------SFHSEYLMAASG 279
            + + D+R+  +   I           N D  TP++  + A        +    L   + 
Sbjct: 311 SVRVFDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFAA 370

Query: 280 EDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQE 339
           E + I + D RN   P+  + GH  SV  + +H     +++S G D +V  WDL     E
Sbjct: 371 ESNKIIILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDLNNSFME 430

Query: 340 ------------QTSDEIEDGD--VPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNI 385
                         S +  DGD  +P+ +     H+ P+   S++NN   +C ++E  N+
Sbjct: 431 INGAGSKSLSASSASLQDSDGDAVMPDGVAGSNLHQDPL---SLNNNEKQICKTLETPNM 487

Query: 386 V 386
           +
Sbjct: 488 M 488

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 5/79 (6%)

Query: 126 RAHYMPQDSTIIATINGDG-TVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGK 184
           R    P D  ++AT   +   + I D     N  +PI++ L  H  +   + ++P  +  
Sbjct: 354 RLEPSPYDPNVLATFAAESNKIIILDM---RNPESPILN-LEGHSSSVNEIKWHPTKRNV 409

Query: 185 LLSSSDDGSVAYWNIQKSI 203
           LLS  DD  V YW++  S 
Sbjct: 410 LLSCGDDCQVLYWDLNNSF 428

>AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR057C (PWP2)
          Length = 922

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 100/229 (43%), Gaps = 27/229 (11%)

Query: 130 MPQDSTIIATINGDGTVFIYDTS------IDENQSNPIISKLSHHKENGYGLAFNPLDKG 183
           M Q++     +N  G    + +S      + E QS   I K   H +    LA++P D  
Sbjct: 311 MGQNAVNTVAVNRSGEWLAFGSSTLGQLLVYEWQSESYILKQQGHFDALNALAYSP-DGA 369

Query: 184 KLLSSSDDGSVAYWNIQKSIPLLTLQE-TSIINDVRWNQ-----FNQNLFGYVTESSCLN 237
           +++++++DG +  W+I     L T +E TS +  V++ +     F+ +L G V     + 
Sbjct: 370 RIVTAAEDGKIKIWDIVSGFCLATFEEHTSSVTSVQFAKNGQIMFSSSLDGTVKAWDLMR 429

Query: 238 LKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLH 297
            ++ R      +I           F+ +A     E + A S ++  I ++  +   Q L 
Sbjct: 430 FRNFRTFTATERI----------QFSCLAADPTGEVVCAGSLDNYDIQVWSVQT-GQLLD 478

Query: 298 YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIE 346
            + GHE  V+ L F   N  I+ S   DK + VW +   G+ Q  + IE
Sbjct: 479 TLSGHEGPVSCLSFSREN-SILASASWDKTIRVWSI--FGRSQQVEPIE 524

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 66/302 (21%), Positives = 123/302 (40%), Gaps = 72/302 (23%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D  +IAT + D T+ ++ +   EN  +     L  H +    L++ P+      DK +L 
Sbjct: 196 DGELIATGSMDNTIRLWQSEKGENFGD----ALRGHSKWITSLSWEPIHLVKPGDKPRLA 251

Query: 187 SSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWN---------------QFNQNLFGYV 230
           S+S DG++  W+  + + L TL   T+ ++ V+W                 ++ N  G  
Sbjct: 252 SASKDGTIKIWDTARRVCLFTLSGHTNSVSCVKWGGRGVLYSGSHDKTIRAWDMNAGG-- 309

Query: 231 TESSCLN-LKDVRNNNNDLKIVSNHDIK------------TPSAFNAMAFSFHS------ 271
               C+N LK   +  N L + +++ ++            +P    A A   +       
Sbjct: 310 ---KCINILKSHAHWINHLSLSTDYALRVGAFDHTGKKPSSPEEARAKALENYEKIAKKN 366

Query: 272 ---EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKR 327
              E LM  + +D  +YL+D     +P+  M GH+  V  + F    DG  ++S   D  
Sbjct: 367 GKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKLVNHVAFSP--DGRYIVSASFDNS 424

Query: 328 VAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQ 387
           + +WD    G++ T            +    GH + +   + S++   L  S  +D  ++
Sbjct: 425 IKLWD----GRDGT-----------FIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLK 468

Query: 388 VW 389
           VW
Sbjct: 469 VW 470

>TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa]
           {ON} Anc_6.325 YCR057C
          Length = 901

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 100/224 (44%), Gaps = 17/224 (7%)

Query: 130 MPQDSTIIATINGDGTVFIYDTS------IDENQSNPIISKLSHHKENGYGLAFNPLDKG 183
           M Q+     +IN  G    + +S      + E QS   I K   H ++   L ++P D  
Sbjct: 288 MGQNPVNTVSINSSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSLNALTYSP-DGS 346

Query: 184 KLLSSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           +++++++DG +  W++     L+TL+  TS +  V++ +  Q LF    + +      +R
Sbjct: 347 RVVTAAEDGKIKVWDVISGFCLVTLEGHTSSVTAVQFAKRGQVLFSASLDGTVRAWDLIR 406

Query: 243 NNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGH 302
             N  +   +         FN +A     E + A S +   I+++  +  +Q L  + GH
Sbjct: 407 YRNFRVFTAAER-----IQFNCLAVDPSGECVCAGSVDSFDIHVWSVQT-SQLLDTLSGH 460

Query: 303 EDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIE 346
           E  V+ L F   N  ++ S   DK + +W +   G+ Q  + I+
Sbjct: 461 EGPVSCLSFSQEN-SVLASASWDKTIRIWSI--FGRSQQVEPID 501

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/302 (21%), Positives = 124/302 (41%), Gaps = 72/302 (23%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D  +IAT + D T+ +++     N+  P+   L  H +    L++ P+       K +L 
Sbjct: 197 DGELIATGSMDNTIRLWEG----NKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPRLA 252

Query: 187 SSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWN---------------QFNQNLFGYV 230
           S+S DG++  W+  + + L+TL   TS ++ ++W                 ++ NL G  
Sbjct: 253 SASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGGQGVLYSGSHDKTIRAWDMNLGG-- 310

Query: 231 TESSCLN-LKDVRNNNNDLKIVSNHDIK------------TPSAFNAMAFSFHS------ 271
               C+N LK   +  N L + +++ ++            TP      A   +       
Sbjct: 311 ---KCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQKRALKNYEKIAKRN 367

Query: 272 ---EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGI-VISGGSDKR 327
              E LM  + +D  +YL++     +P+  M GH+  V  + F    DG  ++S   D  
Sbjct: 368 GEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSP--DGRHIVSASFDNS 425

Query: 328 VAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQ 387
           + +W+ +            DG   + +    GH + +   + S++   L  S  +D  ++
Sbjct: 426 IKLWNGR------------DG---KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLK 469

Query: 388 VW 389
           VW
Sbjct: 470 VW 471

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 75/149 (50%), Gaps = 11/149 (7%)

Query: 185 LLSSSDDGSVAYWNIQKSIPLLTLQ--ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           ++++SDD ++  WN  KS   +T       ++N V ++   +++     ++S + L    
Sbjct: 374 MVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSPDGRHIVSASFDNS-IKLW--- 429

Query: 243 NNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGH 302
            N  D K +S       S +  +A+S     L++ S +D+ + ++D +     +  + GH
Sbjct: 430 -NGRDGKFISTFRGHVASVYQ-VAWSSDCRLLVSCS-KDTTLKVWDVKTKKLAVD-LPGH 485

Query: 303 EDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           +D V ++D+ +++   V SGG DK V +W
Sbjct: 486 KDEVYTVDW-SVDGKRVCSGGKDKMVRLW 513

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/299 (20%), Positives = 115/299 (38%), Gaps = 66/299 (22%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D  +IAT + D T+ ++++        P    +  H +    L + PL      DK +L 
Sbjct: 197 DGELIATGSMDNTIRLWES----KAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLA 252

Query: 187 SSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           S+S DG++  W+  +   L TL   T+ ++ V+W    Q L    +    + + D++   
Sbjct: 253 SASKDGTIKIWDASRRTCLYTLSGHTNSVSCVKWG--GQGLLYTGSHDKTIRVWDIKAGG 310

Query: 246 NDLKIVSNH-------DIKTPSAFNAMAF---------------------------SFHS 271
             + I+ +H        + T  A     F                           S   
Sbjct: 311 KCINILKSHAHWVNHLSLSTDYAIRVGPFGPDGKASPSPQEARDIAKKNYEKVVRKSGQV 370

Query: 272 EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKRVAV 330
           E LM  + +D  ++L++     +PL  M GH+  V  + F    DG  ++S   D  + +
Sbjct: 371 EELMVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAFSP--DGRYIVSASFDNSIKL 428

Query: 331 WDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
           WD +            DG   + +    GH + +   + S++   L  S  +D  ++VW
Sbjct: 429 WDGR------------DG---KFIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 471

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 78/151 (51%), Gaps = 15/151 (9%)

Query: 185 LLSSSDDGSVAYWNIQKSI-PLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           ++++SDD ++  WN  KS  PL  +     ++N V ++   + +     ++S + L D R
Sbjct: 374 MVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAFSPDGRYIVSASFDNS-IKLWDGR 432

Query: 243 NNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYD--TRNLNQPLHYMR 300
               D K ++       S +  +A+S     L++ S +D+ + ++D  TR L+  L    
Sbjct: 433 ----DGKFIATFRGHVASVYQ-VAWSSDCRLLVSCS-KDTTLKVWDVKTRKLSVDLP--- 483

Query: 301 GHEDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           GH+D V ++D+ +++   V SGG DK V +W
Sbjct: 484 GHQDEVYTVDW-SVDGQRVCSGGKDKMVRLW 513

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/297 (21%), Positives = 121/297 (40%), Gaps = 62/297 (20%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D  +IAT + D T+ ++D++  E+        L  H +    L + P+      D+ +L 
Sbjct: 196 DGELIATGSMDNTIRLWDSNKGESYGE----ALRGHAKWITSLTWEPMHLVKAGDQPRLA 251

Query: 187 SSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFG----------YVTESSC 235
           S+S DG++  W+  + + +LTL   T+ ++ V+W        G                C
Sbjct: 252 SASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKWGGRGILYSGSHDKTIRAWDMAAGGKC 311

Query: 236 LN-LKDVRNNNNDLKIVSNHDIK------------TPSAFNAMAFSFHS---------EY 273
           +N LK   +  N L + +++ ++            +P    A A   +          E 
Sbjct: 312 INILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEEARAKALKNYEKIAKKNGQLEE 371

Query: 274 LMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKRVAVWD 332
           LM  + +D  +YL+D    ++P+  M GH+  V  + F    DG  ++S   D  + +WD
Sbjct: 372 LMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFSP--DGRYIVSASFDNSIKLWD 429

Query: 333 LKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
               G+  T            +    GH + +   + S++   L  S  +D  ++VW
Sbjct: 430 ----GRNGT-----------FIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 470

>KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa]
           {ON} Anc_8.316 YDR142C
          Length = 372

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/263 (22%), Positives = 102/263 (38%), Gaps = 39/263 (14%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           +    GDG++ ++DT++ +      I   + H+   +  ++N + K    SSS DG+V  
Sbjct: 76  VLVAQGDGSLRLFDTTLKDYP----IEIFNEHEREVFSCSWNLITKNTFTSSSWDGTVKI 131

Query: 197 WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDI 256
           W+  +   LLTL                             LK ++N +     +SN   
Sbjct: 132 WSPLRKASLLTLVPHP-------------------------LKVMKNFDQVDIPISNQKA 166

Query: 257 KTPSAFNA-----MAFSFHSEYLMAASGEDSLIYLYDTRNL----NQPLHYMRGHEDSVT 307
            T  + N        FS H   L+     +S   L+D R      NQ   +     +++T
Sbjct: 167 HTAISKNKNCIYQAQFSPHDPNLVICCAGNSYTTLFDLRQPSTSNNQQNFFSHSGLEALT 226

Query: 308 SLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDF 367
             DF+     IV +GG D  + +WDL+ + ++  +    D  +  +  I  GH   +   
Sbjct: 227 -CDFNKYRPNIVATGGVDNTIRIWDLRMLSKQFQAGTQRDNSIMCVNEIKKGHELAVRKV 285

Query: 368 SMSNNLNWLCASIEEDNIVQVWK 390
           S S + +    S   D    VW+
Sbjct: 286 SWSPHSSTTLLSTSYDMTCCVWQ 308

>Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa]
           {ON} YCR057C (PWP2) - regulatory protein [contig 16]
           FULL
          Length = 913

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 100/229 (43%), Gaps = 27/229 (11%)

Query: 130 MPQDSTIIATINGDGTVFIYDTS------IDENQSNPIISKLSHHKENGYGLAFNPLDKG 183
           M Q++     +N  G    + +S      + E QS   I K   H +    + ++P D  
Sbjct: 296 MGQNAVNTVCVNDSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDATNAVTYSP-DGS 354

Query: 184 KLLSSSDDGSVAYWNIQKSIPLLTLQE-TSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           +++++S+DG +  W++     L+T QE T+ ++ + + +  Q LF    + +      VR
Sbjct: 355 RVVTASEDGKIKIWDVVSGFCLVTFQEHTAAVSALAFAKRGQVLFSASLDGTVRAWDLVR 414

Query: 243 NNNNDLKIVSNHDIKTPSA-----FNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLH 297
             N           +T +A     FN +A     E + A S +   ++++  +   Q + 
Sbjct: 415 YRN----------FRTFTAAERIQFNCLAADPSGEVVCAGSVDSFAVHVWSVQT-GQLVE 463

Query: 298 YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIE 346
            + GHE  V+ L F   N  ++ S   DK + +W +   G+ Q  + +E
Sbjct: 464 TLDGHEGPVSCLSFSQEN-SVLASASWDKTIRIWSI--FGRSQQVEPLE 509

>TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {ON}
           Anc_8.316 YDR142C
          Length = 367

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 86/214 (40%), Gaps = 30/214 (14%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           +    GDG++ ++DT + +      I+    H++  +   +N L+K   +SSS DG+V  
Sbjct: 76  VLVAQGDGSLRLFDTKLAQYP----IAIFKEHQKEVFSCNWNLLNKNTFVSSSWDGTVKI 131

Query: 197 WNIQKSIPLLTL--QETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNH 254
           W+  +   LLTL  Q    +N V                  +N+  + N  N   I  N 
Sbjct: 132 WSPTRKDSLLTLTPQPLKTVNRV---------------DHSMNIP-MSNQRNHADITRNK 175

Query: 255 DIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHY--MRGHED-SVTSLDF 311
           +           FS H   L+     +S I ++D R    P +     GH      + DF
Sbjct: 176 N-----CIYQAQFSPHDPNLVMCCSGNSYITIFDLRQPPSPTNQRNFLGHSGLEALTCDF 230

Query: 312 HALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEI 345
           +      + +GG D  + +WDL+   +  +S  I
Sbjct: 231 NKYRPHTIATGGVDNVIRIWDLRMTSKNNSSPSI 264

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 4/85 (4%)

Query: 264 AMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGG 323
           ++ FS   ++L AA  ED LI ++D     Q +  ++GHE  + SLD+    + +V SG 
Sbjct: 462 SVCFSPDGKFL-AAGAEDKLIRIWDITT-KQIVMILKGHEQDIYSLDYFPSGEKLV-SGS 518

Query: 324 SDKRVAVWDLKQIGQEQTSDEIEDG 348
            DK V +WDL+  GQ   +  IEDG
Sbjct: 519 GDKTVRIWDLR-TGQCSLTLSIEDG 542

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 70/318 (22%), Positives = 134/318 (42%), Gaps = 30/318 (9%)

Query: 22  TDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSGEEQ 81
           TD  Y L+  ++P   D      L  PS+      SN+   L +   +      TS  E 
Sbjct: 372 TDDYYVLFNPDLPKSLDVDLHLSLSHPSVVCCVRFSNDGQFLATGCNKTTRVYKTSTGEL 431

Query: 82  NYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTIIATIN 141
               IA +     +++ ++ +NS+   ++N         +L +    + P D   +A   
Sbjct: 432 ----IATL-----LVDPQSSNNSNSEQQTNPE-----SSDLYIRSVCFSP-DGKFLAAGA 476

Query: 142 GDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK 201
            D  + I+D +  +     I+  L  H+++ Y L + P  + KL+S S D +V  W+++ 
Sbjct: 477 EDKLIRIWDITTKQ-----IVMILKGHEQDIYSLDYFPSGE-KLVSGSGDKTVRIWDLRT 530

Query: 202 SIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKT--P 259
               LTL     +  V  +  N       +      + D        ++ S  D++    
Sbjct: 531 GQCSLTLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHK 590

Query: 260 SAFNAMAFSFHSEYLMAASGEDSL-IYLYDTRNLNQ----PLHYMRGHEDSVTSLDFHAL 314
            +  +++F+   + L++ S + S+ ++  DT N N      + ++ GH+D V S+   + 
Sbjct: 591 DSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNESCEVTFI-GHKDFVLSVT-TSQ 648

Query: 315 NDGIVISGGSDKRVAVWD 332
           ND  V+SG  D+ V  WD
Sbjct: 649 NDEYVLSGSKDRGVLFWD 666

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 58/251 (23%), Positives = 107/251 (42%), Gaps = 36/251 (14%)

Query: 105 DKHVKSNIRIIKKFKHELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISK 164
           D   K  + I+K   HE ++    Y P    +++  +GD TV I+D    +         
Sbjct: 485 DITTKQIVMILKG--HEQDIYSLDYFPSGEKLVSG-SGDKTVRIWDLRTGQ-------CS 534

Query: 165 LSHHKENGYGLAFNPLDKGKLLSS-SDDGSVAYWNIQKSIPLLTL-QETSIIN------- 215
           L+   E+G     +  + GK +++ S D S   W+ +    L  L  +T + N       
Sbjct: 535 LTLSIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIY 594

Query: 216 DVRWNQFNQNLF-GYVTESSCL-NLKDVRNNNND---LKIVSNHDIKTPSAFNAMAFSFH 270
            V + +  + L  G +  S  L NL    NN+N+   +  + + D        ++  S +
Sbjct: 595 SVSFTKDGKKLVSGSLDRSVKLWNLDTTNNNSNESCEVTFIGHKDFVL-----SVTTSQN 649

Query: 271 SEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFH-----ALNDGIVISGGSD 325
            EY+++ S +D  +  +DT N   PL  ++GH++SV S+            G+  +G  D
Sbjct: 650 DEYVLSGS-KDRGVLFWDT-NSGNPLLMLQGHKNSVISVAVANGQPLGPEFGVFSTGSGD 707

Query: 326 KRVAVWDLKQI 336
               +W  ++I
Sbjct: 708 FTAKIWRYRKI 718

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 76/374 (20%), Positives = 153/374 (40%), Gaps = 55/374 (14%)

Query: 27  ELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSGEEQNYLKI 86
           ++  SN  L ++ V +  +V+P   ++W+PS       +     L     S EE+ + + 
Sbjct: 156 QVLHSNDLLSWESVVDADVVYPVSKIQWVPSQLYPRKLATCSDSLRIWSVSPEERQFQEQ 215

Query: 87  AEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTIIATINGDGTV 146
             ++L         +  ++     ++++I  F     +T   +   D+ +I + + D T 
Sbjct: 216 INLSL----CKYNRQHPANPAAADDMKVIGTFP---PITSFDWNTVDTNLIISSSIDTTC 268

Query: 147 FIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLL 206
            ++D       S+ + ++L  H    + + F         S   DGSV  ++++      
Sbjct: 269 IVWDL----QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFDLR------ 318

Query: 207 TLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMA 266
           +L  ++II +   +  +    G +T SS       + ++  L++        PS ++   
Sbjct: 319 SLAHSTIIYEPPSSSVSGATAGTITPSS-------KGSDALLRL-------EPSPYDP-- 362

Query: 267 FSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDK 326
                  L   + + + I + D RN   P+  ++GH  SV  + +H     +++S G D 
Sbjct: 363 -----NVLATFAADSNKIIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDC 417

Query: 327 RVAVWDL------------KQIGQEQTSDEIEDGDVPELLMIHAGHRSPIND--FSMSNN 372
           +V  WDL            K      TS E  DGD     M   G  S +N+   S++NN
Sbjct: 418 QVLYWDLNSSFMEINAAGSKSPSIHGTSLEDPDGDTE---MTDGGAGSGLNEDPLSLNNN 474

Query: 373 LNWLCASIEEDNIV 386
              +C ++E  N++
Sbjct: 475 SKQVCKTLETPNMM 488

>KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} similar
           to uniprot|P39108 Saccharomyces cerevisiae YDR142C PEX7
           May serve as intraperoxisomal receptor for type 2
           peroxisomal proteins (such as thiolase) Member of
           beta-transducin-related (WD-40) protein family
          Length = 367

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/257 (21%), Positives = 107/257 (41%), Gaps = 32/257 (12%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           +    GDG++ ++D  +++      ++    H++  +   +N ++K   +SSS DG+V  
Sbjct: 76  VLVAQGDGSLRLFDIQLNDYP----VAIFQEHEKEVFSCNWNLINKQLFVSSSWDGTVKV 131

Query: 197 WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDI 256
           W   +   L TL    +                   +S L+ KD+  +N       +   
Sbjct: 132 WTPMRQSSLTTLTPKPM----------------TAHNSALSSKDIPMSNQKRHTSLS--- 172

Query: 257 KTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTR---NLNQPLHYMRGHEDSVTSLDFHA 313
           K  +      FS H   ++ +   +S + ++D R   N NQ   +M  +     + DF+ 
Sbjct: 173 KNKNCIYQSQFSPHDPNIVMSCAGNSYVTMFDLRQPANANQ-YSFMAHNGMETLTCDFNK 231

Query: 314 LNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNL 373
               I+ +GG D  V VWDL+ + ++  ++  +   V E+     GH   I   S S + 
Sbjct: 232 YRSHIIATGGVDNMVKVWDLRMV-RKMAANSRQPMSVNEI----CGHDLAIRKVSWSPHH 286

Query: 374 NWLCASIEEDNIVQVWK 390
           + +  S   D   +VW+
Sbjct: 287 SNMLLSTSYDMTCRVWQ 303

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 269 FHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRV 328
            H  +++ A G+ SL  L+D +  + P+   + HE  V S +++ +N  + +S   D  V
Sbjct: 71  LHENHVLVAQGDGSL-RLFDIQLNDYPVAIFQEHEKEVFSCNWNLINKQLFVSSSWDGTV 129

Query: 329 AVW 331
            VW
Sbjct: 130 KVW 132

>AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR072C
          Length = 513

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/297 (21%), Positives = 124/297 (41%), Gaps = 62/297 (20%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D  +IAT + D T+ ++D+  ++ QS  +   L  H +    L++ P+      +K +L 
Sbjct: 195 DGEVIATGSMDATIRLWDS--EKGQS--LGDALRGHTKWITSLSWEPIHLVKPGEKPRLA 250

Query: 187 SSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFN----------QNLFGYVTESSC 235
           S+S DG++  W+  + + + TL   TS ++ ++W   N             +       C
Sbjct: 251 SASKDGTIKIWDTTRRVCIYTLSGHTSSVSCIKWGGRNVLYSASHDRTVRCWDMAAGGKC 310

Query: 236 LN-LKDVRNNNNDLKIVSNHDIK------------TPSAFNAMAFSFHS---------EY 273
           +N LK   +  N L + +++ ++            +P    A A   +          E 
Sbjct: 311 INILKSHAHWVNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEE 370

Query: 274 LMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKRVAVWD 332
           LM    +D  +YL++    ++P+  M GH+  V  + F    DG  ++S   D  + +WD
Sbjct: 371 LMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSP--DGRYIVSASFDNSIKLWD 428

Query: 333 LKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
            +            DG   + +    GH + +   + S++   L  S  +D  ++VW
Sbjct: 429 GR------------DG---KFIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 469

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 77/151 (50%), Gaps = 15/151 (9%)

Query: 185 LLSSSDDGSVAYWN-IQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           +++ SDD ++  WN ++ S P+L +     ++N V ++   + +     ++S + L D R
Sbjct: 372 MVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNS-IKLWDGR 430

Query: 243 NNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYD--TRNLNQPLHYMR 300
               D K ++       S +  +A+S     L++ S +D+ + ++D  TR L   L    
Sbjct: 431 ----DGKFIATFRGHVASVYQ-VAWSSDCRLLVSCS-KDTTLKVWDVKTRKLTVDLP--- 481

Query: 301 GHEDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           GH D V ++D+ +++   V SGG DK V +W
Sbjct: 482 GHNDEVYTVDW-SVDGKRVCSGGKDKMVRLW 511

>SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 909

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 102/233 (43%), Gaps = 30/233 (12%)

Query: 130 MPQDSTIIATINGDGTVFIYDTS------IDENQSNPIISKLSHHKENGYGLAFNPLDKG 183
           M Q++    +IN  G    + +S      + E QS   I K   H ++   L ++P D  
Sbjct: 297 MGQNAVNTVSINNSGEWLAFGSSKLGQLLVYEWQSESYILKQQGHFDSMNSLTYSP-DGS 355

Query: 184 KLLSSSDDGSVAYWNIQKSIPLLTLQE-TSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           ++++SSDDG +  W++     L T  + TS +  V++ +  Q LF    + +      +R
Sbjct: 356 RVVTSSDDGKIKIWDVVSGFCLATFDDHTSSVTAVQFAKKGQVLFSASLDGTVKAWDLIR 415

Query: 243 NNNNDLKIVSNHDIKTPSA-----FNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLH 297
             N           +T +A     FN +A     E + A S +   I+++  +  N  L 
Sbjct: 416 YRN----------FRTFTAAERIQFNCLAVDPSGEVVCAGSVDSFEIHVWSVQTGNL-LD 464

Query: 298 YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDV 350
            + GHE  V+ L F   N  ++ S   DK + +W +   G+ Q   ++E  DV
Sbjct: 465 TLAGHEGPVSCLSFSNEN-SVLASASWDKTIRIWSI--FGRSQ---QVEPFDV 511

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 81/177 (45%), Gaps = 19/177 (10%)

Query: 173 YGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYV 230
           + L   P  K  LL+   +G +    WN  +S+  +   ETSI ND++    +      V
Sbjct: 17  WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSI-NDLKVIDSDFAAGHLV 75

Query: 231 TESSCLNLK--DVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE-----DSL 283
           + +S   +K  D+R N    KI +          N+   S  S + + A G      D+ 
Sbjct: 76  SSASIDAVKVFDIRTNACVAKIHNEA--------NSPFISLDSRHGLLACGTELQGIDAA 127

Query: 284 IYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQE 339
           +Y+YD R  + PL   +  H D VT + FH  +  +++SG +D    ++DLKQ  +E
Sbjct: 128 VYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEE 184

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/301 (21%), Positives = 125/301 (41%), Gaps = 62/301 (20%)

Query: 133 DSTIIATINGDGTVFIYDTSIDE--NQSNPIISKLSHHKENGYGLAFNPL------DKGK 184
           D  +IAT + D T+ +++++  +     N   S L  H +    L++ PL       K +
Sbjct: 193 DGEVIATGSMDSTIRLWESTKGKPVGGGNGSSSALKGHMKWITSLSWEPLHLVPDGAKPR 252

Query: 185 LLSSSDDGSVAYWNIQKSIPLLTLQETS-IINDVRWNQFNQNLFGY------------VT 231
           L S+S DG++  W+  + + L TL   S  +  V+W        G              T
Sbjct: 253 LASASKDGTIKIWDTARRVCLYTLSGHSNSVACVKWGGEGLLYSGSHDKTVRVWDMNSAT 312

Query: 232 ESSCLN-LKDVRNNNNDLKIVSNHDIK------------TPSAFNAMAFSFH-------- 270
              C++ LK+  +  N L + +++ ++            TP+     A + +        
Sbjct: 313 VGKCISILKNHAHWVNHLSLSTDYALRIGPFDHTGVKPSTPAEAKRRAQANYDKVAKRNG 372

Query: 271 -SEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKRV 328
            +E LM  + +D  ++L++ + L +PL  M GH+  V  + F    DG  ++S   D  +
Sbjct: 373 SAEELMVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNHVAFSP--DGRYIVSASFDNSI 430

Query: 329 AVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQV 388
            +WD +            DG   + L    GH + +   + S++   L  S  +D  ++V
Sbjct: 431 KLWDGR------------DG---KFLSTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKV 474

Query: 389 W 389
           W
Sbjct: 475 W 475

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 76/156 (48%), Gaps = 25/156 (16%)

Query: 185 LLSSSDDGSVAYWNIQK-SIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           ++++SDD ++  WN +K + PL  +     ++N V ++   +    Y+  +S        
Sbjct: 378 MVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNHVAFSPDGR----YIVSAS-------- 425

Query: 243 NNNNDLKIVSNHDIKTPSAFNA-------MAFSFHSEYLMAASGEDSLIYLYDTRNLNQP 295
             +N +K+    D K  S F         +A+S     L++ S +D+ + ++D R     
Sbjct: 426 -FDNSIKLWDGRDGKFLSTFRGHVASVYQVAWSSDCRLLVSCS-KDTTLKVWDVRTRKLS 483

Query: 296 LHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           +  + GH+D V ++D+ +++   V SGG DK V +W
Sbjct: 484 VD-LPGHQDEVFTVDW-SVDGKRVCSGGKDKMVRIW 517

>Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {ON}
           complement(43719..47660) [3942 nt, 1314 aa]
          Length = 1313

