Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A07060na 1ON62562528720.0
Kpol_358.3na 1ON57552719060.0
Suva_16.40na 1ON60653118970.0
Smik_6.473na 1ON60652718890.0
CAGL0A01199gna 1ON61353318890.0
Skud_16.12na 1ON60753118790.0
YPL265W (DIP5)na 1ON60852718780.0
TPHA0M00130singletonON61153018710.0
NDAI0I02660na 1ON59453318630.0
NCAS0D02260na 1ON59753318440.0
SAKL0G14916gna 1ON58153417710.0
KNAG0L02460singletonON58852717130.0
KAFR0B06430singletonON59353617100.0
KLTH0B01166gna 1ON57752717060.0
Kwal_33.15545na 1ON57652716900.0
KLLA0E16281gna 1ON60553116620.0
Ecym_2480na 1ON58652916580.0
KNAG0L02470singletonON63852816210.0
ACL135Wna 1ON58853215660.0
YOR348C (PUT4)7.44ON6275358841e-110
Smik_15.5327.44ON6315258681e-107
SAKL0B10956g7.44ON5725368581e-106
CAGL0E05632g7.44ON5985198591e-106
SAKL0C02662g1.83ON5485138521e-106
Suva_8.4027.44ON6835358571e-105
Kwal_26.69407.44ON5705408471e-105
Ecym_80357.44ON5634948401e-104
CAGL0J08184g1.83ON5725108381e-103
KLTH0F02398g1.83ON5555188341e-103
Skud_14.711.84ON6125138371e-103
TDEL0H040707.44ON5775158301e-102
ZYRO0D17908gna 1ON5184948251e-102
YNL268W (LYP1)1.84ON6115128321e-102
NDAI0F041901.84ON5995108301e-102
Smik_5.241.83ON5906198291e-102
KLTH0D01474g7.44ON6245158321e-102
TDEL0C061701.84ON5734948271e-102
NCAS0E022607.44ON5935218281e-102
Suva_14.751.84ON6115128291e-102
SAKL0C02640gsingletonON5485168241e-102
CAGL0J08162g1.84ON5975178261e-101
TDEL0C061801.83ON5835178251e-101
TBLA0A054601.84ON6085158261e-101
Smik_14.681.84ON6115128261e-101
TPHA0H028507.44ON6015418241e-101
Kpol_2000.641.84ON6105128231e-101
KNAG0C05920singletonON5995038181e-100
Ecym_10871.83ON5705148151e-100
Skud_14.701.83ON5735198141e-100
KNAG0E003907.44ON5995278151e-100
KNAG0F004801.84ON5975108151e-100
KAFR0D039401.83ON5975158141e-100
TDEL0A08030singletonON5144508024e-99
Skud_15.5157.44ON6265368115e-99
YEL063C (CAN1)1.83ON5905068061e-98
Suva_14.731.83ON4974867962e-98
Smik_14.671.83ON5735168022e-98
Skud_5.261.83ON5905068033e-98
NDAI0E038007.44ON6215708054e-98
Suva_5.41.83ON5905157991e-97
SAKL0C02728g1.84ON5624777962e-97
YNL270C (ALP1)1.83ON5735197962e-97
KLLA0C02343g1.83ON5814797972e-97
TPHA0B044701.84ON5995127982e-97
KLLA0F23419g7.44ON5735407943e-97
NDAI0A006101.83ON5655087934e-97
TBLA0A054501.83ON6064797957e-97
NCAS0A006101.84ON6075107957e-97
KLTH0F02420g1.84ON6215107932e-96
TPHA0B044801.83ON6034937912e-96
Ecym_10881.84ON5675207874e-96
NCAS0B085701.83ON5325557827e-96
Kwal_33.134111.84ON5605137831e-95
Kpol_367.77.44ON5845217841e-95
SAKL0C02684gsingletonON5884777832e-95
NCAS0A006001.83ON5445127784e-95
ZYRO0F16632g1.84ON6075097792e-94
KAFR0D007001.83ON5745287752e-94
Kwal_33.134011.83ON5595017708e-94
AFR668W1.83ON5564897672e-93
Kwal_23.4026singletonON5345027634e-93
SAKL0F09790gsingletonON5585297645e-93
ZYRO0F16654g1.83ON5805137622e-92
Kpol_2000.651.83ON5954767615e-92
NDAI0F042001.83ON5665107579e-92
KNAG0C007901.83ON5795107502e-90
AFR156W7.44ON5585297437e-90
KLLA0C02365g1.84ON5795177387e-89
Smik_6.482na 2ON5585457369e-89
TBLA0C01240singletonON6295397365e-88
Kwal_8.590na 3ON6295237356e-88
Suva_13.517singletonON5475167253e-87
SAKL0F16544gsingletonON5675107193e-86
AFR667C1.84ON5635537072e-84
TDEL0E05750singletonON5484907027e-84
KAFR0C051607.44ON5845277031e-83
CAGL0K05753g1.50ON6606487053e-83
KAFR0E018505.158ON5605196975e-83
NDAI0B052201.244ON6115126991e-82
ZYRO0C18502g7.44ON5755106951e-82
SAKL0G14014g5.158ON6055306962e-82
ZYRO0D03762g1.244ON6005056952e-82
KLTH0A00308gsingletonON5414846894e-82
Smik_3.531.50ON6335226955e-82
KLTH0B00154gna 3ON5564956897e-82
TPHA0A002405.158ON6035276928e-82
Kpol_2000.921.50ON6375236921e-81
KAFR0D04120na 4ON6485266913e-81
YCL025C (AGP1)1.50ON6335246894e-81
NDAI0D021605.158ON5875246855e-81
Suva_3.1891.50ON6335246861e-80
SAKL0C01232gsingletonON6136176832e-80
Ecym_47895.158ON5885056812e-80
Kwal_27.126811.244ON5935156785e-80
KAFR0C004003.284ON5825296769e-80
KLLA0B14685gna 5ON5715086759e-80
Suva_2.6881.50ON6615276792e-79
KNAG0F002701.50ON6345226772e-79
SAKL0D00836gna 6ON6016126752e-79
Skud_11.2751.244ON6025236752e-79
TPHA0E036601.50ON6475236782e-79
Skud_3.381.50ON6335246763e-79
KLLA0A11770g5.158ON5815946733e-79
NCAS0A071105.158ON5924986725e-79
YBR068C (BAP2)3.284ON6095196719e-79
Ecym_60211.244ON6005986709e-79
KAFR0D005001.50ON6175286711e-78
Kpol_543.791.244ON6055156664e-78
Suva_2.716singletonON6035156655e-78
TBLA0A051801.50ON6765176705e-78
Kpol_526.103.397ON5805076646e-78
YDR508C (GNP1)1.50ON6635276687e-78
SAKL0D04664g1.244ON5935096639e-78
Skud_7.5255.158ON6035226631e-77
Kpol_1010.325.158ON5995226631e-77
NDAI0C029505.158ON6095696622e-77
KNAG0C02140singletonON5985106612e-77
TPHA0B010901.244ON6065256612e-77
Ecym_26643.285ON5755166583e-77
TDEL0C00930singletonON5954976603e-77
TPHA0A047005.158ON5695006574e-77
NCAS0B079001.244ON6195096614e-77
Smik_16.1155.158ON6035026594e-77
NDAI0F043901.50ON6676146634e-77
KLTH0F04048gsingletonON5835276584e-77
Skud_16.2na 2ON4964526507e-77
KLTH0E15642g1.244ON5965146577e-77
KLTH0B02046g5.158ON5895166567e-77
KAFR0D00520na 4ON5985256578e-77
Smik_4.7901.50ON6635276582e-76
KAFR0D041401.50ON6375136563e-76
Suva_11.2731.244ON6015096534e-76
NDAI0A006401.50ON6416226554e-76
KLLA0A06886gsingletonON5875086514e-76
KAFR0D00510na 7ON6175166535e-76
YKR039W (GAP1)1.244ON6026196525e-76
YGR191W (HIP1)5.158ON6035026525e-76
Skud_4.7841.50ON6635286565e-76
NCAS0D018705.158ON5955126516e-76
CAGL0B03773g5.158ON6055026517e-76
KLTH0F01606gna 4ON6045996517e-76
AGR319W5.158ON6266086528e-76
Skud_2.1913.284ON6095196491e-75
KAFR0A011203.284ON5925196481e-75
KLLA0C01606g1.50ON6205256482e-75
Smik_11.3021.244ON5534766433e-75
KNAG0H011503.284ON6175196473e-75
SAKL0D02970g3.284ON6015326445e-75
Kwal_23.2817na 5ON5805136427e-75
Suva_4.3073.284ON6095166449e-75
Suva_7.4855.158ON6035186421e-74
CAGL0B01012g1.50ON6235216431e-74
NDAI0A074903.284ON5965226384e-74
NCAS0B085801.50ON6275196404e-74
SAKL0C01650g1.50ON6135726395e-74
Kpol_543.78singletonON6055146385e-74
TPHA0B047501.50ON6395216405e-74
Smik_2.2013.284ON6095266386e-74
Kwal_33.13215na 4ON5985206376e-74
KNAG0C005901.50ON6345036381e-73
AGR040C3.285ON5735226303e-73
KAFR0D04130na 7ON6445036344e-73
KNAG0J022003.284ON6075266308e-73
Kpol_1052.163.284ON6135136309e-73
Kwal_33.132041.50ON6075176282e-72
Kwal_33.154075.158ON5875136252e-72
NCAS0A004201.50ON6795826312e-72
CAGL0L03267g1.244ON5975156253e-72
AGR039Cna 8ON5865276236e-72
KLLA0A06930g1.244ON5875126201e-71
TDEL0C065101.50ON6425176231e-71
TBLA0A05190na 4ON6675176242e-71
ZYRO0F13838g8.342ON8365526323e-71
NCAS0I015303.284ON5955306193e-71
CAGL0H08393g3.284ON6125286193e-71
KNAG0G009005.158ON6135176193e-71
NCAS0A106803.284ON5935216174e-71
TDEL0D00200singletonON5675086146e-71
AFR698C1.50ON6095256151e-70
SAKL0D02948gna 8ON5945166132e-70
NDAI0A056203.284ON5715226112e-70
Skud_4.3003.284ON6045266122e-70
SAKL0H15092g8.342ON8505826253e-70
KLTH0F01584g1.50ON5965236097e-70
Suva_2.2033.284ON6045266072e-69
Kwal_26.9612singletonON5435146022e-69
AER405Cna 9ON4974875983e-69
YDR046C (BAP3)3.284ON6045256053e-69
SAKL0D02926g3.285ON5835126034e-69
YBR132C (AGP2)3.397ON5965026034e-69
KLTH0C08052gna 9ON5995196036e-69
Smik_2.2723.397ON5975076001e-68
TPHA0M012003.284ON6075226011e-68
SAKL0C13992gsingletonON5525225962e-68
Smik_4.2843.284ON6045275992e-68
Skud_2.2603.397ON5985025983e-68
TBLA0I020003.284ON6645236005e-68
Kpol_1065.133.284ON5965185956e-68
Kwal_33.14276na 6ON5965155948e-68
TBLA0I020103.285ON6284945969e-68
TDEL0F046608.342ON8405576042e-67
AAR038W3.397ON5665005893e-67
Smik_12.2na 10ON5835185893e-67
TBLA0B077605.158ON6585305943e-67
AFR230C1.244ON6045165913e-67
Suva_4.3813.397ON5905035903e-67
Suva_16.18na 9ON5835145884e-67
KLLA0A10813g1.368ON5845295885e-67
YLL061W (MMP1)na 10ON5835165878e-67
ZYRO0F17446g1.50ON6335175872e-66
CAGL0L07546g3.284ON6345255863e-66
YFL055W (AGP3)na 11ON5585365813e-66
Kpol_2002.441.50ON6275335853e-66
Ecym_10561.50ON6065245833e-66
Skud_6.2na 11ON5585185805e-66
Kwal_27.105383.284ON6025275816e-66
SAKL0D04048gna 9ON5865185807e-66
Ecym_26623.284ON5895195808e-66
TPHA0A024503.397ON5835045781e-65
NCAS0J00140na 11ON5585295761e-65
NDAI0A01340singletonON5545115752e-65
Kpol_1052.143.285ON6025085773e-65
KLTH0C05170g3.284ON5985205755e-65
NCAS0I008503.397ON5845035745e-65
CAGL0M00154gsingletonON5505215717e-65
Skud_2.1923.285ON6195045758e-65
KLLA0F27093gsingletonON5635275719e-65
Suva_16.31singletonON5865005721e-64
NDAI0G060301.368ON5995325712e-64
KNAG0L00110na 11ON5715175692e-64
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A07060
         (625 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...  1110   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   738   0.0  
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   735   0.0  
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   732   0.0  
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   732   0.0  
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   728   0.0  
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   728   0.0  
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     725   0.0  
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   722   0.0  
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              714   0.0  
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   686   0.0  
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             664   0.0  
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   663   0.0  
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   661   0.0  
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   655   0.0  
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   644   0.0  
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   643   0.0  
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             629   0.0  
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   607   0.0  
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   345   e-110
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   338   e-107
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   335   e-106
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   335   e-106
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   332   e-106
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   334   e-105
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   330   e-105
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   328   e-104
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   327   e-103
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   325   e-103
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   327   e-103
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   324   e-102
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   322   e-102
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   325   e-102
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   324   e-102
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   323   e-102
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   325   e-102
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   323   e-102
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     323   e-102
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   323   e-102
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   322   e-102
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   322   e-101
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   322   e-101
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   322   e-101
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   322   e-101
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   322   e-101
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   321   e-101
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            319   e-100
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   318   e-100
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   318   e-100
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   318   e-100
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                318   e-100
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   318   e-100
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            313   4e-99
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   317   5e-99
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   315   1e-98
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   311   2e-98
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   313   2e-98
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   313   3e-98
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     314   4e-98
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   312   1e-97
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   311   2e-97
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   311   2e-97
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   311   2e-97
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   311   2e-97
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   310   3e-97
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   310   4e-97
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   310   7e-97
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              310   7e-97
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   310   2e-96
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   309   2e-96
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   307   4e-96
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            305   7e-96
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   306   1e-95
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   306   1e-95
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   306   2e-95
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   304   4e-95
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   304   2e-94
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   303   2e-94
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   301   8e-94
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   300   2e-93
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   298   4e-93
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   298   5e-93
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   298   2e-92
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   297   5e-92
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            296   9e-92
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              293   2e-90
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   290   7e-90
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   288   7e-89
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   288   9e-89
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   288   5e-88
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   287   6e-88
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   283   3e-87
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   281   3e-86
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   276   2e-84
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            275   7e-84
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   275   1e-83
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   276   3e-83
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   273   5e-83
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   273   1e-82
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   272   1e-82
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   272   2e-82
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   272   2e-82
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   270   4e-82
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   272   5e-82
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   270   7e-82
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   271   8e-82
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   271   1e-81
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   270   3e-81
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   270   4e-81
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    268   5e-81
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   268   1e-80
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   267   2e-80
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   266   2e-80
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   265   5e-80
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                265   9e-80
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   264   9e-80