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/202 (24%), Positives = 77/202 (38%), Gaps = 39/202 (19%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           IA  N    + IYD + ++N  NP+++  S H        FN      L+S   DG +  
Sbjct: 199 IAVCNNSTIISIYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLISGGQDGQIKI 258

Query: 197 WNIQKSI------PLLTLQETS-IINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLK 249
           W+++ +       P L +   S  I DV+W      + GY   S         N + D K
Sbjct: 259 WDLRSNSLSGSNKPDLNINAASDSIRDVKW------MPGYNFSS--------FNQSYDGK 304

Query: 250 IVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSL 309
              N                 SEY  A+  +  L+  +D R  NQ    +  H      L
Sbjct: 305 QTGN-----------------SEYKFASIHDSGLLLKFDIRQPNQVEKKINAHTGPGLCL 347

Query: 310 DFHALNDGIVISGGSDKRVAVW 331
           ++H  N   + +GG D +  +W
Sbjct: 348 NWHP-NQDYIATGGRDGKCCIW 368

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 55/113 (48%), Gaps = 14/113 (12%)

Query: 228 GYVTESSCLNL--KDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIY 285
           G+ + SS LN    ++      +K+ +  D+K+        F  ++ Y+ A     ++I 
Sbjct: 158 GFSSGSSQLNSLNPNLNKRRRQIKLSTIADVKS-------GFQKYNNYI-AVCNNSTIIS 209

Query: 286 LYDTR---NLNQPL-HYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
           +YD     N++ PL      H  +V S DF+     ++ISGG D ++ +WDL+
Sbjct: 210 IYDINKNDNIDNPLVTSFSEHSRAVNSFDFNMTQTSLLISGGQDGQIKIWDLR 262

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 56/132 (42%), Gaps = 19/132 (14%)

Query: 265 MAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGS 324
           +AFS    Y   AS  D    L+   ++  PL    GH + V ++ FH  N   V +G S
Sbjct: 530 VAFSPLGHYFATAS-HDQTARLWSCDHI-YPLRIFAGHLNDVDTVSFHP-NGTYVFTGSS 586

Query: 325 DKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDN 384
           DK   +WD            I  GD   L +   GH +P+   ++S +  WL     ED 
Sbjct: 587 DKTCRMWD------------ITSGDSVRLFL---GHTAPVTSTAVSPDGRWLSTG-SEDG 630

Query: 385 IVQVWKMNNSLR 396
           ++ VW +    R
Sbjct: 631 VINVWDIGTGKR 642

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 83/173 (47%), Gaps = 16/173 (9%)

Query: 175 LAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQN---LFGYVT 231
           +AF+PL      ++S D +   W+     PL        +NDV    F+ N   +F   +
Sbjct: 530 VAFSPLGH-YFATASHDQTARLWSCDHIYPLRIF--AGHLNDVDTVSFHPNGTYVFTGSS 586

Query: 232 ESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRN 291
           + +C  + D+  + + +++   H     +   + A S    +L   S ED +I ++D   
Sbjct: 587 DKTC-RMWDI-TSGDSVRLFLGHT----APVTSTAVSPDGRWLSTGS-EDGVINVWDI-G 638

Query: 292 LNQPLHYMRGH-EDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSD 343
             + L  MRGH +++V SL + +    ++ISGG+D  V VWD+K+   E  S+
Sbjct: 639 TGKRLKQMRGHGKNAVYSLSY-SKEGHVLISGGADHSVRVWDVKKSTAEPGSE 690

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 76/164 (46%), Gaps = 10/164 (6%)

Query: 175 LAFNPLDKGKLLSSSDDGS--VAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVT 231
           +AF  +D  +  S+   G   +  W+  +S PL  L      I  V++NQ   ++F    
Sbjct: 174 IAFQGIDHHRSNSNFVTGGAQIQLWDSNRSTPLSNLSWGADNITTVKFNQNETDIFASAG 233

Query: 232 ESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRN 291
             + + L D+R N+   KIV    ++T    NA+ ++    +      ED   Y YD RN
Sbjct: 234 SDNSIVLYDLRTNSPTQKIVQT--MRT----NAICWNPMEAFNFVIGNEDHNAYYYDMRN 287

Query: 292 LNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQ 335
           +++ ++  + H  +V  +DF    D IV +G  DK + ++   Q
Sbjct: 288 MSRAINVFKDHVSAVMDVDFSPTGDEIV-TGSYDKTIRIFKTNQ 330

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 46/216 (21%), Positives = 90/216 (41%), Gaps = 51/216 (23%)

Query: 151 TSIDENQSNPIISKLSH-HKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQ 209
           T ++   + P + +L + H++  Y +A N  +  KL + S DG + YWN+     + + +
Sbjct: 48  TKMERMFAKPFVGQLGYGHRDGVYVIAKNYRNLNKLATGSADGVIKYWNMSTRDEVCSFK 107

Query: 210 ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAF------- 262
                            +G +T   C+  + +  N ND  ++S  D KT   +       
Sbjct: 108 AH---------------YGLIT-GLCVTPEHLSKNKNDNFMLSCSDDKTVKLWSVNSEDY 151

Query: 263 ------------NAMAFSFHSEYLMAASGED------------SLIYLYDTRNLNQPLHY 298
                       + +  +F+S+  +A  G D            + I L+D+ N + PL  
Sbjct: 152 VNLKDDEQLNTTSGLLKTFYSD--IAFQGIDHHRSNSNFVTGGAQIQLWDS-NRSTPLSN 208

Query: 299 MRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
           +    D++T++ F+     I  S GSD  + ++DL+
Sbjct: 209 LSWGADNITTVKFNQNETDIFASAGSDNSIVLYDLR 244

>NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {ON}
           Anc_8.316 YDR142C
          Length = 375

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 88/207 (42%), Gaps = 27/207 (13%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           +    GDG++ ++D  + +      I+  + HK+      +N ++K    SSS DG+V  
Sbjct: 76  VVVAQGDGSLRLFDIDLAKYP----IAIFNEHKKEVMSCNWNLINKTMFTSSSWDGTVKI 131

Query: 197 WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDI 256
           W+  +   LLTL+ T      +W +   ++   + +         R NN  ++I  +H I
Sbjct: 132 WSPTRKESLLTLRPTP-----KWKKHLDSMEPIIPK---------RRNN--IQIQPSHKI 175

Query: 257 KTPS------AFNAMAFSFHSEYLMAASGEDSLIYLYDTRN-LNQPLHYMRGHEDSVTSL 309
             P+            FS H   L+     DS   ++D R+  N   +++      V S 
Sbjct: 176 NMPNNNNNKDCIYQSQFSPHDPNLLICCSGDSYTTIFDLRDPYNTQRNFLSHAGMEVLSA 235

Query: 310 DFHALNDGIVISGGSDKRVAVWDLKQI 336
           DF+     ++ + G D  + +WD + +
Sbjct: 236 DFNKYRPNVLATAGVDNSIRIWDFRML 262

>NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/303 (20%), Positives = 121/303 (39%), Gaps = 67/303 (22%)

Query: 129 YMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DK 182
           Y P +  +IAT + D T+ ++D+        P+   L  H +    LA+ P+      + 
Sbjct: 194 YCP-NGEVIATGSMDNTIRLWDS----KDGKPLGDALRGHLKWITSLAWEPIHLVKPGES 248

Query: 183 GKLLSSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDV 241
            +L S+S DG++  W+I + + L T+   T+ ++ ++W+   Q +    +    + + D+
Sbjct: 249 PRLASASKDGTIRIWDITRRVCLYTMSGHTNSVSCIKWS--GQGIIYSGSHDKTVRVWDM 306

Query: 242 RNNNNDLKIVSNH-------DIKTPSAFNAMAFSFHS----------------------- 271
             +   + I+ +H        + T  A    AF                           
Sbjct: 307 NADGKCINILKSHAHWVNHLSLSTDYALRVGAFDHTGAQPASAKDARDKALANYEKVVKK 366

Query: 272 ----EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDK 326
               E LM  + +D  ++L++    N+P+  M GH+  V  + F    DG  ++S   D 
Sbjct: 367 NGKLEELMVTASDDFTMFLWNPLKSNKPIARMTGHQKLVNHVAFSP--DGRYIVSASFDN 424

Query: 327 RVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIV 386
            + +WD +            DG   + +    GH + +   + S +   L  S  +D  +
Sbjct: 425 SIKLWDGR------------DG---KFISTFRGHVASVYQVAWSADCR-LLVSCSKDTTL 468

Query: 387 QVW 389
           +VW
Sbjct: 469 KVW 471

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 77/150 (51%), Gaps = 13/150 (8%)

Query: 185 LLSSSDDGSVAYWNIQKS---IPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDV 241
           ++++SDD ++  WN  KS   I  +T  +  ++N V ++   + +     ++S + L D 
Sbjct: 374 MVTASDDFTMFLWNPLKSNKPIARMTGHQ-KLVNHVAFSPDGRYIVSASFDNS-IKLWDG 431

Query: 242 RNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRG 301
           R    D K +S       S +  +A+S     L++ S +D+ + ++D R     +  + G
Sbjct: 432 R----DGKFISTFRGHVASVYQ-VAWSADCRLLVSCS-KDTTLKVWDVRTRKLSVD-LPG 484

Query: 302 HEDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           H+D V ++D+ +++   V SGG DK V +W
Sbjct: 485 HKDEVYTVDW-SVDGKRVCSGGKDKMVRIW 513

>KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa]
           {ON} Anc_7.310 YDL195W
          Length = 1240

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 95/217 (43%), Gaps = 24/217 (11%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDG 192
           D+  IA    +G + ++  S D+  S   ++KL+ H  +   L FN   +  L+S S+ G
Sbjct: 73  DNKTIAGALDNGIIELFYLSNDQLTS---VAKLTTHTSSVKTLKFNSKQENVLVSGSNKG 129

Query: 193 SVAYWNIQKS--------IPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNN 244
            +  W+  K+         P   +     I  + WNQ   ++F     +   ++ D++  
Sbjct: 130 EIFVWDTNKAKQTDYVPMTPGTAMTPLEEITSLSWNQSLAHVFASAGATVYASIWDLKAK 189

Query: 245 NNDLKIVSNHDIKTPSAFNAMAFSF------HSEYLMAASGED--SLIYLYDTRNLNQPL 296
               K V +    +P+       S       +S  +  A+G D    I ++D RN N PL
Sbjct: 190 ----KEVIHLSYTSPATGLKSQLSVVEWHPNNSTRVATATGNDNDPSILVWDLRNANTPL 245

Query: 297 HYM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWD 332
             + +GH   + SLD+   ++ +++S G D  V +W+
Sbjct: 246 QVLDQGHSKGIISLDWCHEDESLMLSSGRDNTVLLWN 282

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 44/85 (51%), Gaps = 4/85 (4%)

Query: 256 IKTPSAFNAMAFSFHSEYLMAA--SGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHA 313
           I T + FN + +S+ ++ +  A  +G   L YL + +  +  +  +  H  SV +L F++
Sbjct: 59  ISTDTKFNDLDWSYDNKTIAGALDNGIIELFYLSNDQLTS--VAKLTTHTSSVKTLKFNS 116

Query: 314 LNDGIVISGGSDKRVAVWDLKQIGQ 338
             + +++SG +   + VWD  +  Q
Sbjct: 117 KQENVLVSGSNKGEIFVWDTNKAKQ 141

>Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa]
           {ON} complement(180839..181954) [1116 nt, 372 aa]
          Length = 371

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 84/203 (41%), Gaps = 29/203 (14%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           +    GDG++ ++DTS+   Q  PI     H KE      +N ++K   +SSS DG+V  
Sbjct: 77  VLVAQGDGSLRLFDTSL---QKFPIAIFKEHSKEV-LSCNWNLINKQTFVSSSWDGTVKI 132

Query: 197 WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDI 256
           W   +   L TLQ   ++                 +S  ++    + N +   I +N + 
Sbjct: 133 WTPNRKESLRTLQVQPVM-----------------QSQLVDNTIAKTNGSRGTISANKN- 174

Query: 257 KTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTR--NLNQPLHYMRGHEDSVT-SLDFHA 313
                     FS H E L+     +S + L+D R  N N        H  S T + DF+ 
Sbjct: 175 ----CIYQAQFSPHDENLVMCCSGNSYVTLFDLRQPNSNNKQQRFLAHNGSETLTCDFNK 230

Query: 314 LNDGIVISGGSDKRVAVWDLKQI 336
               +V + G D  + +WD++ +
Sbjct: 231 YRPTVVATSGVDSSIRIWDIRML 253

>TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {ON}
           Anc_7.310 YDL195W
          Length = 1300

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 101/230 (43%), Gaps = 29/230 (12%)

Query: 133 DSTIIATINGDGTVFIYDT-SIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDD 191
           D+  IA    +G V ++ T S D  +S   I KLS H  +   + FN   +  L S S +
Sbjct: 73  DNKYIAGALDNGMVELFKTNSKDTLKS---IKKLSKHGTSVTTVNFNAKQENVLASGSKN 129

Query: 192 GSVAYWNIQKSI-----------PLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKD 240
           G +  W++ K I           P + +     I  + WNQ   ++F     +S  ++ D
Sbjct: 130 GEIFIWDLNKCIDQSNDSYSPLTPGMAMTPVEEITSLAWNQSLSHVFASAGNTSYASIWD 189

Query: 241 VRNNNNDLKIVSNHDIKTPSAFNAMAFSF------HSEYLMAASGED--SLIYLYDTRNL 292
           ++      K V +    +PS+      S       +S  +  AS  D   +I ++D RN 
Sbjct: 190 LKAK----KEVIHLSYTSPSSSLKPQLSVVEWHPENSTRVATASNSDNEPIILIWDLRNA 245

Query: 293 NQPLHYMR-GHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQT 341
           N PL  +  G+   + SLD+   +  +++S G D    +W+ ++ G+E T
Sbjct: 246 NTPLQILENGNSKGILSLDWCKHDSNLLLSSGRDNTAVLWNPEE-GKELT 294

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 262 FNAMAFSFHSEYLMAASGEDSLIYLYDT--RNLNQPLHYMRGHEDSVTSLDFHALNDGIV 319
           FN + +S  ++Y+ A + ++ ++ L+ T  ++  + +  +  H  SVT+++F+A  + ++
Sbjct: 65  FNDIDWSIDNKYI-AGALDNGMVELFKTNSKDTLKSIKKLSKHGTSVTTVNFNAKQENVL 123

Query: 320 ISGGSDKRVAVWDLKQI 336
            SG  +  + +WDL + 
Sbjct: 124 ASGSKNGEIFIWDLNKC 140

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 64/302 (21%), Positives = 123/302 (40%), Gaps = 72/302 (23%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D  +IAT + D T+ +++         P    +  H++    L++ PL      ++ KL 
Sbjct: 197 DGELIATGSMDNTIRLWE----GKNGKPFGEAMRGHQKWITSLSWEPLHLVKAGERPKLA 252

Query: 187 SSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQ---------------FNQNLFGYV 230
           +SS DG++  W+  + + L TL    + ++ V+W                 ++ NL G  
Sbjct: 253 TSSKDGTIKVWDTGRRVCLYTLSGHVNSVSCVKWGGKNLLYSGSHDKTVRVWDMNLGG-- 310

Query: 231 TESSCLN-LKDVRNNNNDLKIVSNHDIK------------TPSAFNAMAFSFHS------ 271
               C+N LK   +  N L + +++ ++            TP    A A   +       
Sbjct: 311 ---KCINILKSHAHWVNHLSLSTDYALRVGPFDHTGIMPATPEEARAKALKNYEKVAKRN 367

Query: 272 ---EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKR 327
              E LM  + +D  ++L++     +P+  M GH+  V  + F    DG  ++S   D  
Sbjct: 368 GSDEELMVTASDDFTMFLWNPSKSTKPISRMTGHQKLVNHVAFSP--DGRYIVSASFDNS 425

Query: 328 VAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQ 387
           + +WD +            DG   + +    GH + +   + S++   L AS  +D  ++
Sbjct: 426 IKLWDSR------------DG---KFITTFRGHVASVYQVAWSSDCR-LLASCSKDTSLK 469

Query: 388 VW 389
           VW
Sbjct: 470 VW 471

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 73/166 (43%), Gaps = 7/166 (4%)

Query: 176 AFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESS 234
           +F P    ++++ + D +   W+     P++TL   T+ +  V W+  +  L    +  +
Sbjct: 150 SFAPHTSSRMVTGAGDNTARIWDCDTQTPMVTLSGHTNWVLCVAWSP-DGELIATGSMDN 208

Query: 235 CLNLKDVRNNNNDLKIVSNHD--IKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNL 292
            + L + +N     + +  H   I + S              +A S +D  I ++DT   
Sbjct: 209 TIRLWEGKNGKPFGEAMRGHQKWITSLSWEPLHLVKAGERPKLATSSKDGTIKVWDT-GR 267

Query: 293 NQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQ 338
              L+ + GH +SV+ + +   N  ++ SG  DK V VWD+   G+
Sbjct: 268 RVCLYTLSGHVNSVSCVKWGGKN--LLYSGSHDKTVRVWDMNLGGK 311

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 85/199 (42%), Gaps = 55/199 (27%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDG 192
           D  ++ T + D T+F+++ S    +S   IS+++ H++    +AF+P D   ++S+S D 
Sbjct: 370 DEELMVTASDDFTMFLWNPS----KSTKPISRMTGHQKLVNHVAFSP-DGRYIVSASFDN 424

Query: 193 SVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVS 252
           S+  W                  D R  +F     G+V                      
Sbjct: 425 SIKLW------------------DSRDGKFITTFRGHV---------------------- 444

Query: 253 NHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFH 312
                  ++   +A+S     L+A+  +D+ + ++D R     +  + GH D V ++D+ 
Sbjct: 445 -------ASVYQVAWSSDCR-LLASCSKDTSLKVWDIRTKKLSVD-LPGHLDEVYTVDW- 494

Query: 313 ALNDGIVISGGSDKRVAVW 331
           +++   V SGG DK V +W
Sbjct: 495 SVDGKRVCSGGKDKMVRLW 513

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 76/161 (47%), Gaps = 10/161 (6%)

Query: 175 LAFNPLDKGKLLSS--SDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVT 231
            AF  +D  +  S+  +    +  W+  +S PL  L      I+ V++NQ   ++     
Sbjct: 174 FAFQGIDHHRSKSNFVTGGAKIQLWDSNRSKPLTDLSWGADNISTVKFNQNETDILASAG 233

Query: 232 ESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRN 291
             + L L D+R N+   KIV    ++T    NA+ ++    +    + ED   Y YD RN
Sbjct: 234 SDNSLVLYDLRTNSPTQKIVQT--MRT----NAICWNPMEAFNFVVANEDHNAYYYDMRN 287

Query: 292 LNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWD 332
           +++ L+  + H  +V  +DF    D IV +G  DK + +++
Sbjct: 288 MSRALNVFKDHVSAVMDVDFSPTGDEIV-TGSYDKTIRIFN 327

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 87/201 (43%), Gaps = 21/201 (10%)

Query: 151 TSIDENQSNPIISKLSH-HKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQ 209
           T ++   + P + +L + H++  Y +A N  +  KL + S DG V YWN+     L + +
Sbjct: 48  TKMERMFAKPFVGQLGYGHRDGVYVIAKNYKNLNKLATGSADGVVKYWNMSTREELCSFK 107

Query: 210 E-------TSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSN-HDIKTPSA 261
                     +  +    Q N+N     ++   + L  V  N+ D   + N  DI T S 
Sbjct: 108 AHYGLITGLCVTPEHLSKQKNENFMLSCSDDKTVKLWSV--NSEDYANLKNAEDINTASG 165

Query: 262 --------FNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHA 313
                   F       H       +G  + I L+D+ N ++PL  +    D+++++ F+ 
Sbjct: 166 LLKTYYSDFAFQGIDHHRSKSNFVTG-GAKIQLWDS-NRSKPLTDLSWGADNISTVKFNQ 223

Query: 314 LNDGIVISGGSDKRVAVWDLK 334
               I+ S GSD  + ++DL+
Sbjct: 224 NETDILASAGSDNSLVLYDLR 244

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 78/181 (43%), Gaps = 7/181 (3%)

Query: 154 DENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSI 213
           D N+S P+ + LS   +N   + FN  +   L S+  D S+  ++++ + P   + +T  
Sbjct: 199 DSNRSKPL-TDLSWGADNISTVKFNQNETDILASAGSDNSLVLYDLRTNSPTQKIVQTMR 257

Query: 214 INDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEY 273
            N + WN      F    E       D+RN +  L +  +H     SA   + FS   + 
Sbjct: 258 TNAICWNPMEAFNFVVANEDHNAYYYDMRNMSRALNVFKDH----VSAVMDVDFSPTGDE 313

Query: 274 LMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL 333
           ++  S  D  I +++T + +    Y       V  + F +++   ++SG  D  V +W  
Sbjct: 314 IVTGS-YDKTIRIFNTTHGHSREIYHTKRMQHVFQVKF-SMDAKYIVSGSDDGNVRLWRS 371

Query: 334 K 334
           K
Sbjct: 372 K 372

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 81/172 (47%), Gaps = 17/172 (9%)

Query: 173 YGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYV 230
           + L   PL    LL+S  +GSV    W   K I  +    T+I + V  N    N F   
Sbjct: 16  WCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTISDMVVLNNDRNNGFLIA 75

Query: 231 TESS-CLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAA-----SGEDSLI 284
           T +   + + D+R+++  +  + N         +A   S  S + M A     SG D+ +
Sbjct: 76  TAAEDSVKIFDLRSSDT-VATLKNEK-------SAPFLSLDSRHGMLACGTELSGVDAEL 127

Query: 285 YLYDTRNLNQPLHYM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQ 335
           ++YD +  +QPL  +   H D +T++ FH  +  +++SG +D  V ++DL Q
Sbjct: 128 HIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQ 179

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 56/132 (42%), Gaps = 19/132 (14%)

Query: 265 MAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGS 324
           + FS    Y   AS  D    L+   ++  PL    GH + V ++ FH  N   V +G +
Sbjct: 589 VKFSPMGHYFATAS-HDQTARLWSCDHI-YPLRIFAGHLNDVETVSFHP-NGCYVFTGSA 645

Query: 325 DKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDN 384
           DK   +WD            I  GD   L +   GH +P+   +++ +  WLC    ED 
Sbjct: 646 DKTCRMWD------------ISTGDSVRLFL---GHTAPVLTTAVTPDGRWLCTG-GEDG 689

Query: 385 IVQVWKMNNSLR 396
           ++ VW +    R
Sbjct: 690 VINVWDIGTGKR 701

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 275 MAASGEDSLIYLYDTRNLNQPLHYMRGH-EDSVTSLDFHALNDGIVISGGSDKRVAVWDL 333
           +   GED +I ++D     + L  MRGH ++++ S  F+   + I+ISGG+D  V VWDL
Sbjct: 682 LCTGGEDGVINVWDI-GTGKRLKQMRGHGKNAIHSFSFNKEGN-ILISGGADHSVRVWDL 739

Query: 334 KQIGQEQTSD 343
           K+   E +++
Sbjct: 740 KKATPEPSAE 749

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 7/94 (7%)

Query: 258 TPSA---FNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHAL 314
           TPS+     ++ FS   ++L A   ED LI ++D  N  + +  ++GHE  + SLD+   
Sbjct: 443 TPSSDLYIRSVCFSPDGKFL-ATGAEDRLIRIWDIEN-RKIVMILQGHEQDIYSLDYFPS 500

Query: 315 NDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDG 348
            D +V SG  D+ V +WDL+  GQ   +  IEDG
Sbjct: 501 GDKLV-SGSGDRTVRIWDLR-TGQCSLTLSIEDG 532

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 74/159 (46%), Gaps = 10/159 (6%)

Query: 176 AFNPLDKGKLLSSSDDGS--VAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTE 232
           AF  +D  +  S+   G   +  W+  +S P+  L      I  V++NQ   ++      
Sbjct: 174 AFQGIDHHREASTFVTGGAQIHLWDSNRSKPISNLSWGADNITSVKFNQNEVDILASTGS 233

Query: 233 SSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNL 292
            + + L D+R N+   KI+    ++T    NA+ ++    +    + ED   Y YD RN+
Sbjct: 234 DNAIVLYDLRTNSPTQKIIQT--MRT----NAICWNPMEAFNFVIANEDHNAYYYDMRNM 287

Query: 293 NQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           ++ LH  + H  +V  +DF    D IV +G  DK + ++
Sbjct: 288 SRALHVFKDHVSAVMDVDFSPTGDEIV-TGSYDKTIRIF 325

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/199 (23%), Positives = 91/199 (45%), Gaps = 18/199 (9%)

Query: 151 TSIDENQSNPIISKLSH-HKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQ 209
           T ++   + P I +L + H++  Y +A N  +  KL S S DG + YWN+      ++ +
Sbjct: 48  TKMERMFAKPFIGQLGYGHRDGVYTIAKNYNNLNKLASGSADGIIKYWNMSTREEFVSFK 107

Query: 210 E-------TSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKT---- 258
                     +  +      N+N      +   + L  V NN++   + S+ ++ T    
Sbjct: 108 AHYGLVTGLCVTPEHTSKNKNENFMLSCGDDKTVKLWSV-NNDDFSNVKSDAELNTEGLL 166

Query: 259 PSAFNAMAFS---FHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALN 315
            + +   AF     H E     +G  + I+L+D+ N ++P+  +    D++TS+ F+   
Sbjct: 167 KTFYGEHAFQGIDHHREASTFVTG-GAQIHLWDS-NRSKPISNLSWGADNITSVKFNQNE 224

Query: 316 DGIVISGGSDKRVAVWDLK 334
             I+ S GSD  + ++DL+
Sbjct: 225 VDILASTGSDNAIVLYDLR 243

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 45/195 (23%), Positives = 83/195 (42%), Gaps = 11/195 (5%)

Query: 140 INGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNI 199
           + G   + ++D+    N+S PI S LS   +N   + FN  +   L S+  D ++  +++
Sbjct: 188 VTGGAQIHLWDS----NRSKPI-SNLSWGADNITSVKFNQNEVDILASTGSDNAIVLYDL 242

Query: 200 QKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTP 259
           + + P   + +T   N + WN      F    E       D+RN +  L +  +H     
Sbjct: 243 RTNSPTQKIIQTMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALHVFKDH----V 298

Query: 260 SAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIV 319
           SA   + FS   + ++  S  D  I ++ T + +    Y       V  + F +++   +
Sbjct: 299 SAVMDVDFSPTGDEIVTGS-YDKTIRIFKTNHGHAREVYHTKRMQHVFQVKF-SMDSKYI 356

Query: 320 ISGGSDKRVAVWDLK 334
           ISG  D  V +W  K
Sbjct: 357 ISGSDDGNVRLWRSK 371

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 56/132 (42%), Gaps = 19/132 (14%)

Query: 265 MAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGS 324
           +AFS    Y   AS  D    L+   ++  PL    GH + V ++ FH  N   V +G S
Sbjct: 530 VAFSPLGHYFATAS-HDQTARLWSCDHI-YPLRIFAGHLNDVDTVSFHP-NGTYVFTGSS 586

Query: 325 DKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDN 384
           DK   +WD+              GD   L +   GH +P+   ++S +  WL     ED 
Sbjct: 587 DKTCRMWDMST------------GDSVRLFL---GHTAPVTATAVSPDGRWLSTG-SEDG 630

Query: 385 IVQVWKMNNSLR 396
           I+ VW +    R
Sbjct: 631 IINVWDIGTGKR 642

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 83/173 (47%), Gaps = 16/173 (9%)

Query: 175 LAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQN---LFGYVT 231
           +AF+PL      ++S D +   W+     PL        +NDV    F+ N   +F   +
Sbjct: 530 VAFSPLGH-YFATASHDQTARLWSCDHIYPLRIF--AGHLNDVDTVSFHPNGTYVFTGSS 586

Query: 232 ESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRN 291
           + +C  + D+ +  + +++   H     +   A A S    +L   S ED +I ++D   
Sbjct: 587 DKTC-RMWDM-STGDSVRLFLGHT----APVTATAVSPDGRWLSTGS-EDGIINVWDI-G 638

Query: 292 LNQPLHYMRGH-EDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSD 343
             + L  MRGH +++V SL + +    +++SGG+D  + VWD+K+   E  S+
Sbjct: 639 TGKRLKQMRGHGKNAVYSLSY-SKEGHVLVSGGADHSLRVWDVKKSTAEPGSE 690

>Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON}
           (85899..87926) [2028 nt, 676 aa]
          Length = 675

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 64/140 (45%), Gaps = 22/140 (15%)

Query: 254 HDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHA 313
           + +K  +A       F  EY++  + +D +I +YD+ +  + L  + GHE  V +L +  
Sbjct: 284 YTLKGHTASVVTCLQFEDEYIITGA-DDKMIRVYDSVD-KRFLLELSGHEGGVWALKYD- 340

Query: 314 LNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMS--N 371
             DGI++SG +D+ V VWD+KQ                    I  GH S +    +    
Sbjct: 341 -EDGIIVSGSTDRSVRVWDIKQ---------------GRCTHIFKGHTSTVRCLEIVEYK 384

Query: 372 NLNWLCASIEEDNIVQVWKM 391
           N+ ++      DN + VWK+
Sbjct: 385 NVKYIITG-SRDNTLHVWKL 403

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 108/269 (40%), Gaps = 66/269 (24%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           I T   D  + +YD S+D+      + +LS H+   + L ++  + G ++S S D SV  
Sbjct: 304 IITGADDKMIRVYD-SVDKR----FLLELSGHEGGVWALKYD--EDGIIVSGSTDRSVRV 356

Query: 197 WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRN--------NNNDL 248
           W+I++       + T I              G+ +   CL + + +N         +N L
Sbjct: 357 WDIKQG------RCTHIFK------------GHTSTVRCLEIVEYKNVKYIITGSRDNTL 398

Query: 249 KIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQP-LHYMRGHEDSVT 307
                H  K P            E  + ++  + L + Y++ + N   +  +RGH  SV 
Sbjct: 399 -----HVWKLPKP--------DVERRVDSADGNKLPFTYNSPDENPYFVGILRGHMASVR 445

Query: 308 SLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDF 367
           +L  H     IVISG  D  + VWD+ Q+               + L I  GH   I   
Sbjct: 446 ALSGHG---NIVISGSYDNSLMVWDIAQM---------------KCLYILTGHTDRIYS- 486

Query: 368 SMSNNLNWLCASIEEDNIVQVWKMNNSLR 396
           ++ ++    C S   D  ++VW + +  R
Sbjct: 487 TVYDHKRKRCISASMDATIRVWDLKDIWR 515

>KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} similar
           to uniprot|P53197 Saccharomyces cerevisiae YGL003C CDH1
           CDC20 homolog 1 protein required for Clb2 and Ase1
           degradation
          Length = 582

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 69/136 (50%), Gaps = 16/136 (11%)

Query: 214 INDVRWNQFNQNLFGYVTESSCLNLKD--VRNNNNDLKIVSNHDIKTPSAFNAMAFSFHS 271
           I DV  N+  + L G+V   +CL+  +  + + + D KI+ + D++ P  F     +   
Sbjct: 344 IYDVLKNKCIRTLSGHVDRVACLSWNNHVLSSGSRDRKIL-HRDVRAPEPFFEQIDTHSQ 402

Query: 272 EYL----------MAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVIS 321
           E            +A+ G D+++Y+YD   L QP+  M  H  +V ++ +     G++ +
Sbjct: 403 EVCGLKWNVNENKLASGGNDNMVYVYDG-TLRQPMLSMEEHTAAVKAMAWSPHTRGVLAT 461

Query: 322 GG--SDKRVAVWDLKQ 335
           GG  +DK++ +W++ +
Sbjct: 462 GGGTADKKLKIWNISK 477

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/87 (22%), Positives = 45/87 (51%), Gaps = 7/87 (8%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSS--SDDGSV 194
           +A+   D  V++YD ++ +    P++S +  H      +A++P  +G L +   + D  +
Sbjct: 416 LASGGNDNMVYVYDGTLRQ----PMLS-MEEHTAAVKAMAWSPHTRGVLATGGGTADKKL 470

Query: 195 AYWNIQKSIPLLTLQETSIINDVRWNQ 221
             WNI K++ L  +   S + ++ W++
Sbjct: 471 KIWNISKAVKLNEVDTGSQLCNMLWSK 497

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1321

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 79/197 (40%), Gaps = 29/197 (14%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           +A      TV ++D +      + ++S L+ H  +     FN +    L+S   DG V  
Sbjct: 207 VAVCTNSTTVSLFDINRANQTDSALVSSLAEHTRSVNSFDFNMMQTNLLISGGQDGCVKI 266

Query: 197 WNIQKSIPLLTLQETSIIN--DVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNH 254
           W+I+ + P      T I+N  DVR N      FG + +   +   +   N+ +       
Sbjct: 267 WDIRTNNP------TKIVNTCDVRIN----TTFGSIRDIKWMPGYNFSGNDRNYT----- 311

Query: 255 DIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHAL 314
           D+++           H  Y  A+  +   +  +D R  NQP   +  H      L++H  
Sbjct: 312 DLRS-----------HGGYKFASIHDSGALLKFDMRQPNQPEKRINAHTGPGLCLNWHPH 360

Query: 315 NDGIVISGGSDKRVAVW 331
            D I  SGG D +  +W
Sbjct: 361 QDYIA-SGGRDGKCCLW 376

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 12/91 (13%)

Query: 248 LKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQP----LHYMRGHE 303
           +K+ +  D+KT        F  +  Y+ A     + + L+D    NQ     +  +  H 
Sbjct: 188 IKLSTIADVKT-------GFHNYKNYV-AVCTNSTTVSLFDINRANQTDSALVSSLAEHT 239

Query: 304 DSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
            SV S DF+ +   ++ISGG D  V +WD++
Sbjct: 240 RSVNSFDFNMMQTNLLISGGQDGCVKIWDIR 270

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 107/250 (42%), Gaps = 51/250 (20%)

Query: 133 DSTIIATINGDGTVFIYD---TSIDEN-----QSNPIISKLSHHKENGYGLAFNPLDKGK 184
           D T+ AT   D  + I+    TSI+EN     Q N I   L  H +  Y + F+P ++  
Sbjct: 716 DYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLVGHSDAVYSVNFSPCNRF- 774

Query: 185 LLSSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTES------SCLN 237
           LLS S D +   W+      L++ +     I DV ++    NLF   +        SC  
Sbjct: 775 LLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNLFATASSDNTARVWSCDR 834

Query: 238 LKDVR---NNNNDLKIVSNHD----------------------------IKTPSAFNAMA 266
           +  VR    + +D+  VS H                             I   SA  A A
Sbjct: 835 VYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGHSSAVTATA 894

Query: 267 FSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGH-EDSVTSLDFHALNDGIVISGGSD 325
            S    +L  A+ ED  I ++D  +  + L  MRGH ++S+ SL ++   + I++S G+D
Sbjct: 895 VSPDGRWLSTAN-EDGTITVWDIGS-GKKLKSMRGHGKNSIYSLSYNKTGN-ILVSSGAD 951

Query: 326 KRVAVWDLKQ 335
             V VWD+K+
Sbjct: 952 NSVRVWDIKK 961

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 59/140 (42%), Gaps = 29/140 (20%)

Query: 263 NAMAFSFHSEYLMAASG-EDSLIYLYDTRN------------LNQPLHYMRGHEDSVTSL 309
           N  +  F S+Y +AA+G +DS I ++                +N     + GH D+V S+
Sbjct: 707 NMSSLDFSSDYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLVGHSDAVYSV 766

Query: 310 DFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSM 369
           +F   N   ++SG  DK   +W                 D  + L+ + GH  PI D + 
Sbjct: 767 NFSPCNR-FLLSGSGDKTARLWST---------------DTYKGLVSYKGHEKPIWDVNF 810

Query: 370 SNNLNWLCASIEEDNIVQVW 389
           S   N L A+   DN  +VW
Sbjct: 811 SPTGNNLFATASSDNTARVW 830

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%)

Query: 277 ASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQI 336
           A+   +++Y++D R    PL  + GH  SV S+DF+  N+  ++S G+D  V  WD  ++
Sbjct: 175 ATSHSNIVYVWDVRKGTSPLSVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKV 234

Query: 337 GQE 339
             E
Sbjct: 235 EDE 237

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 40/70 (57%), Gaps = 5/70 (7%)

Query: 132 QDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDD 191
           ++S ++AT + +  V+++D      +    +S L  H  +   + FNP ++ +++SS +D
Sbjct: 169 KNSNVLATSHSN-IVYVWDV----RKGTSPLSVLEGHSGSVNSIDFNPFNETEIMSSGND 223

Query: 192 GSVAYWNIQK 201
           G+V +W+  K
Sbjct: 224 GTVKFWDYNK 233

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/62 (19%), Positives = 31/62 (50%)

Query: 273 YLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWD 332
           ++++ S + ++++     +     H + GH  ++T ++FH L   I+ +   D     WD
Sbjct: 84  WVISTSNQKAIVWNLSRSSSKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTYALAWD 143

Query: 333 LK 334
           ++
Sbjct: 144 MR 145

>AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR142C (PEX7)
          Length = 370

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 85/222 (38%), Gaps = 30/222 (13%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           +    GDG++ ++D ++   Q  PI +    H+   +   +N L K   +SSS DG+V  
Sbjct: 76  VLAAQGDGSLRLFDITL---QQYPI-ALFQEHQREVFSCNWNLLHKDTFVSSSWDGTVKV 131

Query: 197 WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDI 256
           W   +   +LTL        V            + E     L  + N         N D 
Sbjct: 132 WTPARPQSMLTLLPAPANRSV------------MVEPGARGLP-LSNQQQHKDAADNKD- 177

Query: 257 KTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPL-----HYMRGHEDSVTSLDF 311
                     FS H   L+ +   +S + L+D R   QP       ++        S DF
Sbjct: 178 ----CIYQAQFSPHDPNLVMSCSGNSYVSLFDLR---QPAASNQQRFIAHSGLEALSCDF 230

Query: 312 HALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPEL 353
           +     ++ +GG DK V VWDL+ + Q  T+       + E+
Sbjct: 231 NKYRPHVIATGGVDKMVKVWDLRMVRQTLTTSRTAPVSINEM 272

>SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1261

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 94/215 (43%), Gaps = 22/215 (10%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDG 192
           D++I+A    +G V  +  S  E +S   ++K+S H      L FN      L S    G
Sbjct: 73  DNSILAGALDNGIVEFF--SPKELKS---VAKISKHTTPVNTLKFNAKQDNVLCSGDSRG 127

Query: 193 SVAYWNIQKSI--------PLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNN 244
            +  W+I K          P + +     +  + WNQ   ++F     S   ++ D++  
Sbjct: 128 EIFIWDINKITSSGYVPFSPGVAMTPIDEVYSLAWNQSLAHVFASAGSSGYTSIWDLKAK 187

Query: 245 NNDLKIVSNHDIKTPSAFNAMAF----SFHSEYLMAASGED--SLIYLYDTRNLNQPLHY 298
              L +  ++   +  A N ++       +S  +  A+G D   +I ++D RN   PL  
Sbjct: 188 KEVLHL--SYTSPSTGAKNHLSVVEWHPSNSTKIATATGNDNDPVILVWDLRNAKAPLQA 245

Query: 299 M-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWD 332
           M +GH   + SLD+   ++ +++S G D   A+W+
Sbjct: 246 MSQGHSKGILSLDWCKQDENLLLSSGRDNTCALWN 280

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/63 (22%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 274 LMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL 333
           ++A + ++ ++  +  + L   +  +  H   V +L F+A  D ++ SG S   + +WD+
Sbjct: 76  ILAGALDNGIVEFFSPKELKS-VAKISKHTTPVNTLKFNAKQDNVLCSGDSRGEIFIWDI 134

Query: 334 KQI 336
            +I
Sbjct: 135 NKI 137

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 39/87 (44%), Gaps = 8/87 (9%)

Query: 119 KHELEVTRAHYMPQDSTIIATING---DGTVFIYDTSIDENQSNPIISKLSHHKENGYGL 175
           K+ L V   H  P +ST IAT  G   D  + ++D     N   P+ +    H +    L
Sbjct: 203 KNHLSVVEWH--PSNSTKIATATGNDNDPVILVWDL---RNAKAPLQAMSQGHSKGILSL 257

Query: 176 AFNPLDKGKLLSSSDDGSVAYWNIQKS 202
            +   D+  LLSS  D + A WN Q +
Sbjct: 258 DWCKQDENLLLSSGRDNTCALWNPQTA 284

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 57/110 (51%), Gaps = 10/110 (9%)

Query: 239 KDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHY 298
           KDV N N      S+  I++      + FS   ++L A   ED LI ++D  N  + +  
Sbjct: 429 KDVENLNTSSSPSSDLYIRS------VCFSPDGKFL-ATGAEDRLIRIWDIEN-RKIVMI 480

Query: 299 MRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDG 348
           ++GHE  + SLD+    D +V SG  D+ V +WDL+  GQ   +  IEDG
Sbjct: 481 LQGHEQDIYSLDYFPSGDKLV-SGSGDRTVRIWDLR-TGQCSLTLSIEDG 528

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 115/286 (40%), Gaps = 47/286 (16%)

Query: 126 RAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKL 185
           R+     D   +AT   D  + I+D    EN+   I+  L  H+++ Y L + P    KL
Sbjct: 447 RSVCFSPDGKFLATGAEDRLIRIWDI---ENRK--IVMILQGHEQDIYSLDYFP-SGDKL 500

Query: 186 LSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           +S S D +V  W+++     LTL   SI + V     +     Y+   S      V ++ 
Sbjct: 501 VSGSGDRTVRIWDLRTGQCSLTL---SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSE 557

Query: 246 NDL---KIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE-DSLIYLYDTRNLNQP------ 295
                 ++ S ++  T    +  +  F  +     SG  D  + L++ +N N        
Sbjct: 558 TGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTP 617

Query: 296 ------LHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGD 349
                 + Y+ GH+D V S+     ND  ++SG  D+ V  WD K  G            
Sbjct: 618 NSGTCEVTYI-GHKDFVLSV-ATTQNDEYILSGSKDRGVLFWD-KTSGN----------- 663

Query: 350 VPELLMIHAGHRSPINDFSMSNNLNW-----LCASIEEDNIVQVWK 390
              LLM+  GHR+ +   +++N         + A+   D   ++WK
Sbjct: 664 --PLLMLQ-GHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 77/335 (22%), Positives = 132/335 (39%), Gaps = 68/335 (20%)

Query: 31  SNVPLLYDFVSETKLVWPSLTVEWLPS-NETTNLPSNEQRLLLGT--------------- 74
           SN  L ++ V+E  + +P   ++WLPS      L ++ + L + +               
Sbjct: 190 SNDLLTWEKVAECNVTYPVSNIQWLPSVPNPRKLATSSECLRIWSLDDNSMDNSSVFNNN 249

Query: 75  ----------HTSGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEV 124
                       S  EQ  L + +     QIIN  T   S+K   SN R++ +      V
Sbjct: 250 ISNNSRHNTYKKSLTEQVNLSLCKYNEQHQIINNSTNSVSNK---SNARLLGQLP---PV 303

Query: 125 TRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGK 184
           T  H+   D+ ++ + + D T  ++D       SN + ++L  H    + + F       
Sbjct: 304 TSFHWNSIDTNLLISSSIDTTCIVWDLQ----SSNYVKTQLIAHDSEVFDVKFLIQSTQL 359

Query: 185 LLSSSDDGSVAYWNIQKSIPLLTLQETSII----NDVRWNQ-FNQNLFGYVTESSCLNLK 239
             S   DGS+  ++++       LQ ++II    ND++ N  FN ++   +  SS  +L 
Sbjct: 360 FASCGGDGSIRVFDLR------ALQHSTIIYETANDLQGNNTFNNDVTTKIDNSSANSLS 413

Query: 240 DVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDS-LIYLYDTRNLNQPLHY 298
                                A   +  S     L+A  G D   I + D RN   P+  
Sbjct: 414 H--------------------ALLRLEPSPTDPNLIATFGLDKKAILILDMRNPGVPVLV 453

Query: 299 MRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL 333
           + GH  SV  + +H     +++S G D +V  WDL
Sbjct: 454 LSGHSPSVNQIKWHPSKPYVLLSCGDDCQVLYWDL 488

>Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {ON}
           YDR142C (PEX7) - Member of beta-transducin-related
           (WD-40) protein family [contig 171] FULL
          Length = 367

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 56/258 (21%), Positives = 106/258 (41%), Gaps = 34/258 (13%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           +    GDG++ ++DT + +      I+    H++  +   +N ++K   +SSS DG+V  
Sbjct: 76  VLVAQGDGSLRLFDTQLTDYP----IAIFHEHEKEVFSCNWNLINKQLFVSSSWDGTVKV 131

Query: 197 WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDV--RNNNNDLKIVSNH 254
           W+  +   L TL    +                  ++  +  KD+   N  N   +  N 
Sbjct: 132 WSPTRPKSLATLTPKPM----------------AAQNPLMPSKDIPMSNQQNHTSLSKNK 175

Query: 255 DIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSL--DFH 312
           +    S F     S H   ++ +   +S + ++D R       Y     + + +L  DF+
Sbjct: 176 NCIYQSQF-----SPHDPNVIMSCAGNSYVTMFDLRQPPGANQYSFLAHNGMETLTCDFN 230

Query: 313 ALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNN 372
                IV +GG D  + VWDL+ + ++  S+  +   V E+     GH   I   S S +
Sbjct: 231 KYRSHIVATGGVDNMIKVWDLRMV-RKAASNSRQPMSVNEI----CGHDLAIRKVSWSPH 285

Query: 373 LNWLCASIEEDNIVQVWK 390
            + +  S   D   +VW+
Sbjct: 286 HSNMLLSTSYDMTCRVWQ 303

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 269 FHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRV 328
            H   ++ A G+ SL  L+DT+  + P+     HE  V S +++ +N  + +S   D  V
Sbjct: 71  LHENQVLVAQGDGSL-RLFDTQLTDYPIAIFHEHEKEVFSCNWNLINKQLFVSSSWDGTV 129

Query: 329 AVW 331
            VW
Sbjct: 130 KVW 132

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 97/215 (45%), Gaps = 24/215 (11%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           IA    +GT+ +Y    D + +    +K S+H  +   + FN      L S  ++G +  
Sbjct: 77  IAGALDNGTLELYSIG-DAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFI 135

Query: 197 WNIQKSI-------PLLTLQETSIINDV---RWNQFNQNLFGYVTESSCLNLKDVRNNNN 246
           W++ K         PL   Q  S +++V    WNQ   ++F     S+  ++ D++    
Sbjct: 136 WDMNKCTESPSSYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAK-- 193

Query: 247 DLKIVSNHDIKTPSAFNAMAFSF------HSEYLMAASGED--SLIYLYDTRNLNQPLHY 298
             K V +    +P++      S       +S  +  A+G D    I ++D RN N PL  
Sbjct: 194 --KEVIHLSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQT 251

Query: 299 M-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWD 332
           + +GH+  + SLD+   ++ +++S G D  V +W+
Sbjct: 252 LSQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 38.1 bits (87), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 68/159 (42%), Gaps = 17/159 (10%)

Query: 189 SDDGSVAYWNIQKS---IPLLTLQETSIINDVRWNQFNQNLFGYVTESSC--LNLKDVRN 243
           S D S+  W++  +    P+ +LQ  S  ND+ W+  N+ + G +   +    ++ D  +
Sbjct: 37  STDSSLELWSLLTTDSEKPMASLQVDSKFNDLDWSHNNKTIAGALDNGTLELYSIGDAHD 96

Query: 244 NNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQ-PLHYMR-- 300
                   SNH     S+   + F+   + ++A+ G +  I+++D     + P  Y    
Sbjct: 97  TIVSTAKFSNHS----SSVKTVKFNSKQDNVLASGGNNGEIFIWDMNKCTESPSSYTPLT 152

Query: 301 -----GHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
                   D V SL ++     +  S GS    ++WDLK
Sbjct: 153 PGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 43/86 (50%), Gaps = 4/86 (4%)

Query: 260 SAFNAMAFSFHSEYLMAASGEDSLIYLY---DTRNLNQPLHYMRGHEDSVTSLDFHALND 316
           S FN + +S H+   +A + ++  + LY   D  +          H  SV ++ F++  D
Sbjct: 63  SKFNDLDWS-HNNKTIAGALDNGTLELYSIGDAHDTIVSTAKFSNHSSSVKTVKFNSKQD 121

Query: 317 GIVISGGSDKRVAVWDLKQIGQEQTS 342
            ++ SGG++  + +WD+ +  +  +S
Sbjct: 122 NVLASGGNNGEIFIWDMNKCTESPSS 147

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1321

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 76/204 (37%), Gaps = 49/204 (24%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           +A      +V IYD +      NP+++ LS H  +   + FN +    L+S   DG +  
Sbjct: 193 VAICGTSTSVAIYDINKTSAIDNPVVTSLSEHTRSINSVDFNMVQTSLLISGGQDGCIKI 252

Query: 197 WNIQKSIPLLTLQETSI------INDVRW---NQFNQNLFGYVTESSCLNLKDVRNNNND 247
           W+++      T  + SI      I DV+W    +F+ +  G               +N  
Sbjct: 253 WDLRSPKISTTRSDVSINTGSDSIRDVKWMPSYEFSNDTNGL--------------SNRH 298

Query: 248 LKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVT 307
            K  S HD                      SG   L+  +D R  NQ    +  H     
Sbjct: 299 FKFASVHD----------------------SG---LLLKFDLRQPNQAEKKINAHSGPAL 333

Query: 308 SLDFHALNDGIVISGGSDKRVAVW 331
            L++H   D  +ISGG D +  +W
Sbjct: 334 CLNWHPHQD-YIISGGRDGKCCLW 356

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 5/73 (6%)

Query: 266 AFSFHSEYLMAASGEDSLIYLYD---TRNLNQPL-HYMRGHEDSVTSLDFHALNDGIVIS 321
            F  H  Y+ A  G  + + +YD   T  ++ P+   +  H  S+ S+DF+ +   ++IS
Sbjct: 185 GFYNHKNYV-AICGTSTSVAIYDINKTSAIDNPVVTSLSEHTRSINSVDFNMVQTSLLIS 243

Query: 322 GGSDKRVAVWDLK 334
           GG D  + +WDL+
Sbjct: 244 GGQDGCIKIWDLR 256

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 48/87 (55%), Gaps = 4/87 (4%)

Query: 262 FNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVIS 321
             ++ FS   +YL A   ED LI ++D  +  + L  ++GHE  + SLD+    D +V S
Sbjct: 372 IRSVCFSPDGKYL-ATGAEDKLIRIWDLSS-KKILMTLQGHEQDIYSLDYFPAGDKLV-S 428

Query: 322 GGSDKRVAVWDLKQIGQEQTSDEIEDG 348
           G  D+ V +WDL+  GQ   +  IEDG
Sbjct: 429 GSGDRTVRIWDLR-TGQCSLTLSIEDG 454

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 115/281 (40%), Gaps = 42/281 (14%)

Query: 126 RAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKL 185
           R+     D   +AT   D  + I+D S     S  I+  L  H+++ Y L + P    KL
Sbjct: 373 RSVCFSPDGKYLATGAEDKLIRIWDLS-----SKKILMTLQGHEQDIYSLDYFPAGD-KL 426

Query: 186 LSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           +S S D +V  W+++     LTL   SI + V     +     Y+   S      V ++ 
Sbjct: 427 VSGSGDRTVRIWDLRTGQCSLTL---SIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSE 483

Query: 246 NDL---KIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE-DSLIYLYDTRNLN-QPLHYM- 299
                 ++ S +++ T    +  +  F  +     SG  D  + L+D R LN Q  H   
Sbjct: 484 TGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDLRGLNGQKSHATC 543

Query: 300 ----RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLM 355
                GH+D V S+     +D  ++SG  D+ V  WD               G+   LLM
Sbjct: 544 EVTYTGHKDFVLSV-ATTQDDEYILSGSKDRGVLFWD------------TASGN--PLLM 588

Query: 356 IHAGHR------SPINDFSMSNNLNWLCASIEEDNIVQVWK 390
           +  GHR      + +N F +  ++  + A+   D   ++WK
Sbjct: 589 LQ-GHRNSVISVAVVNGFPLGPDIG-VFATGSGDCKARIWK 627

>NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8.316
           YDR142C
          Length = 398

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 51/209 (24%), Positives = 90/209 (43%), Gaps = 30/209 (14%)

Query: 142 GDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK 201
           GDG++ ++D ++   Q  PI +    HK+      +N ++K   LSSS DG V  W+  +
Sbjct: 81  GDGSLRLFDINL---QKYPI-AIFKEHKKEVLSCNWNLINKNLFLSSSWDGDVKVWSTAR 136

Query: 202 SIPLLTLQ-----ETSIIN-----DVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIV 251
              L+TL       T+I+N     +   N  +Q +    + +    +       ND K  
Sbjct: 137 QASLITLSPIHTDPTAIVNTKSNINPSLNNVSQPILHPRSTAIRQPVTSASMQGNDNK-- 194

Query: 252 SNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTR----NLNQPLHYMRGHEDSVT 307
                   +      FS H   ++A     S + L+D R    N+ + +    G+E    
Sbjct: 195 --------NCIYQAQFSPHDPNIVACCSGTSYLTLFDLRQPTPNVQRGILTQSGYE--TL 244

Query: 308 SLDFHALNDGIVISGGSDKRVAVWDLKQI 336
           +LDF+     I+ + G DK + +WD++ I
Sbjct: 245 TLDFNKYRSHIIATSGVDKAIKMWDMRFI 273

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 86/219 (39%), Gaps = 17/219 (7%)

Query: 177 FNPLDKGKLLSSSDDGSVAYWNIQKS--IPLLTLQETSIINDVRWNQFNQNLFGYVTESS 234
           +NP D   L+SSS D +   W++Q +  I    +   S + DVR+   +  LF       
Sbjct: 218 WNPTDPNLLISSSIDTTCIVWDLQSANYIKTQLIAHDSEVFDVRFLTQSTQLFASCGGDG 277

Query: 235 CLNLKDVRNNNNDLKIV------SNHDIKTPSAFNAM----AFSFHSEYLMAASGEDSLI 284
            + + D+R   +   I          D+ +P+   A+       F    +   + + S +
Sbjct: 278 SVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVPPALLRLEPSPFDPNVIATFAIDSSKV 337

Query: 285 YLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL-----KQIGQE 339
            + D R+   PL  +  H   +  + +H     +++S   D +V  WDL      +  ++
Sbjct: 338 LILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDLNTHLDSESTKD 397

Query: 340 QTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCA 378
            T D   D  V +  M +A     +N+       +W  A
Sbjct: 398 TTPDSQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGA 436

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 126 RAHYMPQDSTIIATINGDGT-VFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGK 184
           R    P D  +IAT   D + V I D     +  +P+++ L  H      + ++P  +  
Sbjct: 316 RLEPSPFDPNVIATFAIDSSKVLILDM---RSPGSPLLT-LEAHTAPINQIKWHPTRRNV 371

Query: 185 LLSSSDDGSVAYWNI 199
           LLS+SDD  V YW++
Sbjct: 372 LLSASDDCQVLYWDL 386

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 97/217 (44%), Gaps = 20/217 (9%)

Query: 120 HELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNP 179
           HE  V    + P     IA+ + D T  ++D   +    + ++ +  H KE  + LAF  
Sbjct: 264 HERRVAGCRFHPF-GRYIASASFDNTWRLWDAETN----HELLLQEGHGKEV-FCLAFQS 317

Query: 180 LDKGKLLSSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESS--CL 236
            D   L S+  D +   W+I+     + L   T  I  V W+      F   T S    +
Sbjct: 318 -DGSLLCSAGLDCTGMIWDIRSGNCAMVLSGHTKPIYSVDWSPRG---FEVATASGDGTV 373

Query: 237 NLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPL 296
           N+ D+R  N    +++++ I      + + F  H+   + + G D  I +Y   + N+ +
Sbjct: 374 NIWDIRKTNQPQVLLAHNSI-----VSGIRFEKHNGKFLMSCGYDKNINVYSGDSWNK-I 427

Query: 297 HYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL 333
             ++GH D + +LD    +DG V+S G D+ V  W++
Sbjct: 428 TILKGHTDKILALDL-GTHDGSVVSAGWDRSVKSWNV 463

>TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa]
           {ON} Anc_7.356 YLR196W
          Length = 572

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 84/176 (47%), Gaps = 18/176 (10%)

Query: 166 SHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQET---SIINDVRWNQF 222
           +HH +    LA N L +  L S+S D +V  W++       +L +    S ++  +W+Q 
Sbjct: 290 THHTDAVLSLAHNQLFRAILASTSADSTVKLWDLNSGTAARSLNQVHHGSRVSSSQWHQT 349

Query: 223 NQNLFGYVTESSCLNLKDVR-----NNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAA 277
           + ++       S + L DVR     N +    ++S  +I+T         SF ++Y + A
Sbjct: 350 DGSILLTAGYDSKIALTDVRISDEKNMSKYWNVMSGEEIETA--------SFINDYTVLA 401

Query: 278 SGEDSLIYLYDTRNL-NQPLHYMRGHEDSVTSLDFHALNDGIVISGG-SDKRVAVW 331
             ++  +Y +D R++ ++PL  ++ H+  +  L       G++++G   +K + +W
Sbjct: 402 GTDNGNVYSFDVRSVESKPLWTLKAHDAGIAGLSVPKNIPGMLLTGAMGEKVIKLW 457

>TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.651
           YPL139C
          Length = 451

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 65/335 (19%), Positives = 137/335 (40%), Gaps = 54/335 (16%)

Query: 24  QEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHTSGEEQNY 83
           +E+++WK  VP LY+ ++  K ++ S  V     N + N                   N+
Sbjct: 12  EEFKIWKKTVPSLYNHITTRKPIYLSPQV-----NHSVN-------------------NF 47

Query: 84  LKIAE-ITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTII-ATIN 141
            KI + I   D++I +K     +  V  + +  + F+   E+    Y      I     N
Sbjct: 48  SKIKKTICFTDKVIPQKDSGILETSVLYS-QGYEVFELGFELPLGAYAKSSERITDPKFN 106

Query: 142 GDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK 201
            D          D+  + P+ +K S+  E    L +  + +   ++ ++ GS+A++    
Sbjct: 107 CD----------DKTTTTPLSAKWSYQGETISKLEYLNVGETTAIAMANTGSLAWFKDGL 156