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   266   2e-79
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   265   2e-79
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   264   2e-79
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   264   2e-79
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   265   2e-79
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   265   3e-79
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   263   3e-79
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   263   5e-79
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   263   9e-79
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   262   9e-79
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      263   1e-78
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   261   4e-78
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   260   5e-78
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   262   5e-78
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   260   6e-78
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   261   7e-78
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   259   9e-78
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   259   1e-77
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   259   1e-77
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    259   2e-77
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   259   2e-77
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   259   2e-77
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   258   3e-77
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   258   3e-77
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   257   4e-77
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   259   4e-77
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   258   4e-77
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   259   4e-77
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   258   4e-77
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   254   7e-77
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   257   7e-77
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   257   7e-77
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   257   8e-77
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   258   2e-76
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              257   3e-76
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   256   4e-76
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   256   4e-76
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   255   4e-76
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      256   5e-76
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   255   5e-76
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   255   5e-76
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   257   5e-76
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   255   6e-76
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   255   7e-76
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   255   7e-76
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   255   8e-76
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   254   1e-75
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   254   1e-75
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   254   2e-75
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   252   3e-75
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              253   3e-75
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   252   5e-75
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   251   7e-75
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   252   9e-75
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   251   1e-74
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   252   1e-74
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   250   4e-74
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   251   4e-74
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   250   5e-74
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   250   5e-74
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   251   5e-74
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   250   6e-74
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   249   6e-74
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   250   1e-73
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   247   3e-73
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              248   4e-73
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   247   8e-73
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   247   9e-73
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   246   2e-72
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   245   2e-72
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   247   2e-72
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   245   3e-72
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   244   6e-72
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   243   1e-71
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   244   1e-71
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   244   2e-71
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   248   3e-71
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              243   3e-71
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   243   3e-71
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   243   3e-71
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   242   4e-71
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                241   6e-71
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   241   1e-70
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   240   2e-70
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            239   2e-70
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   240   2e-70
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   245   3e-70
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   239   7e-70
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   238   2e-69
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   236   2e-69
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   234   3e-69
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   237   3e-69
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   236   4e-69
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   236   4e-69
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   236   6e-69
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   235   1e-68
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   236   1e-68
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   234   2e-68
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   235   2e-68
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   234   3e-68
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   235   5e-68
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   233   6e-68
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   233   8e-68
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   234   9e-68
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   237   2e-67
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   231   3e-67
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    231   3e-67
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   233   3e-67
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   232   3e-67
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   231   3e-67
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   231   4e-67
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   231   5e-67
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   230   8e-67
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   230   2e-66
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   230   3e-66
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   228   3e-66
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   229   3e-66
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   229   3e-66
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      228   5e-66