Query: 202 SIPLLTLQET-------SIINDVRWNQFNQNLFGY-VTESSCLNLKDVRNNNNDLKIVSN 253
            +P+  +QE        S I+  +    + N F   + + + +  + + +N + +K++ N
Sbjct: 157 KVPIHAMQEIIGPGTSLSSIHSAKGGPSDINDFSISLDDETIIKTQSLSDNGSIIKLIDN 216

Query: 254 --------HDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDS 305
                     I            +    +      D++I  +DTR  ++P+  ++  +D 
Sbjct: 217 AAKPGTVLRSINVSKECITHTIKYIDNNMFVTCSSDNIIRFWDTRGDDKPMFVLQDSKDG 276

Query: 306 V-TSLDFHALNDGIVISGGSDKRVAVWDLKQIGQE 339
           + TSLD   L D + I+G     + +WD++Q+  E
Sbjct: 277 LLTSLDTTPLIDSLFITGSDTGVIKLWDVRQVLAE 311

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 62/127 (48%), Gaps = 21/127 (16%)

Query: 264 AMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISG 322
           ++ FS   E+L A   ED LI +++ +   + +  ++GHE  + SLD+    DG  ++SG
Sbjct: 346 SICFSPDGEFL-ATGAEDKLIRIWNIKE-RKIVMVLKGHEQDIYSLDYFP--DGQKLVSG 401

Query: 323 GSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEE 382
             D+ + +WDLK  GQ   +  IEDG               +   ++S N   L A+   
Sbjct: 402 SGDRSIRIWDLK-TGQCSLTLSIEDG---------------VTTVAVSPNEGKLIAAGSL 445

Query: 383 DNIVQVW 389
           D  V++W
Sbjct: 446 DRSVRIW 452

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 104/271 (38%), Gaps = 74/271 (27%)

Query: 126 RAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKL 185
           R+     D   +AT   D  + I++  I E +   I+  L  H+++ Y L + P D  KL
Sbjct: 345 RSICFSPDGEFLATGAEDKLIRIWN--IKERK---IVMVLKGHEQDIYSLDYFP-DGQKL 398

Query: 186 LSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           +S S D S+  W+++     LTL     I D                             
Sbjct: 399 VSGSGDRSIRIWDLKTGQCSLTLS----IED----------------------------- 425

Query: 246 NDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDT------RNLNQPLHYM 299
                              +A S +   L+AA   D  + ++D+        L+      
Sbjct: 426 ---------------GVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNESG 470

Query: 300 RGHEDSVTSLDFHALNDGI-VISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHA 358
            GH+DSV S+ F    DG  V+SG  D+ V +W+L   G  Q+          +  + + 
Sbjct: 471 NGHQDSVYSVAF--TKDGQHVVSGSLDRTVKLWNL---GDTQSG-------TGKCEVTYI 518

Query: 359 GHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
           GH+  +   + SN+  ++ +  ++  ++ +W
Sbjct: 519 GHKDFVLSVATSNDDKYIFSGSKDRGVI-IW 548

>TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {ON}
           Anc_8.316 YDR142C
          Length = 362

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 79/202 (39%), Gaps = 30/202 (14%)

Query: 135 TIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSV 194
           T +    GDGT+ ++D +    Q    I     H    +   +N L +   +S S DG V
Sbjct: 74  TQVLVAQGDGTLTLFDLTNKLQQ----IQIYKEHYSEVFSCNWNMLTRRTFISGSWDGKV 129

Query: 195 AYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNH 254
             W+  +S  +LTL+             N    G+  E   +  K ++ N+ +   +   
Sbjct: 130 KIWDCARSESVLTLR-------------NNRSLGHTGEH--IETKALQRNSKNKDCI--- 171

Query: 255 DIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHAL 314
                  + A+ FS H   +      +S +  +D R  NQ    +        S D++  
Sbjct: 172 -------YQAL-FSPHDPNMAMCCSGNSYLTFFDLRQPNQQNSILAHSGLETLSCDYNKY 223

Query: 315 NDGIVISGGSDKRVAVWDLKQI 336
              IV S G DK + +WDL+ I
Sbjct: 224 RSYIVASAGVDKAIRIWDLRMI 245

>KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {ON}
           Anc_8.67 YFL009W
          Length = 672

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 59/129 (45%), Gaps = 22/129 (17%)

Query: 266 AFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSD 325
              F  +Y++  + +D +I +YD+   N  L  + GHE  V +L +    DGIV+SG +D
Sbjct: 303 CLQFEDDYVITGA-DDKMIRIYDSNTKNFLLE-LSGHEGGVWALKYDM--DGIVVSGSTD 358

Query: 326 KRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPIN--DFSMSNNLNWLCASIEED 383
           + V VWD+K+                  L +  GH S +   D      + ++      D
Sbjct: 359 RCVRVWDIKR---------------GCCLHVFKGHSSTVRCLDIVEFKGIKYIITG-SRD 402

Query: 384 NIVQVWKMN 392
           N + VWK++
Sbjct: 403 NTLHVWKLS 411

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 80/342 (23%), Positives = 134/342 (39%), Gaps = 71/342 (20%)

Query: 69  RLLLGTHTSGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIK-----KFKHELE 123
           + LL + +   ++N+ K  EI           ED       +N +I+K     KF  +  
Sbjct: 232 KYLLISESFVSKENFKKYVEILRVKYPTMSNIEDAYKFDFLNNCQILKNWYNPKFIPQRT 291

Query: 124 VTRAHYMPQDSTI------IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAF 177
             R H     + +      + T   D  + IYD+    N  N ++ +LS H+   + L +
Sbjct: 292 TLRGHMTSVVTCLQFEDDYVITGADDKMIRIYDS----NTKNFLL-ELSGHEGGVWALKY 346

Query: 178 NPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLN 237
           + +D G ++S S D  V  W+I++   L   +                  G+ +   CL+
Sbjct: 347 D-MD-GIVVSGSTDRCVRVWDIKRGCCLHVFK------------------GHSSTVRCLD 386

Query: 238 LKDVRNNNNDLKIVSNHDIKTPSAFNAM-AFSFHSEYLMAASGEDSL---IYLYDTRNLN 293
           + + +     +K      I T S  N +  +    E     S  D L     +YDT   N
Sbjct: 387 IVEFKG----IKY-----IITGSRDNTLHVWKLSPEVYNRDSENDHLNRWPIVYDTPEEN 437

Query: 294 QP-LHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPE 352
              +  +RGH  SV ++  H     IVISG  D  + VWD+ Q+               +
Sbjct: 438 PYFVGVLRGHLASVRAVSGHG---NIVISGSYDNTLMVWDIVQM---------------K 479

Query: 353 LLMIHAGHRSPINDFSMSNNL-NWLCASIEEDNIVQVWKMNN 393
            L I AGH   I  +S + +     C S   D+ ++VW + N
Sbjct: 480 CLYILAGHTDRI--YSTTYDYKRQRCISASMDSSIRVWDLKN 519

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 54/105 (51%), Gaps = 16/105 (15%)

Query: 244 NNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHE 303
           N+NDL I S            + FS   ++L A   ED LI ++D +   + +  ++GH+
Sbjct: 380 NSNDLYIRS------------VCFSPDGKFL-ATGAEDKLIRIWDIQQ-RKIVMVLQGHD 425

Query: 304 DSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDG 348
             V SLD+    D +V SG  D+ V +WDLK  GQ   +  IEDG
Sbjct: 426 QDVYSLDYFPSGDKLV-SGSGDRTVRIWDLK-TGQCSLTLSIEDG 468

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 113/287 (39%), Gaps = 43/287 (14%)

Query: 126 RAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKL 185
           R+     D   +AT   D  + I+D      Q   I+  L  H ++ Y L + P    KL
Sbjct: 387 RSVCFSPDGKFLATGAEDKLIRIWDI-----QQRKIVMVLQGHDQDVYSLDYFP-SGDKL 440

Query: 186 LSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           +S S D +V  W+++     LTL     +  V  +  +       +    + + D     
Sbjct: 441 VSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGF 500

Query: 246 NDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE-DSLIYLYDTRNLNQP--------- 295
              ++ S +++ T    +  +  F  +     SG  D  + L++ R+ N           
Sbjct: 501 LVERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLRDNNANSSSNNSNKS 560

Query: 296 -----LHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDV 350
                + Y+ GH+D V S+   A ND  ++SG  D+ V  WD K             G+ 
Sbjct: 561 NATCDVTYV-GHKDFVLSVTTTA-NDEYILSGSKDRGVLFWDTKS------------GN- 605

Query: 351 PELLMIHAGHRSPINDFSMSNNLNW-----LCASIEEDNIVQVWKMN 392
             LLM+  GHR+ +   +++N         + A+   D   ++WK +
Sbjct: 606 -PLLMLQ-GHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIWKFS 650

>TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {ON}
           Anc_6.363 YCR084C
          Length = 663

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 46/85 (54%), Gaps = 4/85 (4%)

Query: 264 AMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGG 323
           ++ FS   ++L A   ED LI ++D   L + +  + GHE  + SLD+    D IV SG 
Sbjct: 371 SVCFSPDGKFL-ATGAEDRLIRIWDI-TLKKIVMILNGHEQDIYSLDYFPSGDKIV-SGS 427

Query: 324 SDKRVAVWDLKQIGQEQTSDEIEDG 348
            D+ V +WDL   GQ   +  IEDG
Sbjct: 428 GDRTVRIWDL-NTGQCLLTLSIEDG 451

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 87/215 (40%), Gaps = 61/215 (28%)

Query: 126 RAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKL 185
           R+     D   +AT   D  + I+D ++ +     I+  L+ H+++ Y L + P    K+
Sbjct: 370 RSVCFSPDGKFLATGAEDRLIRIWDITLKK-----IVMILNGHEQDIYSLDYFP-SGDKI 423

Query: 186 LSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           +S S D +V  W++     LLT                            L+++D     
Sbjct: 424 VSGSGDRTVRIWDLNTGQCLLT----------------------------LSIED----- 450

Query: 246 NDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSL-IYLYDTRNLNQPL---HYMRG 301
                              +A S   +++ A S + ++ ++  +T  L + L       G
Sbjct: 451 ---------------GVTTVAVSPDGKFIAAGSLDRAVRVWDAETGFLVERLDSNELGTG 495

Query: 302 HEDSVTSLDFHALNDGI-VISGGSDKRVAVWDLKQ 335
           HEDSV S+ F    DG  V+SG  DK V +W+LKQ
Sbjct: 496 HEDSVYSVVF--TKDGKNVVSGSLDKTVKLWNLKQ 528

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 78/186 (41%), Gaps = 17/186 (9%)

Query: 162 ISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQK--------SIPLLTLQETSI 213
           I+KL+ H      + FN      L S    G +  W+  K         +P   +     
Sbjct: 97  IAKLAQHSTPVKTVRFNAKQHNVLCSGGSKGEIYIWDANKIETPGYAPFVPGTAMTPMDE 156

Query: 214 INDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAF-SFH-- 270
           I  + WNQ   ++F     S   ++ D++     + +  +H        N ++   +H  
Sbjct: 157 IYSLAWNQNQGHVFASAGSSGFASIWDLKAKKEVIHL--SHTSSITGQKNQLSIVEWHPN 214

Query: 271 -SEYLMAASGEDS--LIYLYDTRNLNQPLHYM-RGHEDSVTSLDFHALNDGIVISGGSDK 326
            S  +  ASG DS   I ++D RN N PL  + +GH   V SLD+   ++ +++S G D 
Sbjct: 215 NSTRIATASGSDSDPSILVWDLRNANVPLQTLSQGHTKGVLSLDWCKQDETLLLSSGRDN 274

Query: 327 RVAVWD 332
              +W+
Sbjct: 275 SCVLWN 280

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 61/130 (46%), Gaps = 23/130 (17%)

Query: 262 FNAMAFSFHSEYLMAASGEDSLIYLYD--TRNLNQPLHYMRGHEDSVTSLDFHALNDGIV 319
             ++ FS   ++L A   ED LI ++D  TR +   +  ++GHE  + SLD+    D +V
Sbjct: 473 IRSVCFSPDGKFL-ATGAEDKLIRIWDLATRRI---VMTLQGHEQDIYSLDYFPSGDKLV 528

Query: 320 ISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCAS 379
            SG  D+ V +WDL+  GQ   +  IEDG               +   ++S     L A+
Sbjct: 529 -SGSGDRTVRIWDLR-TGQCSLTLSIEDG---------------VTTVAVSPGDGKLIAA 571

Query: 380 IEEDNIVQVW 389
              D  V++W
Sbjct: 572 GSLDRTVRIW 581

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 62/304 (20%), Positives = 121/304 (39%), Gaps = 40/304 (13%)

Query: 104 SDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIIS 163
           + ++ K++  +      +L +    + P D   +AT   D  + I+D +        I+ 
Sbjct: 453 TSENAKASPAVATSASSDLYIRSVCFSP-DGKFLATGAEDKLIRIWDLATRR-----IVM 506

Query: 164 KLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFN 223
            L  H+++ Y L + P    KL+S S D +V  W+++     LTL     +  V  +  +
Sbjct: 507 TLQGHEQDIYSLDYFP-SGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGD 565

Query: 224 QNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE-DS 282
             L    +    + + D        ++ S +++ T    +  +  F  +     SG  D 
Sbjct: 566 GKLIAAGSLDRTVRIWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDR 625

Query: 283 LIYLYDTRNLNQPLHYMR-----------GHEDSVTSLDFHALNDGIVISGGSDKRVAVW 331
            + L++ R+ N      +           GH+D V S+     ND  ++SG  D+ V  W
Sbjct: 626 SVKLWNLRSANGGTAEGKANTAASEVTYTGHKDFVLSV-ATTQNDEFILSGSKDRGVLFW 684

Query: 332 DLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLN-----WLCASIEEDNIV 386
           D               G+   LLM+  GHR+ +   +++N+        + A+   D   
Sbjct: 685 D------------TPSGN--PLLMLQ-GHRNSVISVAVANDHPLGPEYGVFATGSGDCKA 729

Query: 387 QVWK 390
           ++WK
Sbjct: 730 RIWK 733

>NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {ON}
           Anc_8.67
          Length = 730

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 22/128 (17%)

Query: 266 AFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSD 325
              F  +Y++  + +D  + +YD R+  + L  + GHE  V +L + A  DGI++SG +D
Sbjct: 361 CLQFEDDYVITGA-DDRQLRIYDARS-KKFLKELSGHEGGVWALKYDA--DGIIVSGSTD 416

Query: 326 KRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSN--NLNWLCASIEED 383
           + V +WD+K+                    +  GH S +    +    N+ ++      D
Sbjct: 417 RSVRIWDIKRGCCTH---------------VFKGHTSTVRCLEIVTYKNMKYIVTG-SRD 460

Query: 384 NIVQVWKM 391
           N + VWK+
Sbjct: 461 NTLHVWKL 468

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 59/253 (23%), Positives = 100/253 (39%), Gaps = 59/253 (23%)

Query: 143 DGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKS 202
           D  + IYD      +S   + +LS H+   + L ++    G ++S S D SV  W+I++ 
Sbjct: 375 DRQLRIYDA-----RSKKFLKELSGHEGGVWALKYDA--DGIIVSGSTDRSVRIWDIKRG 427

Query: 203 IPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAF 262
                 +                  G+ +   CL +   +N    +K      I T S  
Sbjct: 428 CCTHVFK------------------GHTSTVRCLEIVTYKN----MKY-----IVTGSRD 460

Query: 263 NAMAFSFHSEYLMAASGEDS-LIYLYDTRNLNQP-LHYMRGHEDSVTSLDFHALNDGIVI 320
           N +    H   L+     D  L  +Y+T   N   +  +RGH  SV ++  H     IVI
Sbjct: 461 NTL----HVWKLIKEEKFDGELPMVYNTPEENPYFVGVLRGHMASVRTISGHG---NIVI 513

Query: 321 SGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASI 380
           SG  D  + VWD+ Q+               + L +  GH   I   ++ ++    C S 
Sbjct: 514 SGSYDNNLMVWDIAQM---------------KCLYVLIGHTDRIYS-TIYDHKRQRCISA 557

Query: 381 EEDNIVQVWKMNN 393
             D+ ++VW ++N
Sbjct: 558 SMDSTIKVWDLDN 570

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 95/212 (44%), Gaps = 29/212 (13%)

Query: 173 YGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYV 230
           + L   P  K  LL+   +G +    W   KS+  +   ET+I ND++    + +    V
Sbjct: 17  WCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAI-NDLKVIDSDFSAGHLV 75

Query: 231 TESSCLNLK--DVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE-----DSL 283
           + +S   +K  D+R N+  +  + N         N+   S  S + + A G      D+ 
Sbjct: 76  SSASIDAVKVFDIRTNSC-IATIQNES-------NSPFLSLDSRHGLLACGTELQGIDAA 127

Query: 284 IYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTS 342
           +++YD R  + PL   +  H D VT + FH  +  I++SG +D    ++DLKQ       
Sbjct: 128 VHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ------- 180

Query: 343 DEIEDG--DVPELLMIH-AGHRSPINDFSMSN 371
           DE ED    V     IH  G  SP   +++S+
Sbjct: 181 DEEEDALHQVINYASIHSCGWLSPKRIYTLSH 212

>CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some
           similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084c TUP1
          Length = 836

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 47/87 (54%), Gaps = 4/87 (4%)

Query: 262 FNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVIS 321
             ++ FS   ++L A   ED LI ++D     + +  ++GHE  + SLD+    D +V S
Sbjct: 558 IRSVCFSPDGKFL-ATGAEDKLIRIWDIEQ-KKIVMVLKGHEQDIYSLDYFPSGDKLV-S 614

Query: 322 GGSDKRVAVWDLKQIGQEQTSDEIEDG 348
           G  D+ V +WDLK  GQ   +  IEDG
Sbjct: 615 GSGDRTVRIWDLK-TGQCTLTLSIEDG 640

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 14/86 (16%)

Query: 301 GHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGH 360
           GH+DSV S+ F    +G+V SG  D+ V +W+L+ +       +   G      + + GH
Sbjct: 686 GHKDSVYSVVFTRDGNGVV-SGSLDRSVKLWNLRNVNHNNADGKPTSGTCE---VTYTGH 741

Query: 361 RSPINDFSMSNNLNWLCASIEEDNIV 386
           +    DF +S       A+ E+D  +
Sbjct: 742 K----DFVLS------VATTEDDEYI 757

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 99/207 (47%), Gaps = 15/207 (7%)

Query: 141 NGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSD-DGSVAYW-- 197
           NG+  +F +D      +S   +S  + HK +   L FN      L+S SD +G +  W  
Sbjct: 83  NGNIELFNFDNKSQTIKSLGNLSDSNKHKGSVKTLKFNTKQSNLLVSGSDKNGEILIWDL 142

Query: 198 -NIQKS--IPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKI-VSN 253
            N+ K+   P + +  T+ I  + WN+   ++F   + +S +++ D++     + +  +N
Sbjct: 143 NNLDKTPLTPGMPMTPTNEITSLAWNKSLSHVFSCSSNTSNVSIFDLKAKKEVIHLNYTN 202

Query: 254 HDIKTPSAFNAMAFSFHSEYLMAA------SGEDSLIYLYDTRNLNQPLHYMR--GHEDS 305
                 S F+ + +   +   +A       S E   I+++D RN + PL  +   GH + 
Sbjct: 203 PVNNVKSLFSVVEWHPKNSTRIATATLNNDSTESDSIFIWDLRNSHTPLQILSKDGHSNG 262

Query: 306 VTSLDFHALNDGIVISGGSDKRVAVWD 332
           + SLD+ + ++ +++S G D  V +W+
Sbjct: 263 ILSLDWCSTDENLLLSSGRDNSVMLWN 289

>Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON}
           similar to Ashbya gossypii ADR090W
          Length = 1228

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 93/216 (43%), Gaps = 22/216 (10%)

Query: 132 QDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDD 191
           +D +I+A    +G V  +    +E +S   ++K+  H      L FN      L+S    
Sbjct: 72  KDGSILAGALDNGVVEFFKP--EELRS---VAKVKKHTTAVQTLRFNAKQSNVLVSGGSQ 126

Query: 192 GSVAYWNIQKSI--------PLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRN 243
           G +  W+  K          P + +     +  + WNQ   ++F     S   ++ D++ 
Sbjct: 127 GEIYVWDTNKIATQGYSPFGPGVAMTPIEEVQSLAWNQTLAHVFASAGSSGFASIWDLKA 186

Query: 244 NNNDLKIVSNHDIKTPSAFNAMAF----SFHSEYLMAASGEDS--LIYLYDTRNLNQPLH 297
               + +  ++   T    N ++       +S  +  A+G D+  +I ++D RN N PL 
Sbjct: 187 KKEVIHL--SYTSPTSGLKNQLSVVEWHPSNSTKVATATGNDNEPVILVWDLRNSNAPLK 244

Query: 298 YM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWD 332
            + +GH   + SLD+   +D ++IS G D    +W+
Sbjct: 245 VLSQGHSKGILSLDWCQQDDKLMISSGRDNTCILWN 280

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/96 (22%), Positives = 47/96 (48%), Gaps = 9/96 (9%)

Query: 251 VSNHDIKTP-------SAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHE 303
           V + D +TP       + FN + +S     ++A + ++ ++  +    L   +  ++ H 
Sbjct: 47  VLSRDARTPQGMIVADAKFNDLEWSKDGS-ILAGALDNGVVEFFKPEELRS-VAKVKKHT 104

Query: 304 DSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQE 339
            +V +L F+A    +++SGGS   + VWD  +I  +
Sbjct: 105 TAVQTLRFNAKQSNVLVSGGSQGEIYVWDTNKIATQ 140

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 50/105 (47%)

Query: 275 MAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
           + AS   + I+++D R    PLH ++GH +SV S+DF   N+  ++S  +D  V  WD  
Sbjct: 173 VMASAHSNDIFIWDLRKGCMPLHILKGHANSVNSIDFSRFNETEIMSSSNDGTVKFWDYS 232

Query: 335 QIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCAS 379
              +E     + D  V +   +  G    +   +  NN  +L +S
Sbjct: 233 VNDKEPLRTVVTDFPVSKGRYLPFGRGFCVMPMTGGNNSVYLSSS 277

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/62 (24%), Positives = 33/62 (53%)

Query: 273 YLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWD 332
           ++++ S + +L++     + N   H + GH  ++T ++FH  N  I+ +   D  V  WD
Sbjct: 84  WVVSTSNQKALVWNLSRSSSNAVEHVLHGHSRAITDINFHPTNPEILATCSIDAYVHAWD 143

Query: 333 LK 334
           ++
Sbjct: 144 MR 145

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 76/180 (42%), Gaps = 15/180 (8%)

Query: 123 EVTRAHYMPQDST---IIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNP 179
           EV    + P  S    +++T N    V+    ++  + SN +   L  H      + F+P
Sbjct: 69  EVADVQWSPHPSKPSWVVSTSNQKALVW----NLSRSSSNAVEHVLHGHSRAITDINFHP 124

Query: 180 LDKGKLLSSSDDGSVAYWNIQKSIPLLTLQE--TSIINDVRWNQFNQNLFGYVTESSCLN 237
            +   L + S D  V  W+++ S          ++    V+WN  N N+      S+ + 
Sbjct: 125 TNPEILATCSIDAYVHAWDMRSSRRAFYSASVWSAGAAQVKWNFKNPNVMA-SAHSNDIF 183

Query: 238 LKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYD-TRNLNQPL 296
           + D+R     L I+  H     ++ N++ FS  +E  + +S  D  +  +D + N  +PL
Sbjct: 184 IWDLRKGCMPLHILKGH----ANSVNSIDFSRFNETEIMSSSNDGTVKFWDYSVNDKEPL 239

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 47/87 (54%), Gaps = 4/87 (4%)

Query: 262 FNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVIS 321
             ++ FS   ++L A   ED LI ++D     Q +  ++GHE  + SLD+    D +V S
Sbjct: 378 IRSVCFSPDGKFL-ATGAEDRLIRIWDIAK-KQIVMVLQGHEQDIYSLDYFPSGDKLV-S 434

Query: 322 GGSDKRVAVWDLKQIGQEQTSDEIEDG 348
           G  D+ V +WDL+  GQ   +  IEDG
Sbjct: 435 GSGDRTVRIWDLR-TGQCSLTLSIEDG 460

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 49/224 (21%), Positives = 96/224 (42%), Gaps = 24/224 (10%)

Query: 175 LAFNPLDKGKLLSS-SDDGSVAYWNIQKSIPLLTLQ--ETSIINDVRWNQFNQNLFGYVT 231
           + F+P   GK L++ ++D  +  W+I K   ++ LQ  E  I +   +   ++ + G  +
Sbjct: 381 VCFSP--DGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSG--S 436

Query: 232 ESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTR- 290
               + + D+R     L +     + T      +A S      +AA   D  + ++D+  
Sbjct: 437 GDRTVRIWDLRTGQCSLTLSIEDGVTT------VAVSPGDGKFIAAGSLDRAVRVWDSET 490

Query: 291 -----NLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEI 345
                 L+       GH+DSV S+ F    +G+V SG  D+ V +W+L+      +S + 
Sbjct: 491 GFLVERLDSENELGTGHKDSVYSVVFTRDGNGVV-SGSLDRSVKLWNLRGDKNNSSSGKP 549

Query: 346 EDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
             G      + + GH+  +   + + N  ++  S  +D  V  W
Sbjct: 550 TPGTCE---VTYTGHKDFVLSVATTQNDQYIL-SGSKDRGVLFW 589

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/224 (26%), Positives = 101/224 (45%), Gaps = 46/224 (20%)

Query: 154 DENQSNPIISKLS---HHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQ- 209
           DE  +NPI S       H    Y  +F+  D+  LLS+S+D +V  W++Q   PL++ + 
Sbjct: 556 DEMPNNPISSTCKTFIGHSGTVYSTSFSAGDE-YLLSASEDKTVRLWSVQDDKPLVSYKG 614

Query: 210 ETSIINDVRWNQFNQNLFGYVTES------SCLNLKDVR---NNNNDLKIVSNH------ 254
               + DV ++    NLF   +        SC  +  +R    + ND+  VS H      
Sbjct: 615 HEKPVWDVEFSPSCNNLFATASNDQTARLWSCDRVYPLRVMAGHLNDVDCVSFHSNGRYI 674

Query: 255 ------------DIKTP----------SAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNL 292
                       DI T           S   +++ S   +++   S +D +I ++D  + 
Sbjct: 675 FTGSSDKTVRMWDINTGDSVRLFMGHNSTVTSLSVSPDGKWISTGS-DDGIITIWDIGS- 732

Query: 293 NQPLHYMRGH-EDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQ 335
            + L  MRGH + S+ SL ++     +++SGG+D+ V VWDL +
Sbjct: 733 GRKLKNMRGHGKSSIHSLSYNP-EGTLLVSGGADQSVRVWDLNK 775

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/129 (23%), Positives = 61/129 (47%), Gaps = 18/129 (13%)

Query: 264 AMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGG 323
           + +FS   EYL++AS ED  + L+  ++ ++PL   +GHE  V  ++F    + +  +  
Sbjct: 579 STSFSAGDEYLLSAS-EDKTVRLWSVQD-DKPLVSYKGHEKPVWDVEFSPSCNNLFATAS 636

Query: 324 SDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEED 383
           +D+   +W   ++              P  L + AGH + ++  S  +N  ++      D
Sbjct: 637 NDQTARLWSCDRV-------------YP--LRVMAGHLNDVDCVSFHSNGRYIFTG-SSD 680

Query: 384 NIVQVWKMN 392
             V++W +N
Sbjct: 681 KTVRMWDIN 689

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 57/141 (40%), Gaps = 30/141 (21%)

Query: 263 NAMAFSFHSEYLMAASG-EDSLIYLYDTRNL---------NQPL----HYMRGHEDSVTS 308
           N  +  F + Y +AASG +DS I ++              N P+        GH  +V S
Sbjct: 520 NMTSLEFSNNYKLAASGFQDSYIKIWSLDGYPLSENDEMPNNPISSTCKTFIGHSGTVYS 579

Query: 309 LDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFS 368
             F A  D  ++S   DK V +W ++              D P  L+ + GH  P+ D  
Sbjct: 580 TSFSA-GDEYLLSASEDKTVRLWSVQD-------------DKP--LVSYKGHEKPVWDVE 623

Query: 369 MSNNLNWLCASIEEDNIVQVW 389
            S + N L A+   D   ++W
Sbjct: 624 FSPSCNNLFATASNDQTARLW 644

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 61/130 (46%), Gaps = 23/130 (17%)

Query: 262 FNAMAFSFHSEYLMAASGEDSLIYLYD--TRNLNQPLHYMRGHEDSVTSLDFHALNDGIV 319
             ++ FS   ++L A   ED LI ++D  TR +   +  ++GHE  + SLD+    D +V
Sbjct: 451 IRSVCFSPDGKFL-ATGAEDKLIRIWDLTTRRI---VMTLQGHEQDIYSLDYFPSGDKLV 506

Query: 320 ISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCAS 379
            SG  D+ V +WDL+  GQ   +  IEDG               +   ++S     L A+
Sbjct: 507 -SGSGDRTVRIWDLR-AGQCSLTLSIEDG---------------VTTVAVSPGDGKLIAA 549

Query: 380 IEEDNIVQVW 389
              D  V++W
Sbjct: 550 GSLDRTVRIW 559

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 61/283 (21%), Positives = 112/283 (39%), Gaps = 41/283 (14%)

Query: 126 RAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKL 185
           R+     D   +AT   D  + I+D +        I+  L  H+++ Y L + P    KL
Sbjct: 452 RSVCFSPDGKFLATGAEDKLIRIWDLTTRR-----IVMTLQGHEQDIYSLDYFP-SGDKL 505

Query: 186 LSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           +S S D +V  W+++     LTL     +  V  +  +  L    +    + + D     
Sbjct: 506 VSGSGDRTVRIWDLRAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGF 565

Query: 246 NDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE-DSLIYLYDTRNLN----------- 293
              ++ S +++ T    +  +  F  +     SG  D  + L++ R+ N           
Sbjct: 566 LVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGSTEGKANTA 625

Query: 294 -QPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPE 352
              + Y  GH+D V S+     ND  ++SG  D+ V  WD               G+   
Sbjct: 626 ASEVTYT-GHKDFVLSV-ATTQNDEFILSGSKDRGVLFWD------------TPSGN--P 669

Query: 353 LLMIHAGHRSPINDFSMSNNLN-----WLCASIEEDNIVQVWK 390
           LLM+  GHR+ +   +++N+        + A+   D   ++WK
Sbjct: 670 LLMLQ-GHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWK 711

>NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {ON}
           Anc_6.363
          Length = 793

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 52/100 (52%), Gaps = 6/100 (6%)

Query: 262 FNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVI 320
             ++ FS   ++L A   ED LI ++D +   + +  ++GHE  V SLD+    DG  ++
Sbjct: 498 IRSVCFSPDGKFL-ATGAEDKLIRIWDIQE-GKIVMVLKGHEQDVYSLDY--FPDGQKLV 553

Query: 321 SGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGH 360
           SG  D+ V +WDL+  GQ   +  IEDG     +  H G 
Sbjct: 554 SGSGDRTVRIWDLR-TGQCSLTLSIEDGVTTVAVSPHDGR 592

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 80/215 (37%), Gaps = 63/215 (29%)

Query: 126 RAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKL 185
           R+     D   +AT   D  + I+D      Q   I+  L  H+++ Y L + P D  KL
Sbjct: 499 RSVCFSPDGKFLATGAEDKLIRIWDI-----QEGKIVMVLKGHEQDVYSLDYFP-DGQKL 552

Query: 186 LSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           +S S D +V  W                  D+R  Q           S  L+++D     
Sbjct: 553 VSGSGDRTVRIW------------------DLRTGQC----------SLTLSIED----- 579

Query: 246 NDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDT------RNLNQPLHYM 299
                              +A S H    +AA   D  + ++D+        L+      
Sbjct: 580 ---------------GVTTVAVSPHDGRFIAAGSLDRAVRVWDSTTGFLVERLDSENELG 624

Query: 300 RGHEDSVTSLDFHALNDG-IVISGGSDKRVAVWDL 333
            GH+DSV S+ F    DG  V+SG  DK V +W+L
Sbjct: 625 TGHQDSVYSVVF--TRDGNEVVSGSLDKSVKLWNL 657

>KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {ON}
           Anc_5.201 YLL011W
          Length = 485

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 96/206 (46%), Gaps = 25/206 (12%)

Query: 151 TSIDENQSNPIISKLSH-HKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQ 209
           T ++   + P I +L H H++  Y +A N  +  KL ++S DG + YWN+      ++ +
Sbjct: 48  TKLERMFAKPFIGQLGHGHRDGVYVVAKNYHNLNKLATASGDGVIKYWNMSTREEYVSFK 107

Query: 210 -ETSIINDVRWNQFNQNLFGYVTES---SCLNLKDVR----NNNNDLKIVSNHDIKTPS- 260
               ++  +       ++ G   ++   SC + K ++    NN++   I S+ ++ T + 
Sbjct: 108 GHYGLVTGLCVTPEGLSVGGLSNQNHMLSCGDDKTIKLWSINNDDFANIKSDEELITKTN 167

Query: 261 AFNAMAFSFHSEY------------LMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTS 308
              A+  +F+ E+            L    G  + I L+D  N + PL  +    D++TS
Sbjct: 168 GSGALLKTFYGEHAFQGIDHHREKPLFVTGG--AKIELWDN-NRSTPLTNLSWGADNITS 224

Query: 309 LDFHALNDGIVISGGSDKRVAVWDLK 334
           L F+     IV S GSD  V ++DL+
Sbjct: 225 LKFNQSETDIVASAGSDNSVVLYDLR 250

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 75/178 (42%), Gaps = 7/178 (3%)

Query: 154 DENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSI 213
           D N+S P+ + LS   +N   L FN  +   + S+  D SV  ++++ + P   + ++  
Sbjct: 205 DNNRSTPL-TNLSWGADNITSLKFNQSETDIVASAGSDNSVVLYDLRTNSPTQKIVQSMR 263

Query: 214 INDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEY 273
            N + WN      F    E       D+RN +  L +  +H     SA   + FS   + 
Sbjct: 264 TNAICWNPMEPFNFVVANEDHNAYYYDMRNMSRSLNVFKDH----VSAVMDVDFSPTGDE 319

Query: 274 LMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           ++  S  D  I ++ T   +    Y       V  + + +++   +ISG  D  V +W
Sbjct: 320 IVTGS-YDKTIRIFKTNQGHSREIYHTKRMQHVMQVKY-SMDSKYLISGSDDGNVRMW 375

>CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa]
           {ON} similar to uniprot|Q08281 Saccharomyces cerevisiae
           YOL138c
          Length = 1336

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 86/213 (40%), Gaps = 30/213 (14%)

Query: 134 STIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGS 193
           S +IA  N    + +YD +      +P+I  LS H        FN      ++S   DG 
Sbjct: 249 SNVIAICNNSTDISLYDLNRTTPAEDPMIQILSGHTRAINSFDFNMSQTNLIISGGQDGC 308

Query: 194 VAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSN 253
           V  W                  D+R +   +         S LN+K   ++  D+K + +
Sbjct: 309 VKVW------------------DIRSDSMKRQ------GRSDLNIKTANDSIRDVKWMPS 344

Query: 254 HDIKT-PSAFNAMAFSFHSEYLMAASGEDSLIYL-YDTRNLNQPLHYMRGHEDSVTSLDF 311
           H+  + PS+ +  + +  S     AS  D+ + L YD R   Q    +  H      L++
Sbjct: 345 HNFASLPSSADGKSLNISSPGYTFASIHDTGVLLKYDLRQTTQVDKKINAHSGPGLCLNW 404

Query: 312 HALNDGIVISGGSDKRVAVWDLKQIGQEQTSDE 344
           H   D I  +GG D + ++W    +G  +++D+
Sbjct: 405 HPHQDYIA-TGGRDGKCSLW---YVGDRRSTDQ 433

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/299 (20%), Positives = 116/299 (38%), Gaps = 66/299 (22%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D  +IAT + D T+ ++D    E   +     L  H +    L++ P+       K +L 
Sbjct: 197 DGEVIATGSMDNTIRLWDPKTGECLGD----ALRGHSKWITSLSWEPIHLVKPGSKPRLA 252

Query: 187 SSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           SSS DG++  W+    +   T+   T+ ++ V+W    Q L    +    + + D+ +  
Sbjct: 253 SSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWG--GQGLLYSGSHDRTVRVWDMNSQG 310

Query: 246 NDLKIVSNH-------DIKTPSAFNAMAFSF---------------------------HS 271
             + I+ +H        + T  A    AF                             +S
Sbjct: 311 RCINILKSHAHWVNHLSLSTDYALRVGAFDHTGQKPTSPEDAQKKALANYEKICKKNGNS 370

Query: 272 EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKRVAV 330
           E +M  + +D  I+L++     +P+  M GH+  V  + F    DG  ++S   D  + +
Sbjct: 371 EEMMVTASDDFTIFLWNPLKSTKPIARMTGHQKLVNHVAFSP--DGRYIVSASFDNSIKL 428

Query: 331 WDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
           WD +            DG   + +    GH + +   + S++   L  S  +D  ++VW
Sbjct: 429 WDGR------------DG---KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 471

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 76/149 (51%), Gaps = 11/149 (7%)

Query: 185 LLSSSDDGSVAYWNIQKSI-PLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           ++++SDD ++  WN  KS  P+  +     ++N V ++   + +     ++S + L D R
Sbjct: 374 MVTASDDFTIFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNS-IKLWDGR 432

Query: 243 NNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGH 302
               D K +S       S +  +A+S     L++ S +D+ + ++D R     +  + GH
Sbjct: 433 ----DGKFISTFRGHVASVYQ-VAWSSDCRLLVSCS-KDTTLKVWDVRTGKLSVD-LPGH 485

Query: 303 EDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           +D V ++D+ +++   V SGG DK V +W
Sbjct: 486 QDEVYTVDW-SVDGKRVCSGGRDKMVRLW 513

>ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly
           similar to uniprot|P25636 Saccharomyces cerevisiae
           YCR057C PWP2 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Eight WD-repeats with
           homology with G protein beta subunits flanked by
           nonhomologous N-terminal and C-terminal extensions
           regulatory protein
          Length = 912

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 98/224 (43%), Gaps = 17/224 (7%)

Query: 130 MPQDSTIIATINGDGTVFIYDTS------IDENQSNPIISKLSHHKENGYGLAFNPLDKG 183
           M Q+     TIN  G    + +       + E QS   + K   H ++   L ++P D  
Sbjct: 292 MGQNPVDTVTINSTGEWLAFGSRQLGQLLVYEWQSESYVLKQQGHFDSMNSLTYSP-DGS 350

Query: 184 KLLSSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           +++++SDDG +  W++     ++TL+  TS +  +++ +  Q LF    + +      +R
Sbjct: 351 RVVTASDDGKIKVWDVVSGFCIVTLEGHTSSVTGIQFAKRGQVLFTSSLDGTVRAWDLIR 410

Query: 243 NNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGH 302
             N  +   S   I+    F  +A     E + A S +   I+++  +   Q +  + GH
Sbjct: 411 YRNFRV-FTSVERIQ----FTCVAVDPSGEVVCAGSTDSFDIHVWSVQT-GQLVDQLAGH 464

Query: 303 EDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIE 346
           E  V+ L F +     + S   D+ + VW +   G+ Q  + IE
Sbjct: 465 EGPVSCLSF-SRETSTLASASWDRTIRVWSI--FGRSQQVEPIE 505

>Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AER263C
          Length = 542

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/300 (19%), Positives = 118/300 (39%), Gaps = 68/300 (22%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D  +IAT + D T+ ++D    +++ +     L  H +    +++ P+      +K ++ 
Sbjct: 224 DGEVIATGSMDNTIRLWDAQTGDSKGDA----LRGHSKWITSMSWEPIHLVTPGNKPRIA 279

Query: 187 SSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           S+S DG++  W+  +   +LTL   TS ++ ++W    Q +    +    +   D+    
Sbjct: 280 SASKDGTIKVWDTVRRQCILTLSGHTSSVSCIKWG--GQGVIYTGSHDRTIRCWDMNAGG 337

Query: 246 NDLKIVSNH-------DIKTPSAFNAMAFSFHS--------------------------- 271
             + I+ +H        + T  A    AF  H+                           
Sbjct: 338 KCINILKSHAHWVNHLSLSTDYALKVGAFD-HTYSRPATAEEAQKRALKNYEKVAKRNGV 396

Query: 272 -EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKRVA 329
            E L+A + +D  +YL++     +PL  M GH+  V  + F    DG  ++S   D  + 
Sbjct: 397 LEELIATASDDFTMYLWNPLKGTKPLTRMTGHQKLVNHVAFSP--DGRYIVSASFDNSIK 454

Query: 330 VWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
           +W               +G   + +    GH + +   + S++   L  S  +D  ++VW
Sbjct: 455 LW---------------EGSSGKFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 498

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 34/179 (18%), Positives = 78/179 (43%), Gaps = 7/179 (3%)

Query: 163 SKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQ 221
           S ++ H        F P    ++++ S D +   W+     P+ TL+  T+ +  V W+ 
Sbjct: 164 SAIAGHSSTILCSTFAPHTSSRMVTGSGDNNARIWDCDTQTPIYTLKGHTNWVLCVAWSA 223

Query: 222 FNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHD--IKTPSAFNAMAFSFHSEYLMAASG 279
            +  +    +  + + L D +  ++    +  H   I + S       +  ++  +A++ 
Sbjct: 224 -DGEVIATGSMDNTIRLWDAQTGDSKGDALRGHSKWITSMSWEPIHLVTPGNKPRIASAS 282

Query: 280 EDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQ 338
           +D  I ++DT    Q +  + GH  SV+ + +     G++ +G  D+ +  WD+   G+
Sbjct: 283 KDGTIKVWDTVR-RQCILTLSGHTSSVSCIKWGG--QGVIYTGSHDRTIRCWDMNAGGK 338

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 71/150 (47%), Gaps = 13/150 (8%)

Query: 185 LLSSSDDGSVAYWNIQKSIPLLTLQ--ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           + ++SDD ++  WN  K    LT       ++N V ++   +    Y+  +S  N   + 
Sbjct: 401 IATASDDFTMYLWNPLKGTKPLTRMTGHQKLVNHVAFSPDGR----YIVSASFDNSIKLW 456

Query: 243 NNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGH 302
             ++  K +S       S +  +A+S     L++ S +D+ + ++D R     +  + GH
Sbjct: 457 EGSSG-KFISTFRGHVASVYQ-VAWSSDCRLLVSCS-KDTTLKVWDVRTRKLAVD-LPGH 512

Query: 303 EDSVTSLDFHALNDG-IVISGGSDKRVAVW 331
            D V ++D+ A  DG  V SGG DK V +W
Sbjct: 513 NDEVYTVDWSA--DGKSVCSGGKDKMVRLW 540

>KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 936

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 64/138 (46%), Gaps = 19/138 (13%)

Query: 255 DIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHAL 314
           +I  PS   AM F   +E L+    ED +I ++D  + +  + +  GH+  VT L   + 
Sbjct: 69  NISKPSVVTAMCFHKETE-LLCVGYEDGVIKVWDLLSKSVLMQF-NGHKSGVTVLRLDSE 126

Query: 315 NDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLN 374
              +V SG  D  + +WDL              G+V   LM    H+  I    + +N++
Sbjct: 127 GTRLV-SGSKDSDLIIWDLV-------------GEVG--LMKLRSHKDAITGIWIDHNMD 170

Query: 375 WLCASIEEDNIVQVWKMN 392
           WL  S+ +D +++VW + 
Sbjct: 171 WL-ISVAKDGLIKVWDLK 187

>KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7.310
           YDL195W gene spans a gap in the genome sequence
          Length = 1307

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 48/222 (21%), Positives = 88/222 (39%), Gaps = 43/222 (19%)

Query: 119 KHELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFN 178
           KH   VT+A +    S I+AT +  G + I+DT+                          
Sbjct: 108 KHAGAVTQARFHSLQSNILATGDSKGGILIWDTN-------------------------- 141

Query: 179 PLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVR---WNQFNQNLFGYVTESSC 235
                K L+ +  G V    +    P+L     S    V+   WN+   ++F     +S 
Sbjct: 142 -----KCLTKAQGGGV----VSTYTPMLPAANKSSEEPVQCLAWNKKQAHIFASTNSTSF 192

Query: 236 LNLKDVRNNNNDLKIVSNHDIK--TPSAFNAMAFSFHSEYLMAASGEDS--LIYLYDTRN 291
            ++ D++   + L +     +    P           S Y+   +G D+  ++ ++D RN
Sbjct: 193 ASIWDLKAKKDVLHLSYTSPLTGLKPQLSVVEWHPDQSTYVATGTGNDTGPVVVVWDLRN 252

Query: 292 LNQPLHYMRG-HEDSVTSLDFHALNDGIVISGGSDKRVAVWD 332
            N PL  + G H   + SLD+   ++ +++S G D  V +W+
Sbjct: 253 ANTPLQELTGGHSKGILSLDWCQQDETLLLSSGRDNSVVLWN 294

 Score = 32.3 bits (72), Expect = 2.6,   Method: Composition-based stats.
 Identities = 27/136 (19%), Positives = 53/136 (38%), Gaps = 4/136 (2%)

Query: 260 SAFNAMAFSFHSEYLMAASGEDSLIYLY---DTRNLNQPLHYMRG-HEDSVTSLDFHALN 315
           + FN + +S  +E ++ A     L +     D  N  + L  + G H  +VT   FH+L 
Sbjct: 63  AKFNDLDWSVDNEIIVGALDSGCLEFYSAGADNGNELKSLGSIEGKHAGAVTQARFHSLQ 122

Query: 316 DGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNW 375
             I+ +G S   + +WD  +   +     +     P L   +     P+   + +     
Sbjct: 123 SNILATGDSKGGILIWDTNKCLTKAQGGGVVSTYTPMLPAANKSSEEPVQCLAWNKKQAH 182

Query: 376 LCASIEEDNIVQVWKM 391
           + AS    +   +W +
Sbjct: 183 IFASTNSTSFASIWDL 198

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 56/246 (22%), Positives = 95/246 (38%), Gaps = 41/246 (16%)

Query: 177 FNPLDKGKLLSSSDDGSVAYWNIQKS--IPLLTLQETSIINDVRWNQFNQNLFGYVTESS 234
           +N +D   ++SSS D +   W++Q S  +    +   S + DVR+   +  LF       
Sbjct: 251 WNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDG 310

Query: 235 CLNLKDVRNNNNDLKIV-----------SNHDIKTPSAFNAMAF------SFHSEYLMAA 277
            + + D+R+  +   I                  TPS+  + A        +    L   
Sbjct: 311 SVRVFDLRSLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYDPNVLATF 370

Query: 278 SGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL---- 333
           + + + I + D RN   P+  + GH  SV  + +H     +++S   D +V  WDL    
Sbjct: 371 AADSNKIIILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDLNNSF 430

Query: 334 --------KQIGQEQTSDEIEDGDVPELLMIHAG-----HRSPINDFSMSNNLNWLCASI 380
                   K  G   T  E  DGD    +M   G     H  P++    S+N    C ++
Sbjct: 431 MEINGGSVKSPGASGTPLEDTDGDT---VMADGGEGSNPHEDPLS--LTSSNEKQACKTL 485

Query: 381 EEDNIV 386
           E  N+V
Sbjct: 486 ETPNMV 491

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 5/79 (6%)

Query: 126 RAHYMPQDSTIIATINGDGT-VFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGK 184
           R    P D  ++AT   D   + I D     N  +PI++ L  H  +   + ++P  +  
Sbjct: 356 RLEPSPYDPNVLATFAADSNKIIILDM---RNPESPILT-LEGHSSSVNEIKWHPTKRNV 411

Query: 185 LLSSSDDGSVAYWNIQKSI 203
           LLS SDD  V YW++  S 
Sbjct: 412 LLSCSDDCQVLYWDLNNSF 430

>KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 826

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 54/132 (40%), Gaps = 19/132 (14%)

Query: 265 MAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGS 324
           + FS    Y + AS  D    L+   ++  PL    GH + V    FH  N   V +G S
Sbjct: 601 VKFSPLGHYFITAS-HDQTARLWSCDHI-YPLRIFSGHLNDVDCSTFHP-NGCYVFTGSS 657

Query: 325 DKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDN 384
           DK   +WD            I+ GD   L +   GH SP+    +S +  WL    E+  
Sbjct: 658 DKTCRMWD------------IQTGDSVRLFL---GHTSPVTALEVSPDGRWLTTGSEDGT 702

Query: 385 IVQVWKMNNSLR 396
           I+ VW +    R
Sbjct: 703 II-VWDIGTGKR 713

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 83/169 (49%), Gaps = 16/169 (9%)

Query: 175 LAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQN---LFGYVT 231
           + F+PL     +++S D +   W+     PL     +  +NDV  + F+ N   +F   +
Sbjct: 601 VKFSPLGH-YFITASHDQTARLWSCDHIYPLRIF--SGHLNDVDCSTFHPNGCYVFTGSS 657

Query: 232 ESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRN 291
           + +C  + D++  ++ +++   H     S   A+  S    +L   S ED  I ++D   
Sbjct: 658 DKTC-RMWDIQTGDS-VRLFLGHT----SPVTALEVSPDGRWLTTGS-EDGTIIVWDI-G 709

Query: 292 LNQPLHYMRGH-EDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQE 339
             + +  M+GH ++ + S+ F+   + +V +GG+D+ V VWD+K+   E
Sbjct: 710 TGKRIKQMKGHGKNPIYSITFNKEGNCLV-TGGADQSVRVWDIKRFTNE 757

>Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 60/299 (20%), Positives = 116/299 (38%), Gaps = 66/299 (22%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D  +IAT + D T+ ++D    E   +     L  H +    L++ P+       K +L 
Sbjct: 197 DGEVIATGSMDNTIRLWDPKTGECLGD----ALRGHSKWITSLSWEPIHLVKPGSKPRLA 252

Query: 187 SSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           SSS DG++  W+    +   T+   T+ ++ V+W    Q L    +    + + D+ +  
Sbjct: 253 SSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWG--GQGLLYSGSHDRTVRVWDINSQG 310

Query: 246 NDLKIVSNH-------DIKTPSAFNAMAFSF---------------------------HS 271
             + I+ +H        + T  A    AF                             +S
Sbjct: 311 RCINILKSHAHWVNHLSLSTDYALRVGAFDHTGKRPSTPEDAQKKALENYEKICKKNGNS 370

Query: 272 EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKRVAV 330
           E +M  + +D  ++L++     +P+  M GH+  V  + F    DG  ++S   D  + +
Sbjct: 371 EEMMVTASDDFTMFLWNPLKSTKPVARMTGHQKLVNHVAFSP--DGRYIVSASFDNSIKL 428

Query: 331 WDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
           WD +            DG   + +    GH + +   + S++   L  S  +D  ++VW
Sbjct: 429 WDGR------------DG---KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 471

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 76/149 (51%), Gaps = 11/149 (7%)

Query: 185 LLSSSDDGSVAYWNIQKSI-PLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           ++++SDD ++  WN  KS  P+  +     ++N V ++   + +     ++S + L D R
Sbjct: 374 MVTASDDFTMFLWNPLKSTKPVARMTGHQKLVNHVAFSPDGRYIVSASFDNS-IKLWDGR 432

Query: 243 NNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGH 302
               D K +S       S +  +A+S     L++ S +D+ + ++D R     +  + GH
Sbjct: 433 ----DGKFISTFRGHVASVYQ-VAWSSDCRLLVSCS-KDTTLKVWDVRTRKLSVD-LPGH 485

Query: 303 EDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           +D V ++D+ +++   V SGG DK V +W
Sbjct: 486 KDEVYTVDW-SVDGKRVCSGGKDKMVRLW 513

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 47/87 (54%), Gaps = 4/87 (4%)

Query: 262 FNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVIS 321
             ++ FS   ++L A   ED LI ++D     + +  ++GHE  + SLD+    D +V S
Sbjct: 465 IRSVCFSPDGKFL-ATGAEDRLIRIWDIAQ-KKIVMVLQGHEQDIYSLDYFPSGDKLV-S 521

Query: 322 GGSDKRVAVWDLKQIGQEQTSDEIEDG 348
           G  D+ V +WDL+  GQ   +  IEDG
Sbjct: 522 GSGDRTVRIWDLRN-GQCSLTLSIEDG 547

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 56/110 (50%), Gaps = 10/110 (9%)

Query: 239 KDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHY 298
           KDV N N      S+  I++      + FS   ++L A   ED LI ++D     + +  
Sbjct: 425 KDVENLNTSSSPSSDLYIRS------VCFSPDGKFL-ATGAEDRLIRIWDIEK-RKIVMI 476

Query: 299 MRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDG 348
           ++GHE  + SLD+    D +V SG  D+ V +WDL+  GQ   +  IEDG
Sbjct: 477 LQGHEQDIYSLDYFPSGDKLV-SGSGDRTVRIWDLR-TGQCSLTLSIEDG 524

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 74/167 (44%), Gaps = 10/167 (5%)

Query: 177 FNPLDKGKLLSSSDDGSVAYWNIQKS--IPLLTLQETSIINDVRWNQFNQNLFGYVTESS 234
           +NP+D   L+SSS D +   W+++ S  +    +   S + DVR+   +  LF       
Sbjct: 256 WNPIDTNLLISSSIDTTCIIWDLESSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDG 315

Query: 235 CLNLKDVRNNNNDLKIVSNHDIKTPSAFNA-------MAFSFHSEYLMAASGEDS-LIYL 286
            + + D+R+  +   I        PS+  A       +  S H   ++A    DS  I +
Sbjct: 316 SVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKIII 375

Query: 287 YDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL 333
            D RN   P+  ++GH  S+  + +H     I++S   D +V  WDL
Sbjct: 376 LDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 131 PQDSTIIATINGDGT-VFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSS 189
           P D  I+AT   D   + I D     N   P+++ L  H  +   + ++P ++  LLS +
Sbjct: 357 PHDPNIVATFAADSNKIIILDM---RNPETPVLT-LQGHSSSLNQIKWHPTERNILLSCA 412

Query: 190 DDGSVAYWNIQKSI 203
           DD  V YW++  S+
Sbjct: 413 DDCQVLYWDLNSSL 426

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1353

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 89/219 (40%), Gaps = 29/219 (13%)

Query: 113 RIIKKFKHELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENG 172
           R++KK     +V    Y  ++   +A      +V +YD +      NP+++ LS H  + 
Sbjct: 175 RVVKKISVISDVKAGFYNHKN--YVAICGTSTSVSVYDINKTSTIDNPLVTTLSEHTRSI 232

Query: 173 YGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTE 232
             + FN      L+S   DG +  W+++ S      Q ++  +D+  N  + ++      
Sbjct: 233 NSVDFNMSQTNLLISGGQDGCIKVWDLRSS------QRSTNRSDININTGSDSI------ 280

Query: 233 SSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNL 292
                         D+K + ++D  T    N+   S +  +  A+  +  L+  +D R  
Sbjct: 281 -------------RDIKWMPSYDFATNDVNNSNGIS-NRGFKFASIHDSGLLLKFDLRQP 326

Query: 293 NQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           NQ    +  H      L +H   +  +ISGG D +  +W
Sbjct: 327 NQMEKKINAHSGPGLCLHWHPHQE-YIISGGRDGKCCLW 364

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 48/113 (42%), Gaps = 25/113 (22%)

Query: 246 NDLKIVSNHDIKTPSAFN--------------------AMAFSFHSEYLMAASGEDSLIY 285
           +D  IV+ HD    S FN                       F  H  Y+ A  G  + + 
Sbjct: 149 DDYSIVNTHDFMHSSNFNQKGSSNLRRVVKKISVISDVKAGFYNHKNYV-AICGTSTSVS 207

Query: 286 LYD---TRNLNQPL-HYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
           +YD   T  ++ PL   +  H  S+ S+DF+     ++ISGG D  + VWDL+
Sbjct: 208 VYDINKTSTIDNPLVTTLSEHTRSINSVDFNMSQTNLLISGGQDGCIKVWDLR 260

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 49/176 (27%), Positives = 77/176 (43%), Gaps = 25/176 (14%)

Query: 173 YGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSI----INDVRWNQFNQNL 226
           +     PL K  +L+S  +G V    W   KSI      ET+I    I +  W     N 
Sbjct: 17  WCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDW----HNE 72

Query: 227 FGYVTES-SCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE----- 280
             ++T S   + L DVR+N     I + H+        A   S  S Y   A G      
Sbjct: 73  TRFITASMHAVKLFDVRSN---ACIGTIHN-----EVGAPFLSLDSRYDKIACGTELKGV 124

Query: 281 DSLIYLYDTRNLNQPLHYM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQ 335
           D+ ++++D R L+ P   +   H D +TS+ FH  +  +++SG +D    ++DL Q
Sbjct: 125 DAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQ 180

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 55/132 (41%), Gaps = 19/132 (14%)

Query: 265 MAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGS 324
           +AFS    Y   AS  D    L+   ++   L    GH   V  + FH  N   V +G S
Sbjct: 611 VAFSPMGHYFATAS-HDQTARLWSCDHI-YSLRIFAGHLSDVDCVTFHP-NGCYVFTGSS 667

Query: 325 DKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDN 384
           DK   +WD            +  G+   L +   GH +P+    +S +  WL AS  ED 
Sbjct: 668 DKTCRMWD------------VSTGETVRLFL---GHTAPVVSLGVSPDGRWL-ASGSEDG 711

Query: 385 IVQVWKMNNSLR 396
           ++ VW + +  R
Sbjct: 712 LINVWDIGSGKR 723

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 50/90 (55%), Gaps = 3/90 (3%)

Query: 275 MAASGEDSLIYLYDTRNLNQPLHYMRGH-EDSVTSLDFHALNDGIVISGGSDKRVAVWDL 333
           +A+  ED LI ++D  +  + L  MRGH  ++V S+ F +    ++ISGG+D  V VWD+
Sbjct: 704 LASGSEDGLINVWDIGS-GKRLKQMRGHGRNAVNSIVF-SQEGTVIISGGTDNSVRVWDM 761

Query: 334 KQIGQEQTSDEIEDGDVPELLMIHAGHRSP 363
            +   E + +   + D  + ++ + G+  P
Sbjct: 762 YKSNNESSINNDTESDFSQSIVGYFGNTLP 791

>NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {ON}
           Anc_8.67
          Length = 885