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   228   6e-66
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   228   7e-66
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   228   8e-66
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   227   1e-65
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      226   1e-65
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              226   2e-65
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   226   3e-65
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   226   5e-65
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   225   5e-65
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   224   7e-65
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   226   8e-65
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   224   9e-65
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   224   1e-64
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   224   2e-64
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   223   2e-64
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   228   2e-64
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   223   2e-64
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   224   2e-64
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   228   3e-64
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   223   5e-64
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   222   7e-64
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              223   1e-63
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   221   1e-63
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   222   2e-63
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              219   6e-63
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   219   7e-63
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              221   8e-63
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   219   1e-62
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   219   2e-62
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   218   2e-62
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   218   2e-62
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   217   3e-62
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   216   5e-62
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   217   6e-62
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   221   7e-62
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   216   9e-62
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    214   1e-61
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   216   2e-61
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   215   2e-61
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   216   2e-61
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   215   2e-61
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   215   3e-61
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   215   3e-61
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   219   5e-61
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                214   7e-61
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   213   7e-61
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   213   1e-60
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   214   1e-60
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   214   1e-60
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   213   2e-60
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   214   2e-60
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   212   2e-60
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              212   3e-60
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   212   3e-60
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   212   4e-60
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   209   7e-60
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   216   7e-60
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   209   9e-60
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   211   1e-59
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   211   1e-59
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   215   2e-59
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   214   2e-59
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   210   2e-59
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   210   3e-59
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   210   3e-59
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   214   4e-59
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   209   4e-59
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   209   5e-59
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   209   6e-59
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                208   9e-59
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   213   1e-58
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   209   1e-58
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   208   1e-58
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   207   4e-58
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   206   5e-58
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   206   5e-58
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   205   6e-58
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   206   7e-58
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      206   7e-58
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   209   8e-58
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   205   1e-57
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   204   2e-57
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   209   2e-57
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   205   2e-57
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   208   6e-57
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   203   6e-57
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   202   8e-57
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   206   2e-56
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   201   3e-56
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   204   1e-55
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   202   2e-55
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   198   6e-55
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   192   8e-53
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   191   1e-52
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   193   9e-52
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              184   8e-50
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   179   2e-47
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   173   3e-46
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     167   9e-46
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     167   9e-46
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   166   1e-43
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   165   2e-43
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         124   1e-30
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   115   2e-28
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      99   3e-22
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          97   4e-22
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     98   2e-21
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          71   1e-13
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      69   2e-13
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    65   3e-11
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    55   3e-08
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      55   3e-08
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              55   6e-08
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              33   0.37 
AFL081W Chr6 (286339..287967) [1629 bp, 542 aa] {ON} Syntenic ho...    33   2.3  
KAFR0D03990 Chr4 complement(785167..786924) [1758 bp, 585 aa] {O...    33   2.8  
Smik_6.7 Chr6 (9124..9204,9208..9294,9405..9470,9474..9617,9624....    32   4.0  
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    32   5.2  