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 64/142 (45%), Gaps = 26/142 (18%)

Query: 266 AFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSD 325
              F  +Y++  + +D  + +YD++     L  + GHE  V +L +    DGI++SG +D
Sbjct: 479 CLQFEDDYVITGA-DDRQLRIYDSKK-KIFLKELSGHEGGVWALKYDE--DGIIVSGSTD 534

Query: 326 KRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSN--NLNWLCASIEED 383
           + V VWD+K+                    +  GH S +    +    N+ ++      D
Sbjct: 535 RTVRVWDIKRGCCTH---------------VFKGHTSTVRCLEIVTYKNIKYIVTG-SRD 578

Query: 384 NIVQVWKM----NNSLREDPLV 401
           N + VWK+    N S+ E PL+
Sbjct: 579 NTLHVWKLVREDNRSIDELPLI 600

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 42/95 (44%), Gaps = 19/95 (20%)

Query: 299 MRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHA 358
           +RGH  SV ++  H     I+ISG  D  + VWD+ Q+               + + +  
Sbjct: 614 LRGHMASVRTISGHG---NIIISGSYDNNLMVWDIAQM---------------KCIYLLI 655

Query: 359 GHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNN 393
           GH   I   ++ ++    C S   D+ +++W + N
Sbjct: 656 GHTDRIYS-TIYDHQRKRCISASMDSTIKIWDLEN 689

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 75/195 (38%), Gaps = 27/195 (13%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           IA      +V IYD +    + +P+I+ LS H  +   + FN      L+S   DG +  
Sbjct: 199 IAICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCIKV 258

Query: 197 WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDI 256
           W+++                            Y    S LN     ++  D+K +  +D 
Sbjct: 259 WDLRS-------------------------HSYKVNRSDLNFNSGSDSVRDVKWMPTYDF 293

Query: 257 KTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALND 316
            +  A  ++  S  S    A+  +  L+  +D R  NQ    +  H      + +H   D
Sbjct: 294 ASLGADTSLCSSGRSNKF-ASVHDSGLLLTFDMRQPNQVERKINAHSGPGLCMHWHPHMD 352

Query: 317 GIVISGGSDKRVAVW 331
             +ISGG D + A+W
Sbjct: 353 -YIISGGRDGKCALW 366

 Score = 37.0 bits (84), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 5/73 (6%)

Query: 266 AFSFHSEYLMAASGEDSLIYLYDTRNL---NQPL-HYMRGHEDSVTSLDFHALNDGIVIS 321
            F  H  Y+ A  G  + + +YD       + PL   +  H  S+ S+DF+     ++IS
Sbjct: 191 GFHHHKNYI-AICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLIS 249

Query: 322 GGSDKRVAVWDLK 334
           GG D  + VWDL+
Sbjct: 250 GGQDGCIKVWDLR 262

>KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363
           YCR084C
          Length = 655

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 47/87 (54%), Gaps = 4/87 (4%)

Query: 262 FNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVIS 321
             ++ FS   ++L A   ED LI ++D     + +  ++GH+  V SLD+    D +V S
Sbjct: 376 IRSVCFSPDGKFL-ATGAEDRLIRIWDLAQ-QKIVMVLQGHDQDVYSLDYFPSGDKLV-S 432

Query: 322 GGSDKRVAVWDLKQIGQEQTSDEIEDG 348
           G  D+ V +WDLK  GQ   +  IEDG
Sbjct: 433 GSGDRTVRIWDLK-TGQCSLTLSIEDG 458

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 52/235 (22%), Positives = 99/235 (42%), Gaps = 51/235 (21%)

Query: 124 VTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKL-------SHHKENGYGLA 176
           VT     P D   IA  + D  V ++D+     ++  ++ +L       + H+++ Y + 
Sbjct: 459 VTTVAVSPGDGKYIAAGSLDRAVRVWDS-----ETGFLVERLDSENELGTGHRDSVYSVV 513

Query: 177 FNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCL 236
           F   D  K++SSS D SV  WN++        +E +  N       N++    V E + +
Sbjct: 514 FT-RDGNKVVSSSLDRSVKLWNLRG----YNEKENAADN-------NKSQSSVVCEVTYI 561

Query: 237 NLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPL 296
             KD         ++S            +  + + E++++ S +D  +  +DT N   PL
Sbjct: 562 GHKDF--------VLS------------VTTTANDEFVLSGS-KDRGVLFWDT-NTGNPL 599

Query: 297 HYMRGHEDSVTSL---DFHALND--GIVISGGSDKRVAVWDLKQIGQEQTSDEIE 346
             ++GH +SV S+   + H L     +  +G  D R  +W   ++       EI+
Sbjct: 600 LMLQGHRNSVISVAVANGHPLGPEYQVFATGSGDCRARIWKFSKLDSASKVKEIQ 654

>ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 726

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 58/280 (20%), Positives = 118/280 (42%), Gaps = 62/280 (22%)

Query: 123 EVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDK 182
           +++ A+ + Q+ T  A+ + +  V+ +D+ +DE      I+ LS              D 
Sbjct: 485 DLSLAYQLYQEDTEFASNSEEACVYTFDSHLDE------ITALS-------------FDS 525

Query: 183 GKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           G L+S S D ++  W++     + T+       D+ +    Q+     + S         
Sbjct: 526 GHLVSGSQDRTLRQWDLSTGKCVQTI-------DISFASRGQSTSSLASSSLLS------ 572

Query: 243 NNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGH 302
                  +V    +     F+A          +A   +D ++ L+D R+  + +  + GH
Sbjct: 573 ------PVVEAPVVGALQCFDAA---------LATGTKDGIVRLWDMRS-GKTIRSLEGH 616

Query: 303 EDSVTSLDFHALNDGIVISGGSDKRVAVWDLK------QIGQEQTSDEIEDGDVPELLMI 356
            D++T+L F + N   +++G  D+ + +WDL+          E    E+ D D+ ++  +
Sbjct: 617 TDAITTLKFDSRN---LVTGSLDRSIRIWDLRTGTLADAFAYESPVLEL-DFDLQDI--V 670

Query: 357 HAGHRSPINDFSMSNNLNWLCASIEEDN--IVQVWKMNNS 394
            A   + +  F   N+ +W+CA  EE++  I Q  K  N 
Sbjct: 671 AAVGENGVKVFDRENDKHWVCAQSEEEDASISQFVKYKNG 710

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 46/109 (42%), Gaps = 23/109 (21%)

Query: 287 YDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK---QIGQEQTSD 343
           Y TR  +Q   + + H++S+  LDF      +  +G  D  + +W+L    Q+GQ     
Sbjct: 399 YYTRG-SQISSFPKSHDESIICLDFDVPFGTLATAGHLDHSIKLWNLSKKNQVGQ----- 452

Query: 344 EIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMN 392
                          GH + IN   + N  N L +    D ++++W ++
Sbjct: 453 -------------MTGHHASINCMQLDNQYNMLISG-GRDAVLKLWDLS 487

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 62/154 (40%), Gaps = 38/154 (24%)

Query: 191 DGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKI 250
           D S+  WN+ K                  NQ  Q + G+    +C+ L    +N  ++ I
Sbjct: 436 DHSIKLWNLSKK-----------------NQVGQ-MTGHHASINCMQL----DNQYNMLI 473

Query: 251 VSNHDIKTPSAFNAMAFSFHSEYL-MAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSL 309
               D        ++A+  + E    A++ E++ +Y +D+            H D +T+L
Sbjct: 474 SGGRDAVLKLWDLSLAYQLYQEDTEFASNSEEACVYTFDS------------HLDEITAL 521

Query: 310 DFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSD 343
            F   + G ++SG  D+ +  WDL      QT D
Sbjct: 522 SF---DSGHLVSGSQDRTLRQWDLSTGKCVQTID 552

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 61/132 (46%), Gaps = 11/132 (8%)

Query: 214 INDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEY 273
           I D+ +N  N ++    +  + ++  D+R+         +    T SA+ + A      Y
Sbjct: 120 ITDINFNPENPDILATCSVDTYVHAWDMRS--------PHRPFYTTSAWRSGASQVKWNY 171

Query: 274 L---MAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAV 330
               + AS   + IY++D R  + PLH + GH+ SV S+DF+      ++S  +D  V  
Sbjct: 172 KDSNILASAHSNDIYIWDLRMGSTPLHKLVGHDSSVNSIDFNRFKSSEIMSSSNDGTVKF 231

Query: 331 WDLKQIGQEQTS 342
           WD+ +     TS
Sbjct: 232 WDISKGSDNCTS 243

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 41/70 (58%), Gaps = 5/70 (7%)

Query: 132 QDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDD 191
           +DS I+A+ + +  ++I+D  +    S P+  KL  H  +   + FN     +++SSS+D
Sbjct: 172 KDSNILASAHSN-DIYIWDLRMG---STPL-HKLVGHDSSVNSIDFNRFKSSEIMSSSND 226

Query: 192 GSVAYWNIQK 201
           G+V +W+I K
Sbjct: 227 GTVKFWDISK 236

>ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]
           {ON} some similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084C
          Length = 718

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 54/105 (51%), Gaps = 5/105 (4%)

Query: 245 NNDLKIVSNHDIKTPSAF-NAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHE 303
           NND    +N    +   +  ++ FS   ++L A   ED LI ++D     + +  ++GHE
Sbjct: 421 NNDANSFANTRTASSDLYIRSVCFSPDGKFL-ATGAEDRLIRIWDIAQ-KKIVMVLQGHE 478

Query: 304 DSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDG 348
             + SLD+    D +V SG  D+ V +WDL+  GQ   +  IEDG
Sbjct: 479 QDIYSLDYFPSGDKLV-SGSGDRTVRIWDLR-TGQCSLTLSIEDG 521

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 96/225 (42%), Gaps = 25/225 (11%)

Query: 175 LAFNPLDKGKLLSS-SDDGSVAYWNIQKSIPLLTLQ--ETSIINDVRWNQFNQNLFGYVT 231
           + F+P   GK L++ ++D  +  W+I +   ++ LQ  E  I +   +   ++ + G  +
Sbjct: 442 VCFSP--DGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSG--S 497

Query: 232 ESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTR- 290
               + + D+R     L +     + T      +A S      +AA   D  + ++D   
Sbjct: 498 GDRTVRIWDLRTGQCSLTLSIEDGVTT------VAVSLGDGKYIAAGSLDRAVRVWDAET 551

Query: 291 -----NLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEI 345
                 L+       GH+DSV S+ F     G+V SG  D+ V +W+L   GQ  T+ E 
Sbjct: 552 GFLVERLDSENELGTGHKDSVYSVVFTRDGHGVV-SGSLDRSVKLWNLSS-GQNNTNAET 609

Query: 346 EDGDVPELLMI-HAGHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
           +    P    + + GH+  +   + + N  ++ +   +D  V  W
Sbjct: 610 K--PAPGTCEVTYTGHKDFVLSVATTRNDEYILSG-SKDRGVLFW 651

>KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]
           {ON} similar to uniprot|P47025 Saccharomyces cerevisiae
           YJL112W MDV1 WD repeat protein that regulates steps in
           the Dnm1p-dependent process of mitochondrial fission
          Length = 723

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 37/60 (61%), Gaps = 4/60 (6%)

Query: 275 MAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
           MA   +D ++ L+D R + Q +  + GH D+VT L F A+N   +++G  D+ + +WDL+
Sbjct: 585 MATGTKDGIVRLWDLR-MGQVVRTLEGHTDAVTGLQFDAVN---LVTGSLDRSIRIWDLR 640

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/97 (20%), Positives = 44/97 (45%), Gaps = 17/97 (17%)

Query: 298 YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIH 357
           + + H+DS+T LDF      +  +G  D  V +W+L        S + + G +P      
Sbjct: 401 FTKAHDDSITCLDFDMPFGTMCTAGKLDHSVKIWNL--------SKKTQIGTLP------ 446

Query: 358 AGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNS 394
            GH + ++   M  + + +      D ++++W ++ +
Sbjct: 447 -GHLASVSCMQMDESSSLITGG--RDALLKLWDLDKA 480

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/156 (22%), Positives = 78/156 (50%), Gaps = 12/156 (7%)

Query: 185 LLSSSDDGSVAYWNIQK----SIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKD 240
           ++S+S+  ++  WN+ K    +I       +  I D+ +N  + ++    +  + ++  D
Sbjct: 86  IVSTSNQKAII-WNLNKPSSNAIEYALHGHSRAITDINFNSQHPDILATCSIDTYVHAWD 144

Query: 241 VRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAAS-GEDSLIYLYDTRNLNQPLHYM 299
           +R+ +      S+      S+ + + ++F    ++A+S G D  ++++D R+ + PLH +
Sbjct: 145 MRSPHRPFYTTSSWR----SSASQVKWNFKDSNILASSHGND--VFIWDLRHGSTPLHKL 198

Query: 300 RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQ 335
            GH   V S+DF    +  ++S  +D  V  WDL +
Sbjct: 199 TGHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLSK 234

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 44/70 (62%), Gaps = 5/70 (7%)

Query: 132 QDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDD 191
           +DS I+A+ +G+  VFI+D     + S P+  KL+ H      + F+  ++ K++SSS+D
Sbjct: 170 KDSNILASSHGN-DVFIWDL---RHGSTPL-HKLTGHNSGVNSIDFSRFEENKIMSSSND 224

Query: 192 GSVAYWNIQK 201
           G+V +W++ K
Sbjct: 225 GTVKFWDLSK 234

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 68/156 (43%), Gaps = 23/156 (14%)

Query: 240 DVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYM 299
           D +    D    S+ D+       ++ FS   ++L A   ED LI ++D     + +  +
Sbjct: 358 DTKTGTEDANSASSADL----YIRSVCFSPDGKFL-ATGAEDKLIRIWDIAQ-RKIVMVL 411

Query: 300 RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAG 359
           RGHE  + SLD+    + +V SG  D+ + +WDL   GQ   +  IEDG       +   
Sbjct: 412 RGHEQDIYSLDYFQSGNKLV-SGSGDRTIRIWDL-HTGQCSLTLSIEDG-------VTTV 462

Query: 360 HRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSL 395
             SP        N N++ A    D  V+VW  N+  
Sbjct: 463 AVSP-------GNGNYVAAG-SLDRTVRVWDSNSGF 490

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 70/292 (23%), Positives = 122/292 (41%), Gaps = 56/292 (19%)

Query: 126 RAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKG-K 184
           R+     D   +AT   D  + I+D +        I+  L  H+++ Y L +     G K
Sbjct: 377 RSVCFSPDGKFLATGAEDKLIRIWDIA-----QRKIVMVLRGHEQDIYSLDY--FQSGNK 429

Query: 185 LLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNN 244
           L+S S D ++  W++      LTL     +  V  +  N N   YV   S      V ++
Sbjct: 430 LVSGSGDRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGN---YVAAGSLDRTVRVWDS 486

Query: 245 NNDLKIVSNHDIKTPSAFN------AMAFSFHSEYLMAASGEDSLIYLYDTRNLN----- 293
           N+   +V   D +  +         ++ F+   + +++ S  D  + L++ RN+N     
Sbjct: 487 NSGF-LVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGS-LDRSVKLWNLRNINGASTS 544

Query: 294 -QP-------LHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEI 345
            QP       + Y+ GH+D V S+     ND  ++SG  D+ V  WD             
Sbjct: 545 PQPKTEGNCEMTYI-GHKDFVLSVTTTE-NDQYILSGSKDRGVIFWD------------- 589

Query: 346 EDGDVPELLMIHAGHRSPINDFSMSN------NLNWLCASIEEDNIVQVWKM 391
           +   VP LLM+  GHR+ +   +++N      N N + A+   D   ++WK 
Sbjct: 590 KVSGVP-LLMLQ-GHRNSVISVAVANGKPLGANYN-VFATGSGDCKAKIWKF 638

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 82/176 (46%), Gaps = 19/176 (10%)

Query: 171 NGYGLAFNPLDKG-KLLSSSDDGSVAYWNIQKSIPLLTLQETSI-INDVRW--NQFN-QN 225
           N +   F PLDK   LL S  +G +   +        +++ +++ IND++   + F+  +
Sbjct: 17  NNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNLSINDLKILNSDFHCGS 76

Query: 226 LFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE----- 280
           LF   T  S + + D+ +NN  +  + N         N    S  S + + A G      
Sbjct: 77  LFSTATAES-VKIFDINSNNGPIATLHNDK-------NVPFLSLDSRHGLLAMGTELQGV 128

Query: 281 DSLIYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQ 335
           D+ I +YD R  + PL   +  H D VT+L FH  +  +++SG +D    V+DL Q
Sbjct: 129 DAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ 184

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 93/207 (44%), Gaps = 27/207 (13%)

Query: 151 TSIDENQSNPIISKLSH-HKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQ 209
           T ++   + P I +L H H++  Y +A N     KL + S DG + YWN+      ++ +
Sbjct: 48  TKLERMFAKPFIGQLGHGHRDGIYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFK 107

Query: 210 E-----TSI------INDVRWNQFNQNLFGYVTESSCLNLKDV--------RNNNNDLKI 250
                 T +       +D + +  NQN     ++   + L  +        R+++ND   
Sbjct: 108 AHYGLITGLCVTQPHFHDKKSDWKNQNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDSVT 167

Query: 251 VSNHDIKT---PSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVT 307
                ++T    SAF  +    H E    A+G  + I+L+D   L +P+  +    D++T
Sbjct: 168 NEEGLVRTFDGESAFQGI--DSHRENSTFATG-GAKIHLWDVNRL-KPISNLSWGADNIT 223

Query: 308 SLDFHALNDGIVISGGSDKRVAVWDLK 334
           S+ F+     I+ S GSD  + ++DL+
Sbjct: 224 SVRFNQNETDILASTGSDNSIVLYDLR 250

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (42%), Gaps = 7/181 (3%)

Query: 154 DENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSI 213
           D N+  PI S LS   +N   + FN  +   L S+  D S+  ++++ + P   + +T  
Sbjct: 205 DVNRLKPI-SNLSWGADNITSVRFNQNETDILASTGSDNSIVLYDLRTNSPTQKIVQTMR 263

Query: 214 INDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEY 273
            N + WN      F    E       D+RN +  L +  +H     SA   + FS   + 
Sbjct: 264 TNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLTVFKDH----VSAVMDVDFSPTGDE 319

Query: 274 LMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL 333
           ++  S + S I +Y T + +    Y       V  + + +++   +ISG  D  V +W  
Sbjct: 320 IVTGSYDKS-IRMYKTNHGHSREIYHTKRMQHVFQVKY-SMDAKYIISGSDDGNVRLWRS 377

Query: 334 K 334
           K
Sbjct: 378 K 378

>SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 769

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 39/60 (65%), Gaps = 4/60 (6%)

Query: 275 MAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
           +A   +D L+ L+D R+  Q +  ++GH D++TSL F ++N   +I+G  D+ + +WDL+
Sbjct: 630 LATGTKDGLVRLWDLRS-GQVVRTLQGHTDAITSLQFDSIN---LITGSIDRSIRIWDLR 685

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 47/98 (47%), Gaps = 17/98 (17%)

Query: 298 YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIH 357
           + + HE+S+T LDF      +  +G  D  + VWDL +  Q+QT+             + 
Sbjct: 446 FAKAHEESITCLDFDMPFGTMCTAGKLDHTIKVWDLSK--QKQTA-------------LM 490

Query: 358 AGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSL 395
           +GH + I+   M +  N L      D ++++W ++ ++
Sbjct: 491 SGHLATISCMQM-DQFNTLITG-GRDALLKLWDVDRAV 526

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 30/69 (43%), Gaps = 15/69 (21%)

Query: 275 MAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
           M  S ED+ +Y +D             H D +T+L F   N   +ISG  D+ +  WDL 
Sbjct: 536 MEDSKEDACVYTFD------------AHVDEITALSFSGDN---LISGSQDRTIRQWDLN 580

Query: 335 QIGQEQTSD 343
                QT D
Sbjct: 581 SGKCVQTID 589

>KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1299

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 93/235 (39%), Gaps = 45/235 (19%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDG 192
           D+ IIA    +G V  +  + +E +S   ++KL+ H      + FN      L S    G
Sbjct: 73  DNAIIAGALENGVVEFF--APEEPRS---VAKLAQHTTPVKTVTFNARQHNVLCSGGSKG 127

Query: 193 SVAYWNIQK--------SIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR-- 242
            +  W+  K         +P   +     I  + WNQ   ++F     S   ++ D++  
Sbjct: 128 EIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQAHVFASAGSSGYASIWDLKAK 187

Query: 243 -------------NNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDS--LIYLY 287
                           N L IV  H               +S  +  ASG DS   I ++
Sbjct: 188 KEVIHLSYASPVTGQRNQLSIVEWH-------------PNNSTRIATASGNDSDPSILIW 234

Query: 288 DTRNLNQPLHYM-RGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQT 341
           D RN N P+  + + H   V SLD+   ++ +++S G D    +W+ ++ GQ  T
Sbjct: 235 DLRNANVPMQVLSQPHTKGVLSLDWCKQDETLLLSSGRDNVCVLWNPEE-GQSLT 288

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 83/175 (47%), Gaps = 14/175 (8%)

Query: 168 HKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLF 227
           H    + + F+PL      + S D +   W+     PL        +NDV    F+ N  
Sbjct: 583 HNHPVWDVKFSPLGH-YFATGSHDQTARLWSCDHIYPLRIF--AGHLNDVDCVTFHPNGT 639

Query: 228 GYVTESS--CLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIY 285
             +T SS     + D++  ++ +++   H     ++  ++A S    +L   S ED +I 
Sbjct: 640 YVLTGSSDKTCRMWDIQTGDS-VRLFLGHT----ASVVSVAVSPDGRWLTTGS-EDGVII 693

Query: 286 LYDTRNLNQPLHYMRGH-EDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQE 339
           ++D     + +  MRGH + +V SL F+   + I++SGG+D+ V VWDLK+   E
Sbjct: 694 VWDI-GTGKRIKQMRGHGKSAVYSLSFNKEGN-ILVSGGADQSVRVWDLKKFTNE 746

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 86/386 (22%), Positives = 147/386 (38%), Gaps = 103/386 (26%)

Query: 15  EEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGT 74
           EE++P+T  Q+ +L  +N            +  P+L    LP   T ++    QR+    
Sbjct: 425 EEKKPVTKAQQPQLEDAN------------MESPALDALPLPPKTTLDIKLEVQRV---- 468

Query: 75  HTSGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQDS 134
               E ++ +K+  + L    +   T  N+++ + S      +F  +  +  A +  QDS
Sbjct: 469 ---KESRDAIKLDNLQLALPSVCMYTFHNTNRDMTS-----LEFSDDCRLAAAGF--QDS 518

Query: 135 TI-IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGS 193
            I + +++G      YD  + E+ ++     L  H    Y  +F+P D   L+SSS+D +
Sbjct: 519 QIKLFSLDGSPLGNRYDPDLPEDATS---KTLVGHSGTVYSTSFSP-DNRYLVSSSEDKT 574

Query: 194 VAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSN 253
           V  W++                               T S+ ++ K             N
Sbjct: 575 VRLWSLD------------------------------THSALVSYKG-----------HN 593

Query: 254 H---DIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLD 310
           H   D+K         FS    Y   AS  D    L+   ++  PL    GH + V  + 
Sbjct: 594 HPVWDVK---------FSPLGHYFATAS-HDHTARLWSCDHI-YPLRIFAGHLNDVDCVS 642

Query: 311 FHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMS 370
           FH  N   + +G SDK   +WD            I  GD   L +   G  +P+    +S
Sbjct: 643 FHP-NGCYLFTGSSDKTCRMWD------------IATGDCVRLFL---GLTAPVISTCVS 686

Query: 371 NNLNWLCASIEEDNIVQVWKMNNSLR 396
            +  WL ++  ED I+ VW +    R
Sbjct: 687 PDGRWL-STGSEDGIINVWDIGTGKR 711

>TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2.663
           YKL021C
          Length = 406

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 79/186 (42%), Gaps = 24/186 (12%)

Query: 186 LSSSDDGSVAYWNIQ--KSIPLLTLQETSIIND-VRWNQFNQNLFGYVTESSCLNLKDVR 242
           +S SDD S+  WN+   K   +L L++ S     VRW   N + F     +  L  K   
Sbjct: 160 VSVSDDHSIRLWNLMTVKKAAVLKLRKYSQNGQFVRWLG-NGDFFAVALLNKVLIYK--- 215

Query: 243 NNNNDLKIVSNHDIKTPSAFNAM------AFSFHSEYLMAASGEDSLIYLYDTRNLNQ-- 294
              +  K+V   DI+  +  +        A     EYL+    E S+ + Y T+   +  
Sbjct: 216 --TSTAKVVKEIDIEKKTIMHMEVEKLNDANGSEDEYLVVGLSEGSICF-YMTKEFQEES 272

Query: 295 -----PLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKRVAVWDLKQIGQEQTSDEIEDG 348
                P   + GH + V    F+A   G  ++S GSD ++ VWDLK  G++    ++   
Sbjct: 273 EDKVAPAFVLLGHTNRVKDFKFYANEFGKYLVSIGSDGKIVVWDLKLTGKDTERQQVAIF 332

Query: 349 DVPELL 354
           D  E L
Sbjct: 333 DSGERL 338

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/224 (21%), Positives = 91/224 (40%), Gaps = 43/224 (19%)

Query: 160 PIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNI--QKSIPLLTLQETSIINDV 217
           P +     H +    L+F   D   L+S S D  + +W++   K +  L L  T   ND 
Sbjct: 417 PCLHNFELHSDEITALSF---DSEALISGSKDRKILHWDLVTGKCVQQLDLIVTPTYNDT 473

Query: 218 RWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHD--IKTPSAFNAMAFSFHSEYLM 275
           + +                     R+ NN   ++ +    I     +N+          +
Sbjct: 474 KVS--------------------ARSANNSTSVLGSEAPMIGALQCYNSA---------L 504

Query: 276 AASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQ 335
           A+  +D ++ L+D R + +P+  + GH D +TSL F +     +++G  D  V +WDL+ 
Sbjct: 505 ASGTKDGVVRLWDLR-IGKPVRALEGHTDGITSLKFDSEK---LVTGSMDNSVRIWDLRT 560

Query: 336 ---IGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWL 376
              I        I   D  + L+    + + +N F+M  + +W+
Sbjct: 561 SSIIDVIAYDLPITSLDFDDKLITVGANETGVNVFNMERDEHWM 604

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 43/84 (51%), Gaps = 2/84 (2%)

Query: 261 AFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVI 320
           +  A+ F      L ++S +D ++ ++D  N  + +  + GH  +V  +    +N  ++I
Sbjct: 323 SITALDFDRPWGTLCSSSYQDRIVKVWDL-NHGEQVGELPGHLATVNCMQMDRVNYNMLI 381

Query: 321 SGGSDKRVAVWDLKQIGQEQTSDE 344
           +G  D  + +WDL  + +E  SD+
Sbjct: 382 TGSKDATLKMWDL-NLSKELYSDQ 404

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 41/92 (44%), Gaps = 17/92 (18%)

Query: 302 HEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHR 361
           H +S+T+LDF      +  S   D+ V VWDL     EQ       G++P       GH 
Sbjct: 320 HGNSITALDFDRPWGTLCSSSYQDRIVKVWDLNH--GEQV------GELP-------GHL 364

Query: 362 SPINDFSMSN-NLNWLCASIEEDNIVQVWKMN 392
           + +N   M   N N L     +D  +++W +N
Sbjct: 365 ATVNCMQMDRVNYNMLITG-SKDATLKMWDLN 395

>TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.67
           YFL009W
          Length = 862

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 60/134 (44%), Gaps = 22/134 (16%)

Query: 266 AFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSD 325
              F   Y++  + +D +I +YD++ L + L  + GH+  V +L +    DGI++SG +D
Sbjct: 446 CLQFEDNYIITGA-DDRMIRVYDSK-LKKFLLELAGHDGGVWALKYDE--DGILVSGSTD 501

Query: 326 KRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPIN--DFSMSNNLNWLCASIEED 383
           + V VWD+K+                    I  GH S +   D     N  ++      D
Sbjct: 502 RTVRVWDIKRGCCTH---------------IFKGHTSTVRCLDIVKYKNTKYIITG-SRD 545

Query: 384 NIVQVWKMNNSLRE 397
             + VWK+  S+ E
Sbjct: 546 TTLHVWKLPYSVEE 559

 Score = 37.0 bits (84), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 59/271 (21%), Positives = 101/271 (37%), Gaps = 80/271 (29%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           I T   D  + +YD+ + +      + +L+ H    + L ++  + G L+S S D +V  
Sbjct: 454 IITGADDRMIRVYDSKLKK-----FLLELAGHDGGVWALKYD--EDGILVSGSTDRTVRV 506

Query: 197 WNIQKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDI 256
           W+I++       +                  G+ +   CL++  V+  N    I  + D 
Sbjct: 507 WDIKRGCCTHIFK------------------GHTSTVRCLDI--VKYKNTKYIITGSRDT 546

Query: 257 KTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHY------------MRGHED 304
                      + H   L  +  E   I L   + +N+P+ Y            +RGH  
Sbjct: 547 -----------TLHVWKLPYSVEEYDDIKL---KTINEPILYQTTQDNPFFVGILRGHLA 592

Query: 305 SVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHR--- 361
           SV ++  H     IV+SG  D  + VWD+ Q+               + L I  GH    
Sbjct: 593 SVRTVSGHG---NIVVSGSYDNNLIVWDIIQM---------------KCLYILTGHTDRI 634

Query: 362 -SPINDFSMSNNLNWLCASIEEDNIVQVWKM 391
            S I D   S      C S   D+ ++VW +
Sbjct: 635 YSTIYDHKRSR-----CISASMDSTIRVWDL 660

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (58%)

Query: 275 MAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWD 332
           + AS   + +Y++D R    PLH ++GH +SV S+DF   ++  ++S  +D  V  WD
Sbjct: 173 VMASAHSNDVYIWDLRKGCTPLHVLQGHVNSVNSIDFSKFDETEIMSSSNDGTVKFWD 230

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/62 (20%), Positives = 33/62 (53%)

Query: 273 YLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWD 332
           ++++ S + +L++     + +   H + GH  ++T ++FH  +  I+ +   D  V  WD
Sbjct: 84  WVISTSNQKALLWNLSRNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWD 143

Query: 333 LK 334
           ++
Sbjct: 144 MR 145

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 83/175 (47%), Gaps = 14/175 (8%)

Query: 168 HKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLF 227
           H    + + F+PL      + S D +   W+     PL        +NDV    F+ N  
Sbjct: 568 HNHPVWDVKFSPLGH-YFATVSHDQTARLWSCDHIYPLRIF--AGHLNDVDCVAFHPNGT 624

Query: 228 GYVTESS--CLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIY 285
             +T SS     + D++  ++ +++   H     ++  ++A S    +L   S ED +I 
Sbjct: 625 YVLTGSSDKTCRMWDIQTGDS-VRLFLGHT----ASVVSVAVSPDGRWLTTGS-EDGVII 678

Query: 286 LYDTRNLNQPLHYMRGH-EDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQE 339
           ++D     + +  MRGH + +V SL F+   + I++SGG+D+ V VWDLK+   E
Sbjct: 679 VWDI-GTGKRIKQMRGHGKSAVNSLSFNKEGN-ILVSGGADQSVRVWDLKKFTNE 731

>YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}
           RSA4WD-repeat protein involved in ribosome biogenesis;
           may interact with ribosomes; required for maturation and
           efficient intra-nuclear transport or pre-60S ribosomal
           subunits, localizes to the nucleolus
          Length = 515

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/299 (19%), Positives = 116/299 (38%), Gaps = 66/299 (22%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D  +IAT + D T+ ++D    +   +     L  H +    L++ P+       K +L 
Sbjct: 197 DGEVIATGSMDNTIRLWDPKSGQCLGD----ALRGHSKWITSLSWEPIHLVKPGSKPRLA 252

Query: 187 SSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           SSS DG++  W+    +   T+   T+ ++ V+W    Q L    +    + + D+ +  
Sbjct: 253 SSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWG--GQGLLYSGSHDRTVRVWDINSQG 310

Query: 246 NDLKIVSNH-------DIKTPSAFNAMAFSF---------------------------HS 271
             + I+ +H        + T  A    AF                             +S
Sbjct: 311 RCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENYEKICKKNGNS 370

Query: 272 EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKRVAV 330
           E +M  + +D  ++L++     +P+  M GH+  V  + F    DG  ++S   D  + +
Sbjct: 371 EEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSP--DGRYIVSASFDNSIKL 428

Query: 331 WDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
           WD +            DG   + +    GH + +   + S++   L  S  +D  ++VW
Sbjct: 429 WDGR------------DG---KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 471

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 76/149 (51%), Gaps = 11/149 (7%)

Query: 185 LLSSSDDGSVAYWNIQKSI-PLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           ++++SDD ++  WN  KS  P+  +     ++N V ++   + +     ++S + L D R
Sbjct: 374 MVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNS-IKLWDGR 432

Query: 243 NNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGH 302
               D K +S       S +  +A+S     L++ S +D+ + ++D R     +  + GH
Sbjct: 433 ----DGKFISTFRGHVASVYQ-VAWSSDCRLLVSCS-KDTTLKVWDVRTRKLSVD-LPGH 485

Query: 303 EDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           +D V ++D+ +++   V SGG DK V +W
Sbjct: 486 KDEVYTVDW-SVDGKRVCSGGKDKMVRLW 513

>Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]
           {ON} YJL112W (MDV1) - Involved in mitochondrial division
           [contig 260] FULL
          Length = 721

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 37/60 (61%), Gaps = 4/60 (6%)

Query: 275 MAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
           MA   +D L+ L+D R+  Q +  + GH D+VT L F ++N   +++G  D+ + +WDL+
Sbjct: 583 MATGTKDGLVRLWDLRS-GQVIRTLEGHTDAVTGLQFDSVN---LVTGSLDRSIRIWDLR 638

>NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1134

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 68/141 (48%), Gaps = 11/141 (7%)

Query: 197 WNIQKS----IPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVS 252
           WN+ KS    I  +    +  I D+ +N  N ++    +  + ++  D+R+ +      S
Sbjct: 95  WNLAKSSSDAIEHVLHGHSRAITDINFNPENPDILATCSIDTYVHAWDMRSPHKPFYSTS 154

Query: 253 NHDIKTPSAFNAMAFSFHSEYLMAAS-GEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDF 311
                  S+ + + ++F    ++A+S G D  ++++D RN + PL  + GHE SV S+DF
Sbjct: 155 ----AWRSSASQVKWNFKDSNILASSHGND--VFIWDLRNGSTPLCQLVGHESSVNSIDF 208

Query: 312 HALNDGIVISGGSDKRVAVWD 332
                  ++S  +D  V  WD
Sbjct: 209 SRFKSTEIMSSSNDGTVKFWD 229

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 41/67 (61%), Gaps = 5/67 (7%)

Query: 132 QDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDD 191
           +DS I+A+ +G+  VFI+D     N S P+  +L  H+ +   + F+     +++SSS+D
Sbjct: 168 KDSNILASSHGN-DVFIWDL---RNGSTPLC-QLVGHESSVNSIDFSRFKSTEIMSSSND 222

Query: 192 GSVAYWN 198
           G+V +W+
Sbjct: 223 GTVKFWD 229

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 14/62 (22%), Positives = 33/62 (53%)

Query: 273 YLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWD 332
           ++++ S + +LI+     + +   H + GH  ++T ++F+  N  I+ +   D  V  WD
Sbjct: 83  WVVSTSNQKALIWNLAKSSSDAIEHVLHGHSRAITDINFNPENPDILATCSIDTYVHAWD 142

Query: 333 LK 334
           ++
Sbjct: 143 MR 144

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1333

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 41/204 (20%), Positives = 80/204 (39%), Gaps = 41/204 (20%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           +A  +    + IYD +  ++ +NP++S    H  +     FN +    ++S   DG +  
Sbjct: 195 VAVSSNSTVISIYDINRSKSTNNPLVSSFQQHTRSINSFDFNMVHTNLIISGGQDGCIKI 254

Query: 197 WNIQKSIP----LLTLQETSIINDVRW---NQFNQNLFGYVTESSCLNLKDVRNNNNDLK 249
           W+++ + P    +     +  + DV+W   + F+    G +  SS               
Sbjct: 255 WDLRSNNPNRCDVSISTSSDSVRDVKWMPYHNFSSTPTGGLEASS--------------- 299

Query: 250 IVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSL 309
                        N+M + F      A+  +  L+  +D R  NQ    +  H      L
Sbjct: 300 ------------ENSMGYKF------ASIHDSGLLLKFDIRQPNQVEQKINAHTGPGLCL 341

Query: 310 DFHALNDGIVISGGSDKRVAVWDL 333
           ++H  N   + +GG D ++ VW+L
Sbjct: 342 NWHP-NLNYITTGGRDGKLCVWNL 364

>Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W
           (REAL)
          Length = 391

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 58/128 (45%), Gaps = 22/128 (17%)

Query: 266 AFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSD 325
              F   Y++  + +D +I +YD  N  + L  + GH+  V +L +   +DGI++SG +D
Sbjct: 32  CLQFEDNYVITGA-DDKMIRVYDAIN-KKFLLQLSGHDGGVWALKYS--HDGILVSGSAD 87

Query: 326 KRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPIN--DFSMSNNLNWLCASIEED 383
             V VWD+K+                    +  GH+S +   D     N N++      D
Sbjct: 88  STVRVWDIKK---------------GYCTHVFEGHKSTVRCLDIVEYENTNYIVTG-SRD 131

Query: 384 NIVQVWKM 391
           N + VWK+
Sbjct: 132 NTLHVWKL 139

 Score = 37.7 bits (86), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 96/238 (40%), Gaps = 61/238 (25%)

Query: 164 KLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFN 223
           +LS H    + L ++    G L+S S D +V  W+I+K                    + 
Sbjct: 62  QLSGHDGGVWALKYS--HDGILVSGSADSTVRVWDIKKG-------------------YC 100

Query: 224 QNLF-GYVTESSCLNLKDVRNNNNDLKIVSN------HDIKTPSAFNAMAFSFHSEY-LM 275
            ++F G+ +   CL++ +  N N    IV+       H  K P   +A  +    +Y L+
Sbjct: 101 THVFEGHKSTVRCLDIVEYENTN---YIVTGSRDNTLHVWKLPKKSSATDYENEHDYPLL 157

Query: 276 AASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQ 335
             + E++  ++            +RGH   V ++  H     IV+SG  D  + VWD+ Q
Sbjct: 158 FHTPEENPYFV----------GVLRGHTALVRAVSGHG---NIVVSGSYDNTLIVWDVAQ 204

Query: 336 IGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNN 393
           +               + L I +GH   +   ++ ++    C S   D  +++W +NN
Sbjct: 205 M---------------KCLCILSGHTDRVYS-ALYDHERKRCISASMDTTIKIWDLNN 246

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 4/87 (4%)

Query: 262 FNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVIS 321
             ++ FS   ++L A   ED LI ++D     + +  ++GHE  + SLD+    + +V S
Sbjct: 430 IRSVCFSPDGKFL-ATGAEDRLIRIWDIAQ-KKIIMVLQGHEQDIYSLDYFPSGEKLV-S 486

Query: 322 GGSDKRVAVWDLKQIGQEQTSDEIEDG 348
           G  D+ V +WDL+  GQ   +  IEDG
Sbjct: 487 GSGDRTVRIWDLR-TGQCSLTLSIEDG 512

 Score = 37.0 bits (84), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 61/272 (22%), Positives = 109/272 (40%), Gaps = 68/272 (25%)

Query: 126 RAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKL 185
           R+     D   +AT   D  + I+D +        II  L  H+++ Y L + P  + KL
Sbjct: 431 RSVCFSPDGKFLATGAEDRLIRIWDIA-----QKKIIMVLQGHEQDIYSLDYFPSGE-KL 484

Query: 186 LSSSDDGSVAYWNIQKSIPLLTLQ-------------------ETSIINDVR-WNQF--- 222
           +S S D +V  W+++     LTL                      S+   VR W+     
Sbjct: 485 VSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSETGF 544

Query: 223 ------NQNLFGYVTESSCLNLKDVRNNNN-------------DLKIVSNHDIK--TPSA 261
                 ++N  G   + S  ++   R+ NN             +L   +N D+K   P  
Sbjct: 545 LVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLNDANNKDLKPNVPGT 604

Query: 262 FN-----------AMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSL- 309
                        ++A +   EY+++ S +D  +  +DT++ N PL  ++GH +SV S+ 
Sbjct: 605 CEVTYTGHKDFVLSVATTQGDEYILSGS-KDRGVLFWDTKSGN-PLLMLQGHRNSVISVA 662

Query: 310 --DFHALND--GIVISGGSDKRVAVWDLKQIG 337
             + H L    G+  +G  D +  +W  ++I 
Sbjct: 663 VANGHPLGTEYGVFATGSGDCKARIWKYRKIA 694

>NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa]
           {ON} Anc_1.247 YJL112W
          Length = 668

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 46/103 (44%), Gaps = 17/103 (16%)

Query: 291 NLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGD 349
           NL   +H +   H DS+T LDF    + +  +   D  V +WDL                
Sbjct: 338 NLGDKIHSFKSAHTDSITCLDFAKSWNTLCTAANYDNTVKIWDLS--------------- 382

Query: 350 VPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMN 392
             E L   +GH++ IN   MSNN N L  +  +D  V+VW ++
Sbjct: 383 TTEQLGSFSGHKATINCLQMSNN-NSLLMTGSKDATVKVWNID 424

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 56/256 (21%), Positives = 94/256 (36%), Gaps = 51/256 (19%)

Query: 115 IKKFK--HELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENG 172
           I  FK  H   +T   +    +T+    N D TV I+D S  E      +   S HK   
Sbjct: 343 IHSFKSAHTDSITCLDFAKSWNTLCTAANYDNTVKIWDLSTTEQ-----LGSFSGHKATI 397

Query: 173 YGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPL--------------------------- 205
             L  +  +   L++ S D +V  WNI   I L                           
Sbjct: 398 NCLQMSN-NNSLLMTGSKDATVKVWNIDLGIELAKKENNQLEEKDESPCVLTFDSHSDEI 456

Query: 206 --LTLQETSIINDVRWNQFNQN--LFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSA 261
             L+     +I+  R     Q   + G   ++   N   +   N D+ +  N  +     
Sbjct: 457 TALSFDGEYLISASRDKTVRQYDIISGKCFQTLATNFGSISKTNGDMLMSRNSPV----- 511

Query: 262 FNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVIS 321
               A  +++  L+  S  D +  L+D R + + +  M GH  ++TSL F  +    + +
Sbjct: 512 --VGALQYYNTALITGSS-DGIARLWDLR-IGKVVRSMEGHNGAITSLQFDPIK---LTT 564

Query: 322 GGSDKRVAVWDLKQIG 337
             +D  + VWDL+  G
Sbjct: 565 SSTDGDIRVWDLRTAG 580

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 74/177 (41%), Gaps = 36/177 (20%)

Query: 160 PIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQ--KSIPLLTLQETSIINDV 217
           P I     HK+    L+F   D   L+S S D  + +W++   K I  L L  T   +D+
Sbjct: 415 PCIHNFELHKDEITALSF---DSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDI 471

Query: 218 RWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAA 277
           +    + N        +CL                   + T +        ++S   +A 
Sbjct: 472 KMPARSLN------NGACL-------------------LGTEAPMIGALQCYNSA--LAT 504

Query: 278 SGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
             +D ++ L+D R + +P+  + GH D +TSL F +     +++G  D  V +WDL+
Sbjct: 505 GTKDGIVRLWDLR-VGKPVRLLEGHTDGITSLKFDSEK---LVTGSMDNSVRIWDLR 557

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 42/94 (44%), Gaps = 17/94 (18%)

Query: 302 HEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHR 361
           H +S+T+LDF      +  S   D+ V VWDL           I+ G++P       GH 
Sbjct: 318 HGNSITALDFDTPWGTLCSSSYQDRIVKVWDLNH--------GIQVGELP-------GHL 362

Query: 362 SPINDFSM-SNNLNWLCASIEEDNIVQVWKMNNS 394
           + +N   +   N N L     +D  +++W +N S
Sbjct: 363 ATVNCMQIDKKNYNMLITG-SKDATLKLWDLNLS 395

>NDAI0F03380 Chr6 (813767..815455) [1689 bp, 562 aa] {ON} Anc_2.73
           YNL182C
          Length = 562

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 18/112 (16%)

Query: 263 NAMAFSFHSEYLMAASGEDSLIYLYDTRN---LN-QPLHYMRGHEDSVTSLDFHALNDGI 318
           NA    F   YL+ AS E   +Y+++  +   LN +P+     H  S+T +    +N   
Sbjct: 91  NAAVADFDLPYLLLASTESGKLYIWELNSGILLNVKPM----AHYQSITKIK-SIMNGKY 145

Query: 319 VISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMS 370
           VI+ G+D RV +W        QT D IE  D   + ++H  H  P+ DF +S
Sbjct: 146 VITSGNDARVIIW--------QTMDLIEQDDPKPICILH-DHSLPVTDFQVS 188

>Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W
           (CDC4) - 1:1 [contig 7] FULL
          Length = 744

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 65/302 (21%), Positives = 112/302 (37%), Gaps = 77/302 (25%)

Query: 117 KFKHELEVTRAHYMP-------QDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHK 169
           KFK      R H M        +D  +I   + D  + +YD      ++   I++LS H 
Sbjct: 357 KFKPHRTTLRGHTMKIVTCLQFEDDYVITGAD-DKMIRVYDA-----KTEKFITQLSGHD 410

Query: 170 ENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVRWNQFNQNLFGY 229
              + L +     G L+S S D SV  WNI+                    +      G+
Sbjct: 411 GGVWALKYG--HDGILVSGSTDRSVRVWNIKS------------------GKCTHVFKGH 450

Query: 230 VTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGED---SLIYL 286
            +   CL++  V +N     +  + D            + H   L   + ED    +  +
Sbjct: 451 TSTVRCLDI--VEHNGKKFIVTGSRD-----------HTLHVWKLPNCNAEDYNPEVCEV 497

Query: 287 YDTRNLNQP-LHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEI 345
           ++T + N   +  +RGH  +V ++  H     IV+SG  D  + VWD+ Q+         
Sbjct: 498 FNTTDANPYFVGVLRGHMAAVRTVSGHG---NIVVSGSYDFNLMVWDIAQM--------- 545

Query: 346 EDGDVPELLMIHAGHR----SPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLREDPLV 401
                 + L +  GH     S I D+  +      C S   D+ V+VW + +  +  P  
Sbjct: 546 ------KCLYVLTGHTDRIYSTIYDYQRNR-----CISAGMDSTVKVWDLADVSKNGPCT 594

Query: 402 NM 403
            +
Sbjct: 595 TI 596

>Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON}
           YDR142C (REAL)
          Length = 376

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 83/183 (45%), Gaps = 30/183 (16%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           +    GDGT+ ++DTS+ E      I+    H+   +   +N +++   LSSS DGS+  
Sbjct: 76  VLVAQGDGTLRLFDTSLKEYP----IAIFKEHEREVFSCNWNLVNRQNFLSSSWDGSIKI 131

Query: 197 WNIQKSIPLLT-----LQETSIINDVRWNQFNQNLFGYVTES-SCLNLKDVRNNNNDLKI 250
           W+  +   L++     L+ T +++ +     N+  F  ++++ +C+       ++ +L I
Sbjct: 132 WSPLRKQSLMSLTPRPLEITKMVDPLNAILLNKKKFAGISKNRNCVYQAQFSPHDQNLII 191

Query: 251 -------VSNHDIKTPSAFNAMAFSFHS-------------EYLMAASGEDSLIYLYDTR 290
                   S  DI+ P + +   F  HS              Y++A  G D+ I ++D R
Sbjct: 192 SCSGNSYASLFDIRLPPSKSQSNFLVHSGLEALTCDFNKYRPYVVATGGVDNAIRIWDIR 251

Query: 291 NLN 293
            LN
Sbjct: 252 MLN 254

>Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON}
           YDR142C (REAL)
          Length = 377

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/253 (21%), Positives = 101/253 (39%), Gaps = 53/253 (20%)

Query: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196
           +    GDGT+ ++DT++ E      I+    H+   +   +N +++   LSSS DGS+  
Sbjct: 76  VLVAQGDGTLRLFDTTLKEYP----IAIFKEHEREVFSCNWNLVNRQTFLSSSWDGSIKI 131

Query: 197 WNIQKSIPLLTLQETSI--------INDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDL 248
           W+  +S  L++L    +        +N +  N+  +N  G     +C+       ++ +L
Sbjct: 132 WSPLRSQSLMSLTPRPLEITKMVDPLNAILSNK-KKNFTGISQNKNCVYQAQFSPHDQNL 190

Query: 249 KI-------VSNHDIKTPSAFNAMAFSFHS-------------EYLMAASGEDSLIYLYD 288
            I        S  DI+ P + +   F  HS              Y++A  G D+ I ++D
Sbjct: 191 VISCSGNSYASLFDIRLPPSRSQTNFLVHSGLEALTCDFNKYRPYVIATGGVDNAIRIWD 250

Query: 289 TRNL--------NQPLHYMR-----------GHEDSVTSLDFHALNDGIVISGGSDKRVA 329
            R L         +P H               H  ++  + +   +  I++S   D    
Sbjct: 251 IRMLKTSGSATTGRPTHTSSHNSACINEIPNAHGLAIRKVTWSPHHSNILMSASYDMTCR 310

Query: 330 VW-DLKQIGQEQT 341
           VW DL   G ++T
Sbjct: 311 VWKDLSNDGAKET 323

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 94/207 (45%), Gaps = 27/207 (13%)

Query: 151 TSIDENQSNPIISKLSH-HKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQ 209
           T ++   + P + +L + H++  Y +A N     KL + S DG + YWN+      ++ +
Sbjct: 48  TKLERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTREEFVSFK 107

Query: 210 ETS------IINDVRWNQFNQNLFGYVTESSC----------LNLKDVRN-NNNDLKIVS 252
                     +   R++    +L       SC          +N+ D  N N++D   V+
Sbjct: 108 AHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSINVDDYSNKNSSDNDSVT 167

Query: 253 NHD--IKT---PSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVT 307
           N +  I+T    SAF  +    H E    A+G  + I+L+D   L +P+  +    D++T
Sbjct: 168 NEEGLIRTFDGESAFQGI--DSHRENSTFATG-GAKIHLWDVNRL-KPVSDLSWGADNIT 223

Query: 308 SLDFHALNDGIVISGGSDKRVAVWDLK 334
           SL F+     I+ S GSD  + ++DL+
Sbjct: 224 SLKFNQNETDILASTGSDNSIVLYDLR 250

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 77/181 (42%), Gaps = 7/181 (3%)

Query: 154 DENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSI 213
           D N+  P+ S LS   +N   L FN  +   L S+  D S+  ++++ + P   + +T  
Sbjct: 205 DVNRLKPV-SDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLRTNSPTQKIVQTMR 263

Query: 214 INDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEY 273
            N + WN      F    E       D+RN +  L +  +H     SA   + FS   + 
Sbjct: 264 TNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDH----VSAVMDVDFSPTGDE 319

Query: 274 LMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL 333
           ++  S + S I +Y T + +    Y       V  + + +++   +ISG  D  V +W  
Sbjct: 320 IVTGSYDKS-IRIYKTNHGHSREIYHTKRMQHVFQVKY-SMDSKYIISGSDDGNVRLWRS 377

Query: 334 K 334
           K
Sbjct: 378 K 378

>KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON} 
          Length = 450

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 71/175 (40%), Gaps = 19/175 (10%)

Query: 181 DKGKLLSSSDDGSVAYWNIQKSIPLLTLQE--------TSIINDVRWNQFNQNLFGYVTE 232
           D   +++ S +GS+A++     +P+  +QE         +I + VR +    + FG    
Sbjct: 131 DDSTIIAMSKNGSLAWFRDGIKVPIHIVQEMMGPMTSYAAIHSHVRPDDLAVSDFGLNVN 190

Query: 233 SSCLNLKDVRNNNND--LKIVSN--------HDIKTPSAFNAMAFSFHSEYLMAASGEDS 282
              L          D  LKI+ N          IK P         F   YL     +D+
Sbjct: 191 LDTLVKSQSNGTEEDSILKIIDNSGKPGDILRTIKVPDTTVTHTVRFFDNYLFGTCSDDN 250

Query: 283 LIYLYDTRNLNQPLHYMRGHEDS-VTSLDFHALNDGIVISGGSDKRVAVWDLKQI 336
            I  +DTR   +PL  +   ++  +TS D   +   + ++G S   + +WD++ +
Sbjct: 251 TIRFWDTRTSEKPLFVLTQPKNGRITSFDTSQITGELFVTGTSTGVIKLWDVRAV 305

>Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {ON}
           YKR036C (REAL)
          Length = 662

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 36/60 (60%), Gaps = 4/60 (6%)

Query: 275 MAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
           +A   +D ++ L+D R + +P+  +RGH D +TSL F +     +++G  D  V +WDL+
Sbjct: 521 LATGTKDGIVRLWDLR-VGKPVRLLRGHTDGITSLKFDSEK---LVTGSMDNSVRIWDLR 576

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 261 AFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVI 320
           +  A+ F      L ++S +D ++ ++D ++  Q +  + GH  +V  +   A N  ++I
Sbjct: 340 SITALDFDIPWGTLCSSSYQDRIVKVWDLKSGGQ-VGELPGHLATVNCMQLDAANHNMLI 398

Query: 321 SGGSDKRVAVWDL 333
           +G  D  + +WDL
Sbjct: 399 TGSKDATLKLWDL 411

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 15/93 (16%)

Query: 302 HEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHR 361
           H +S+T+LDF      +  S   D+ V VWDLK  GQ         G++P       GH 
Sbjct: 337 HGNSITALDFDIPWGTLCSSSYQDRIVKVWDLKSGGQV--------GELP-------GHL 381

Query: 362 SPINDFSMSNNLNWLCASIEEDNIVQVWKMNNS 394
           + +N   +    + +  +  +D  +++W +N S
Sbjct: 382 ATVNCMQLDAANHNMLITGSKDATLKLWDLNLS 414

>TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.247
           YKR036C
          Length = 719

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 38/60 (63%), Gaps = 4/60 (6%)

Query: 275 MAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
           +A   +D ++ L+D R+   P+  + GH D+VT+L F + +   +++  SDK+V +WDL+
Sbjct: 574 LATGTKDGIVRLWDLRS-GVPVRTLEGHTDAVTALKFDSSS---IVTASSDKQVRIWDLR 629

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 2/85 (2%)

Query: 257 KTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALND 316
           K  S  N +   F  E   +  G  +L + YD+ +    L +   H + V+ LDF     
Sbjct: 359 KRKSKQNKLQLFFDEELGKSKKGRTTLQHHYDSGD--NILTFKGAHANGVSCLDFDVPFG 416

Query: 317 GIVISGGSDKRVAVWDLKQIGQEQT 341
            +  +G  D  V VWDL +  Q  T
Sbjct: 417 TLSTAGYLDPIVKVWDLTRKVQMAT 441

>YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}
           PEX7Peroxisomal signal receptor for the N-terminal
           nonapeptide signal (PTS2) of peroxisomal matrix
           proteins; WD repeat protein; defects in human homolog
           cause lethal rhizomelic chondrodysplasia punctata (RCDP)
          Length = 375

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 95/219 (43%), Gaps = 35/219 (15%)

Query: 102 DNSDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPI 161
           D S + V+ N  + +    +L    +H   ++  ++A   GDGT+ ++DT+  E      
Sbjct: 46  DRSGRIVEVNSFLTQDCLFDLAWNESH---ENQVLVA--QGDGTLRLFDTTFKEFP---- 96

Query: 162 ISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLT-----LQETSIIND 216
           I+    H+   +   +N +++   LSSS DGS+  W+  +   L+T     L+ T +++ 
Sbjct: 97  IAIFKEHEREVFSCNWNLVNRQNFLSSSWDGSIKIWSPLRKQSLMTLTPRPLEITKMVDP 156

Query: 217 VRWNQFNQNLF-GYVTESSCLNLKDVRNNNNDLKI-------VSNHDIKTPSAFNAMAFS 268
           +      +  F G     +C+       ++ +L +        S  DI+ PS  N   F 
Sbjct: 157 LNAIILKKKSFTGISKNRNCVYQAQFSPHDQNLVLSCSGNSYASLFDIRLPSGKNQNNFL 216

Query: 269 FHS-------------EYLMAASGEDSLIYLYDTRNLNQ 294
            HS              Y++A  G D+ I ++D R LN+
Sbjct: 217 VHSGLEALTCDFNKYRPYVVATGGVDNAIRIWDIRMLNK 255

>KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3.22
           YOL138C
          Length = 1365

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/198 (20%), Positives = 78/198 (39%), Gaps = 41/198 (20%)

Query: 145 TVFIYDTSIDENQS--NPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKS 202
           T+ I+D     + S  NP+++  + H  +  G  FN +    ++S   D  V  W+I+ +
Sbjct: 246 TISIFDIVKPPSSSEFNPVVTSFNGHTRSVNGFDFNMIQTNLIISGGQDACVKIWDIRTN 305

Query: 203 ---------IPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSN 253
                    I + T  ++  I D++W                +   ++  NN+D      
Sbjct: 306 TRKDSSRSDINITTSYDS--IRDIKW----------------MPGSNILANNSD------ 341

Query: 254 HDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHA 313
                PS++ +     HS Y  A+  +   +  +D R  NQ    +  H      L++H 
Sbjct: 342 -----PSSYGSYGVRSHSGYKFASIHDSGTVLKFDLRQPNQFEKKINAHTGPGLCLNWHP 396

Query: 314 LNDGIVISGGSDKRVAVW 331
            N   + +GG D +  +W
Sbjct: 397 -NQDYIATGGRDGKCCLW 413

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 43/99 (43%), Gaps = 14/99 (14%)

Query: 242 RNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYD------TRNLNQP 295
           R N+  LK+ +  D+K         F  +  Y  A     + I ++D      +   N  
Sbjct: 213 RRNSRQLKLSTIADVK-------CGFQNYRNY-AAICTNSTTISIFDIVKPPSSSEFNPV 264

Query: 296 LHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
           +    GH  SV   DF+ +   ++ISGG D  V +WD++
Sbjct: 265 VTSFNGHTRSVNGFDFNMIQTNLIISGGQDACVKIWDIR 303

>Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W
           (CDC20) - anaphase promoting complex subunit [contig
           237] FULL
          Length = 574