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score = 1110 bits (2872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/625 (88%), Positives = 554/625 (88%)

Query: 1   MAESIQSTDISHTRIEIDNIAVQQKGLDSSQDGGIKFVDQTNYNIYGNLDNMGDYSKDYY 60
           MAESIQSTDISHTRIEIDNIAVQQKGLDSSQDGGIKFVDQTNYNIYGNLDNMGDYSKDYY
Sbjct: 1   MAESIQSTDISHTRIEIDNIAVQQKGLDSSQDGGIKFVDQTNYNIYGNLDNMGDYSKDYY 60

Query: 61  EKSQYQQQNLDIEXXXXXXXXXXXXXXXXXXXPKHTDGLKKNLQARHVSMXXXXXXXXXX 120
           EKSQYQQQNLDIE                   PKHTDGLKKNLQARHVSM          
Sbjct: 61  EKSQYQQQNLDIESNISSLSSTTSITSTGGSSPKHTDGLKKNLQARHVSMIAIGGSLGTG 120

Query: 121 XXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMASYIPMDGFTSYASRYVDPALG 180
                      AGPASMFIAYSFVGILVFFTMAAIGEMASYIPMDGFTSYASRYVDPALG
Sbjct: 121 LLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEMASYIPMDGFTSYASRYVDPALG 180