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 48/95 (50%), Gaps = 6/95 (6%)

Query: 135 TIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSV 194
           T+IAT +  G + I D  I     N I+S    HK    G+A+ P D  +L S S+D +V
Sbjct: 332 TLIATGSKSGEIHINDVRIK----NHIVSTWEEHKGEVCGIAYRP-DGLQLASGSNDNTV 386

Query: 195 AYWNIQKSIPL-LTLQETSIINDVRWNQFNQNLFG 228
           A W+ + S+P  +  Q T+ +  + W+    NL  
Sbjct: 387 AIWDTRTSLPQHIKRQHTAAVKALAWSPDISNLLA 421

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 60/299 (20%), Positives = 115/299 (38%), Gaps = 66/299 (22%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLL 186
           D  +IAT + D T+ +++    E   +     L  H +    L++ P+       K +L 
Sbjct: 197 DGEVIATGSMDNTIRLWNPKTGECLGD----ALRGHSKWITCLSWEPIHLVKPGSKPRLA 252

Query: 187 SSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNN 245
           SSS DG++  W+    +   TL   T+ ++ V+W    Q L    +    + + D+ +  
Sbjct: 253 SSSKDGTIKIWDSVNRVCQYTLSGHTNSVSCVKWG--GQGLLYSGSHDRTVRVWDMNSQG 310

Query: 246 NDLKIVSNH-------DIKTPSAFNAMAFSF---------------------------HS 271
             + I+ +H        + T  A    AF                              S
Sbjct: 311 RCINILKSHAHWVNHLSLSTDYALRVGAFDHTGKKPATSEEAQKKALENYEKICKKNGSS 370

Query: 272 EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKRVAV 330
           E +M  + +D  ++L++     +P+  M GH+  V  + F    DG  ++S   D  + +
Sbjct: 371 EEMMVTASDDFTMFLWNPLKSTKPIARMTGHQKLVNHVAFSP--DGRYIVSASFDNSIKL 428

Query: 331 WDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
           WD +            DG   + +    GH + +   + S++   L  S  +D  ++VW
Sbjct: 429 WDGR------------DG---KFISTFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 471

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 76/149 (51%), Gaps = 11/149 (7%)

Query: 185 LLSSSDDGSVAYWNIQKSI-PLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           ++++SDD ++  WN  KS  P+  +     ++N V ++   + +     ++S + L D R
Sbjct: 374 MVTASDDFTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSASFDNS-IKLWDGR 432

Query: 243 NNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGH 302
               D K +S       S +  +A+S     L++ S +D+ + ++D R     +  + GH
Sbjct: 433 ----DGKFISTFRGHVASVYQ-VAWSSDCRLLVSCS-KDTTLKVWDVRTRKLSVD-LPGH 485

Query: 303 EDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           +D V ++D+ +++   V SGG DK V +W
Sbjct: 486 QDEVYTVDW-SVDGKRVCSGGKDKMVRLW 513

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 54/101 (53%), Gaps = 10/101 (9%)

Query: 243 NNNNDLKIV---SNHDIKTPSAFN-AMAFSFHSEYLMAASGE-----DSLIYLYDTRNLN 293
           +N N +K+     N ++ T    N A   S  S + M A G      D+ ++L+D RN +
Sbjct: 71  SNGNKVKVFDLRENKEVATLEQENGANVLSLGSGHGMLAYGSEQQGVDAHLHLFDIRNWS 130

Query: 294 QPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL 333
           +P+  ++  H+D +TS+ FH  +  +++SG +D    V+DL
Sbjct: 131 KPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDL 171

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%)

Query: 156 NQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDG 192
           N S P+ S +  H+++   +AF+P D   LLS S DG
Sbjct: 128 NWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDG 164

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 96/246 (39%), Gaps = 41/246 (16%)

Query: 177 FNPLDKGKLLSSSDDGSVAYWNIQKS--IPLLTLQETSIINDVRWNQFNQNLFGYVTESS 234
           +N +D   ++SSS D +   W++Q S  +    +   S + DVR+   +  LF       
Sbjct: 251 WNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDG 310

Query: 235 CLNLKDVRNNNNDLKIV---------SNHDIKTPSAFNAMAF------SFHSEYLMAASG 279
            + + D+R+  +   I           N    TPS   + A        +    L   + 
Sbjct: 311 SVRVFDLRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPNVLATFAA 370

Query: 280 EDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL------ 333
           + + I + D RN   P+  + GH  SV  + +H     +++S   D +   WDL      
Sbjct: 371 DSNKIIILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDLNNSFME 430

Query: 334 ------KQIGQEQTSDEIEDGDVPELLMIHAGHRS-----PINDFSMSNNLNWLCASIEE 382
                 K       S E  DGD    +M   G ++     P+N    SNN   +C +++ 
Sbjct: 431 INGSDSKSPTASGASLEDSDGDT---VMADGGAKANQQEDPLN----SNNDKQVCRTLDT 483

Query: 383 DNIVQV 388
            N++ V
Sbjct: 484 PNMMYV 489

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 5/79 (6%)

Query: 126 RAHYMPQDSTIIATINGDGT-VFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGK 184
           R    P D  ++AT   D   + I D     N  +PI++ L  H  +   + ++P  +  
Sbjct: 354 RLEPSPYDPNVLATFAADSNKIIILDM---RNPESPILN-LEGHTCSVNEIKWHPTKRNV 409

Query: 185 LLSSSDDGSVAYWNIQKSI 203
           LLS SDD    YW++  S 
Sbjct: 410 LLSCSDDCQALYWDLNNSF 428

>NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 56/296 (18%), Positives = 113/296 (38%), Gaps = 66/296 (22%)

Query: 136 IIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPL------DKGKLLSSS 189
           +IAT + D T+ +++         P+   L  H +    LA+ P+      ++ +L S+S
Sbjct: 200 VIATGSMDNTIRLWE----GKSGKPVGDALRGHLKWITSLAWEPIHLVKAGEQPRLASAS 255

Query: 190 DDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDL 248
            DG++  W+  + + L TL   T+ ++ ++W    Q +    +    +   D+ +    +
Sbjct: 256 KDGTIKIWDTSRRVCLYTLSGHTNSVSCIKWG--GQGILYSGSHDKTVRAWDMNSEGRCI 313

Query: 249 KIVSNH-------DIKTPSAFNAMAFSFHS---------------------------EYL 274
            ++ +H        + T  A     F                               E L
Sbjct: 314 NVLKSHAHWVNHLSLSTDYALRVGPFDHTGVEPTSPEDARDKALKNYEKVVKKNGRVEEL 373

Query: 275 MAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDG-IVISGGSDKRVAVWDL 333
           M  + +D  ++L++     +PL  M GH+  V  + F    DG  ++S   D  + +WD 
Sbjct: 374 MVTASDDFTMFLWNPLKSTKPLGRMTGHQKLVNHVAFSP--DGRYIVSASFDNSIKLWDG 431

Query: 334 KQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVW 389
           +            DG   + +    GH + +   + S +   L  S  +D  ++VW
Sbjct: 432 R------------DG---KFISTFRGHVASVYQVAWSADCR-LLVSCSKDTTLKVW 471

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 76/149 (51%), Gaps = 11/149 (7%)

Query: 185 LLSSSDDGSVAYWNIQKSI-PLLTLQ-ETSIINDVRWNQFNQNLFGYVTESSCLNLKDVR 242
           ++++SDD ++  WN  KS  PL  +     ++N V ++   + +     ++S + L D R
Sbjct: 374 MVTASDDFTMFLWNPLKSTKPLGRMTGHQKLVNHVAFSPDGRYIVSASFDNS-IKLWDGR 432

Query: 243 NNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGH 302
               D K +S       S +  +A+S     L++ S +D+ + ++D R     +  + GH
Sbjct: 433 ----DGKFISTFRGHVASVYQ-VAWSADCRLLVSCS-KDTTLKVWDVRTRKLSVD-LPGH 485

Query: 303 EDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           +D V ++D+ +++   V SGG DK V +W
Sbjct: 486 KDEVFTVDW-SVDGKRVCSGGKDKMVRIW 513

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 39/179 (21%), Positives = 76/179 (42%), Gaps = 7/179 (3%)

Query: 163 SKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQ-ETSIINDVRWNQ 221
           S ++ H       AF P    ++++ + D +   W+     P  TL   T+ +  V W  
Sbjct: 137 SAIAGHGSTILCSAFAPNSSSRMVTGAGDNTARIWDCDTQTPKATLTGHTNWVLCVSWCP 196

Query: 222 FNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNH-DIKTPSAFNAMAFSFHSEY-LMAASG 279
            N  +    +  + + L + ++       +  H    T  A+  +      E   +A++ 
Sbjct: 197 -NGEVIATGSMDNTIRLWEGKSGKPVGDALRGHLKWITSLAWEPIHLVKAGEQPRLASAS 255

Query: 280 EDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQ 338
           +D  I ++DT +    L+ + GH +SV+ + +     GI+ SG  DK V  WD+   G+
Sbjct: 256 KDGTIKIWDT-SRRVCLYTLSGHTNSVSCIKWGG--QGILYSGSHDKTVRAWDMNSEGR 311

>KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]
           {ON} similar to uniprot|P47025 Saccharomyces cerevisiae
           YJL112W MDV1 WD repeat protein that regulates steps in
           the Dnm1p-dependent process of mitochondrial fission
          Length = 705

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 44/78 (56%), Gaps = 7/78 (8%)

Query: 257 KTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALND 316
           K P A  A+      +  +A   +D ++ L+D R+  + +  + GH D++TSL F ++N 
Sbjct: 555 KEPPAIGALQCF---DAALATGTKDGIVRLWDLRS-GKVVRMLEGHTDAITSLQFDSVN- 609

Query: 317 GIVISGGSDKRVAVWDLK 334
             +++G  D+ + +WDL+
Sbjct: 610 --LVTGAMDRSIRIWDLR 625

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 27/120 (22%), Positives = 53/120 (44%), Gaps = 8/120 (6%)

Query: 274 LMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL 333
           + +A   D  + ++D     Q +  + GH  S++ +     +   +I+GG D  + +WD+
Sbjct: 412 MCSAGSLDHSVKVWDLSKKKQ-IATLHGHLASISCMQIDQYS--TLITGGRDAVLKLWDI 468

Query: 334 KQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNN 393
            +   ++ S+  ED D    L     H   I   S   + N +  S  +D  V+ W +N+
Sbjct: 469 DKAMADEASNSSEDNDA--CLYTFDSHVDEITAISFDGD-NLVSGS--QDRTVRQWDLNS 523

>AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YJL112W (MDV1) and YKR036C
           (CAF4)
          Length = 715

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 79/190 (41%), Gaps = 51/190 (26%)

Query: 145 TVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIP 204
            ++ +D+ IDE      I+ LS    N             L+S S D ++  W++     
Sbjct: 497 CIYTFDSHIDE------ITALSFEANN-------------LVSGSQDRTIRQWDLNNGKC 537

Query: 205 LLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNA 264
           + TL     IN       ++++ G              N NND  I     I     ++A
Sbjct: 538 VQTLD----INFATGGNLSRSMIG----------SGFLNTNNDHPI-----IGAIQCYDA 578

Query: 265 MAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGS 324
                     +A   +D ++ L+D R+  + +  + GH D+VTSL F +LN   +++G  
Sbjct: 579 A---------LATGTKDGIVRLWDLRS-GRVVRTLEGHSDAVTSLQFDSLN---LVTGSL 625

Query: 325 DKRVAVWDLK 334
           D  + +WDL+
Sbjct: 626 DNSIRIWDLR 635

 Score = 35.0 bits (79), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 101/240 (42%), Gaps = 51/240 (21%)

Query: 161 IISKLSHHKENGYGLAFNPLDKGKLLSSSD-DGSVAYWNIQKSIPLLTLQ-ETSIINDVR 218
           I+S  S H++N   L FN L  G L S+   D ++  WN+ K+  + ++    + ++ ++
Sbjct: 403 ILSFDSAHEDNVTCLDFN-LPFGTLCSAGKLDPTIKVWNLSKNKHVASITGHLATVSCMQ 461

Query: 219 WNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAAS 278
            +Q+N  + G     + L + D++      K + N  I  PS                  
Sbjct: 462 MDQYNTLITG--GRDALLKMWDIQ------KAIDNDSI--PS------------------ 493

Query: 279 GEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQ 338
            ++  IY +D+            H D +T+L F A N   ++SG  D+ +  WDL     
Sbjct: 494 -DEVCIYTFDS------------HIDEITALSFEANN---LVSGSQDRTIRQWDLNNGKC 537

Query: 339 EQTSD-EIEDGDVPELLMIHAGHRSPINDFSMSNNLNWLCASIE---EDNIVQVWKMNNS 394
            QT D     G      MI +G  +  ND  +   +    A++    +D IV++W + + 
Sbjct: 538 VQTLDINFATGGNLSRSMIGSGFLNTNNDHPIIGAIQCYDAALATGTKDGIVRLWDLRSG 597

>Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON}
           (27192..29201) [2010 nt, 670 aa]
          Length = 669

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 38/63 (60%), Gaps = 4/63 (6%)

Query: 272 EYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVW 331
           E  +A+  +D LI L+D R+  + +  + GH D++TSL F   N   +I+G  DK + +W
Sbjct: 530 ESALASGTKDGLIRLWDLRS-GKVIRILEGHTDAITSLKFDMTN---LITGSLDKNIRIW 585

Query: 332 DLK 334
           D++
Sbjct: 586 DMR 588

>TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7.310
           YDL195W
          Length = 1265

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/247 (21%), Positives = 97/247 (39%), Gaps = 58/247 (23%)

Query: 141 NGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQ 200
           NG   +F ++   D  QSN +I K + H      + FNP  +  LL S  +G +   N  
Sbjct: 83  NGSIEIFKFNQENDSIQSNELI-KNNRHTGPIRSITFNP-RQDNLLLSGGEGIINSSNSA 140

Query: 201 KSIPL------------------------------LTLQETSIINDVRWNQFNQNLFGYV 230
           K++P                               +T+     I+ + WN+   ++F   
Sbjct: 141 KTLPTINNIQNTTSEIFIYDLNDVDNPETLPMSPNMTMNRFETISSLAWNKSLSHVFSAA 200

Query: 231 TESSCLNLKDVR-----------NNNNDLK----IVSNHDIKTPSAFNAMAFSFHSEYLM 275
             +S +++ D++           N    +K    +V  H   +     A + +  +    
Sbjct: 201 GNTSAVSIFDLKAKKEVINLNYINPTTGMKEIFSVVEWHPKNSTRIATATSNNISNPLNA 260

Query: 276 AASGEDSLIYLYDTRNLNQPLHYMR----------GHEDSVTSLDFHALNDGIVISGGSD 325
            A+  DS IY++D RN N PL  +           GH D + SLD+ A ++  ++S G D
Sbjct: 261 TANAGDS-IYIWDLRNSNAPLQILSPQQFENNTIVGHTDGIQSLDWCAQDETFLLSSGRD 319

Query: 326 KRVAVWD 332
             + +W+
Sbjct: 320 NSIMLWN 326

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 95/229 (41%), Gaps = 48/229 (20%)

Query: 159 NPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTLQETSIINDVR 218
           +P    L  H    Y  +F+P D   LLS S+D +V  W++     L++ +     N   
Sbjct: 517 DPTCKTLVGHSGTVYATSFSP-DNKYLLSGSEDKTVRLWSMDTHTALVSYKGH---NHPV 572

Query: 219 WNQFNQNLFGYVTESS---------CLNLKDVR---NNNNDLKIVSNH------------ 254
           W+     L  Y   +S         C ++  +R    + ND+  VS H            
Sbjct: 573 WDVNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSD 632

Query: 255 ------DIKTPSAFN----------AMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHY 298
                 D+ T  +             +A S    +L   S ED +I ++D     + L  
Sbjct: 633 KTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGS-EDGIINIWDI-GTGKRLKQ 690

Query: 299 MRGH-EDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIE 346
           MRGH ++++ SL + +    ++ISGG+D  V VWDLK+   E +++  E
Sbjct: 691 MRGHGKNAIYSLSY-SKEGNVLISGGADHSVRVWDLKKATTEPSAEPEE 738

>ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL035C
          Length = 403

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 78/181 (43%), Gaps = 18/181 (9%)

Query: 164 KLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIIN-DVRWN 220
           K+S   +N + L   PL +  +L++  +G V    W   KS+  +   E+SI    V  +
Sbjct: 8   KVSFGADN-WCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSINGLQVLDS 66

Query: 221 QFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE 280
             ++           + L D+R       +          A  A A S  S + M A G 
Sbjct: 67  AHDRGTVFATAADDGVKLFDIRTRGCVATLTD--------ANGAPALSLDSRHGMLAFGT 118

Query: 281 -----DSLIYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334
                D+++ L+      +PL  ++  H D VT + FH  +  +++SG +D  V V+DLK
Sbjct: 119 ELVGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLK 178

Query: 335 Q 335
           Q
Sbjct: 179 Q 179

>KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W
          Length = 746

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 64/138 (46%), Gaps = 25/138 (18%)

Query: 266 AFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSD 325
              +  +Y++  + +D +I +Y+ ++  + L  + GHE  V +L +    DGI++SG +D
Sbjct: 377 CLQYEDDYVITGA-DDKMIRVYNAKS-KKFLLELSGHEGGVWALKYDC--DGIIVSGSTD 432

Query: 326 KRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPIN--DFSMSNNLNWLCASIEED 383
           + V VWD+K+                    +  GH S +   D    N + ++      D
Sbjct: 433 RSVRVWDIKRRCCTH---------------VFKGHTSTVRCLDIVEYNGVKYIVTG-SRD 476

Query: 384 NIVQVWKMNNSL---RED 398
           N + VW ++ ++   RED
Sbjct: 477 NTLHVWSLDRNIYNRRED 494

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 54/305 (17%), Positives = 117/305 (38%), Gaps = 43/305 (14%)

Query: 129 YMPQDSTIIATINGDGTVFIYD-----TSIDEN-------QSNPIISKLSHHKENGYGLA 176
           ++PQ +T+   +    T   Y+     T  D+        +S   + +LS H+   + L 
Sbjct: 360 FVPQRTTLRGHMTSVVTCLQYEDDYVITGADDKMIRVYNAKSKKFLLELSGHEGGVWALK 419

Query: 177 FNPLDKGKLLSSSDDGSVAYWNIQK------------SIPLLTLQETSIINDVRWNQFNQ 224
           ++    G ++S S D SV  W+I++            ++  L + E + +  +     + 
Sbjct: 420 YDC--DGIIVSGSTDRSVRVWDIKRRCCTHVFKGHTSTVRCLDIVEYNGVKYIVTGSRDN 477

Query: 225 NLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGE---- 280
            L  +  + +  N ++     + L +V +     P     +     S   ++  G+    
Sbjct: 478 TLHVWSLDRNIYNRREDDTAPDRLPLVYDAPEDNPYFIGILRGHLASVRTVSGYGKIVIS 537

Query: 281 ---DSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIG 337
              D+ + ++D   + + L+ + GH D + S  +        IS   D  + +WDLK I 
Sbjct: 538 GSYDNTLMVWDIMQM-KCLYILSGHSDRIYSTIYDHRRQR-CISASMDSSIRIWDLKNIR 595

Query: 338 QEQTSDEIEDGDVPELLMIHA-----GHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMN 392
           +      + +  +P   +  +     GH S +    +SN       S   D  ++ W  +
Sbjct: 596 KNGNCQPVSNSGIPCTRVCDSYKVLNGHTSLVGLLRLSNK---FLLSAAADGSLKGWDAD 652

Query: 393 NSLRE 397
             +R+
Sbjct: 653 TYVRK 657

>Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AER255C
          Length = 471

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 15/89 (16%)

Query: 301 GHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGH 360
           GHE+  T+L F   +  + +SGG+D ++ +WDL    +              LL    GH
Sbjct: 176 GHENGTTALKFLPKSGHLFLSGGNDNKLKIWDLYHDRR--------------LLRDFCGH 221

Query: 361 RSPINDFSMSNNLNWLCASIEEDNIVQVW 389
           + PI DF+ + +      S+  D  +++W
Sbjct: 222 QKPIRDFNFTTDSKQF-TSVSYDKFLKIW 249

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 149 YDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSIPLLTL 208
           YDT   +N  N +I    HH  +   L F P +  K +SSS+D ++  W+ Q +IP+  +
Sbjct: 291 YDTR--DNYKNGLIQTYDHHTSSIIALKFFP-NGSKFISSSEDKTIRIWDNQINIPIKQI 347

Query: 209 QETS 212
            +T+
Sbjct: 348 SDTA 351

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 60/113 (53%), Gaps = 10/113 (8%)

Query: 267 FSFHSE-YLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSD 325
            +F S+  L+A++G D++  ++D R+  +P+  + GH  +++ +D+ + N   + + G+D
Sbjct: 304 IAFQSDGALLASAGLDAVCAIWDLRS-GEPIMKLEGHAGAISGVDW-SPNGYQLATAGAD 361

Query: 326 KRVAVWDLKQIGQEQT--SDEIEDGDVP-----ELLMIHAGHRSPINDFSMSN 371
             V VWD++ +G E    + ++   DV         ++  GH   +N F+  N
Sbjct: 362 GTVRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADN 414

>ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL195W (SEC31)
          Length = 1233

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 75/188 (39%), Gaps = 21/188 (11%)

Query: 162 ISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQKSI--------PLLTLQETSI 213
           +++++ H      + FN       +S    G +  W+  K          P   +     
Sbjct: 96  VARVARHTTGVRAVRFNAKQANVAVSGGSQGEIFVWDTNKISAAGYSPFGPGTAMTPIDE 155

Query: 214 INDVRWNQFNQNLFGYVTESSCLNLKDVRNNNN--DLKIVSNHDIKTPSAFNAMAF---- 267
           +  + WNQ   ++F     S   ++ D++       L   S H        N +A     
Sbjct: 156 VQSLAWNQSLAHVFASAGSSGFASIWDLKAKKEVIHLSYTSPHS----GLKNQLAVVEWH 211

Query: 268 SFHSEYLMAASGED--SLIYLYDTRNLNQPLHYM-RGHEDSVTSLDFHALNDGIVISGGS 324
             +S  +  A+G D   +I ++D RN N PL  M +GH   + SLD+   ++ +++S G 
Sbjct: 212 PSNSTRVATATGNDNEPVILVWDLRNANMPLQVMSQGHSKGILSLDWCKHDEKLMLSSGR 271

Query: 325 DKRVAVWD 332
           D    +W+
Sbjct: 272 DNTCILWN 279

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 30/63 (47%), Gaps = 1/63 (1%)

Query: 274 LMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDL 333
           ++A + E+ ++  +  R         R H   V ++ F+A    + +SGGS   + VWD 
Sbjct: 75  MLAGALENGVVEFFCARERRSVARVAR-HTTGVRAVRFNAKQANVAVSGGSQGEIFVWDT 133

Query: 334 KQI 336
            +I
Sbjct: 134 NKI 136

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 42/211 (19%), Positives = 81/211 (38%), Gaps = 36/211 (17%)

Query: 114 IIKKFKHELEVTRAHYMPQDSTIIATINGDGTVFIYDT-SIDENQSNPIISKLSHHKENG 172
           + +  +H   V    +  + + +  +    G +F++DT  I     +P           G
Sbjct: 96  VARVARHTTGVRAVRFNAKQANVAVSGGSQGEIFVWDTNKISAAGYSPF----------G 145

Query: 173 YGLAFNPLDKGKLL-----------SSSDDGSVAYWNIQKSIPLLTLQETSI-------I 214
            G A  P+D+ + L           S+   G  + W+++    ++ L  TS        +
Sbjct: 146 PGTAMTPIDEVQSLAWNQSLAHVFASAGSSGFASIWDLKAKKEVIHLSYTSPHSGLKNQL 205

Query: 215 NDVRWNQFNQNLFGYVTES---SCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHS 271
             V W+  N       T +     + + D+RN N  L+++S    K      ++ +  H 
Sbjct: 206 AVVEWHPSNSTRVATATGNDNEPVILVWDLRNANMPLQVMSQGHSK---GILSLDWCKHD 262

Query: 272 EYLMAASGEDSLIYLYDTRNLNQPLHY-MRG 301
           E LM +SG D+   L++     +   Y  RG
Sbjct: 263 EKLMLSSGRDNTCILWNPEEAQKLTQYPTRG 293

>Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar to
           Ashbya gossypii ADR077C
          Length = 1201

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 61/146 (41%), Gaps = 20/146 (13%)

Query: 248 LKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVT 307
           +K+++  + K+  A  A+AF     +++ A    S I L+D R +   LH    HE  V 
Sbjct: 1   MKMLTKFESKSTRA-KAIAFHPSRPWVLVALFS-STIQLWDYR-MGVLLHRFEDHEGPVR 57

Query: 308 SLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDF 367
            +DFH     + +SGG D  V VW L               D  + L    GH   +   
Sbjct: 58  GVDFHP-TQPLFVSGGDDYTVKVWSL---------------DSRKCLFTLHGHLDYVRTV 101

Query: 368 SMSNNLNWLCASIEEDNIVQVWKMNN 393
              N L W+  S  +D  +++W   N
Sbjct: 102 FFHNELPWII-SASDDQTIRIWNWQN 126

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 69/140 (49%), Gaps = 20/140 (14%)

Query: 269 FHSE--YLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDK 326
           FH+E  ++++AS +D  I +++ +N  + +  + GH   V    FH  N+ +VIS   D+
Sbjct: 103 FHNELPWIISAS-DDQTIRIWNWQN-RKEIACLTGHNHFVMCAQFHP-NEDLVISASLDE 159

Query: 327 RVAVWDLKQIGQEQTS------DEI------EDGDVPELLM--IHAGHRSPINDFSMSNN 372
            V VWD+  + +  ++      DE+       DG   + ++  I  GH   +N  S    
Sbjct: 160 TVRVWDISGLRKRHSAPGSQNFDEVISQQNLFDGGFGDCVVKFILEGHTRGVNWASFHPT 219

Query: 373 LNWLCASIEEDNIVQVWKMN 392
           L  L  S  +D  V++W+M+
Sbjct: 220 LP-LIVSGSDDRQVKLWRMS 238

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 49/110 (44%), Gaps = 10/110 (9%)

Query: 268 SFHSEYLMAASG-EDSLIYLYDTRNLNQ-PLHYMRGHEDSVTSLDFHALNDGIVISGGSD 325
           SFH    +  SG +D  + L+         +   RGH ++V S+ FH   + ++IS G D
Sbjct: 215 SFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHSNNVDSVIFHPYQN-LIISVGED 273

Query: 326 KRVAVWDL------KQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSM 369
             + VWDL      KQ  +EQ    +     P + +  A H S I  F +
Sbjct: 274 STIRVWDLDRRTPVKQFKREQDRFWLVRAH-PNINLFGAAHDSGIMIFKL 322

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1120

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 35/66 (53%)

Query: 270 HSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHALNDGIVISGGSDKRVA 329
           HS+  + AS     ++++D RN + PL  +  HE SV S+DF+      ++S  +D  V 
Sbjct: 168 HSDVNIMASSHGDDVFIWDLRNGSTPLFKLSSHESSVNSIDFNRFRSTEIMSSSNDGTVK 227

Query: 330 VWDLKQ 335
            WD  +
Sbjct: 228 FWDYSR 233

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 43/71 (60%), Gaps = 5/71 (7%)

Query: 133 DSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDG 192
           D  I+A+ +GD  VFI+D     N S P+  KLS H+ +   + FN     +++SSS+DG
Sbjct: 170 DVNIMASSHGDD-VFIWDL---RNGSTPLF-KLSSHESSVNSIDFNRFRSTEIMSSSNDG 224

Query: 193 SVAYWNIQKSI 203
           +V +W+  +++
Sbjct: 225 TVKFWDYSRNV 235

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 78/203 (38%), Gaps = 21/203 (10%)

Query: 120 HELEVTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNP 179
           H   +T  ++ PQ   I+AT + D  V  +D     +   P  S  S  K +   + +N 
Sbjct: 113 HSRAITDINFSPQHPDILATCSIDTYVHAWDM---RSPQRPFYST-SSWKSSAAQVKWNH 168

Query: 180 LDKGKLLSSSDDGSVAYWNIQK-SIPLLTL-QETSIINDVRWNQFNQNLFGYVTESSCLN 237
            D   + SS  D  V  W+++  S PL  L    S +N + +N+F        +    + 
Sbjct: 169 SDVNIMASSHGD-DVFIWDLRNGSTPLFKLSSHESSVNSIDFNRFRSTEIMSSSNDGTVK 227

Query: 238 LKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEY-LMAASGEDSLIYLYD-------- 288
             D   N  D     + D      +      F   + +M   G ++ +Y+ D        
Sbjct: 228 FWDYSRNVEDSLRTIHTDFPI---WRGRYLPFGEGFCVMPTVGGNNSVYMMDLSLEKSEM 284

Query: 289 TRNLNQPLHYMRGHEDSVTSLDF 311
           T    QP +  +GH D V  +DF
Sbjct: 285 TACKLQPAYTFKGHTDRV--IDF 305

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,189,277
Number of extensions: 2556537
Number of successful extensions: 11643
Number of sequences better than 10.0: 1010
Number of HSP's gapped: 10793
Number of HSP's successfully gapped: 1653
Length of query: 407
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 295
Effective length of database: 40,638,807
Effective search space: 11988448065
Effective search space used: 11988448065
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)