Query: 181 FAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFG 240
           FAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFG
Sbjct: 181 FAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFG 240

Query: 241 EFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKF 300
           EFEFWLSSFK                   PDHDRLGFRYWQHPGAFKPYSDAIDGSVGKF
Sbjct: 241 EFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKF 300

Query: 301 VAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCV 360
           VAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCV
Sbjct: 301 VAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCV 360

Query: 361 AYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRS 420
           AYNDPRLL            PFVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRS
Sbjct: 361 AYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRS 420

Query: 421 LYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFG 480
           LYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFG
Sbjct: 421 LYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFG 480

Query: 481 LLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLG 540
           LLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLG
Sbjct: 481 LLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLG 540

Query: 541 HSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHEVDLFTGKEVFDQQEIEGKILDQ 600
           HSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHEVDLFTGKEVFDQQEIEGKILDQ
Sbjct: 541 HSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHEVDLFTGKEVFDQQEIEGKILDQ 600

Query: 601 EKQIRLRENKFSLEWIYEKFLGNIF 625
           EKQIRLRENKFSLEWIYEKFLGNIF
Sbjct: 601 EKQIRLRENKFSLEWIYEKFLGNIF 625

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/527 (68%), Positives = 418/527 (79%), Gaps = 1/527 (0%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK L+ARH+SM                      GPAS+ IAYSFVGILVFF MA +GEM
Sbjct: 50  LKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILVFFVMACLGEM 109

Query: 159 ASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
           A+YIP+DGFTSYA+RY DPALGFAVGYCYLFKY I+ PNQLTA +LVIQYWIDR+TVNPG
Sbjct: 110 ATYIPLDGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPG 169

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
           VWITIFLVVIVIIN  GV++FGEFEFWLSSFK                   P+HDRLGFR
Sbjct: 170 VWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFR 229

Query: 279 YWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAV 338
           YW++PGAFKPYS++I GS GKFV+FV+VFVYALFAYLGIELTGIVAAEA NPR+++PRA+
Sbjct: 230 YWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAI 289

Query: 339 KLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIF 398
           KLT++RI++FY+VTIFLLGMCVAYNDPRLL            PFVVAIQNSG+R LPHIF
Sbjct: 290 KLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQNSGVRALPHIF 349

Query: 399 NACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAY 458
           N CVLIFVFSACNSDLYVG+RSLYSLA+DGKAP +F +T  WG+P+ +L  C LF LLAY
Sbjct: 350 NVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGCFLFCLLAY 409

Query: 459 MNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYG 518
           MNVSSGSAQ+FNYFVNVVSIFG+LSWI I ITYI F RA   Q VDR+ FAY APFQPYG
Sbjct: 410 MNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYG 469

Query: 519 TYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHE 578
            Y +L +CV IAFIKNFTVF+G  FDYK+FITGYIGLP++VIFYFGYK I KTK+VK+ E
Sbjct: 470 AYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEE 528

Query: 579 VDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625
            DL++ KE  D++E EGKI + E + RL+ +K SL+W YEK+LG IF
Sbjct: 529 ADLYSFKEAIDREEAEGKIKEAEAKERLKNSKKSLKWFYEKYLGYIF 575

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/531 (67%), Positives = 414/531 (77%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
            T  L+K+L+ARH+SM                      GP SM IAY FVG+LVFFTMA 
Sbjct: 76  ETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFFTMAC 135

Query: 155 IGEMASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDT 214
           +GEMASYIP+DGFTSYASRYVDPALGFA+GY YLFKY IL PNQLTAA+LVIQYW+ RD 
Sbjct: 136 LGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDR 195

Query: 215 VNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 274
           VNPGVWITIFLVVIV IN+ GV+FFGEFEFWLSSFK                   PDHDR
Sbjct: 196 VNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHDR 255

Query: 275 LGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSV 334
           LGFRYW+ PGAFK YS AI GS GKFVAF SVFVY+LF+Y GIELTGIV +EA NPRKSV
Sbjct: 256 LGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNPRKSV 315

Query: 335 PRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVL 394
           P+A+KLTV+RI++FYL T+FLLGMCVAYNDPRLL            PFVVAIQNSGI+VL
Sbjct: 316 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSGIKVL 375

Query: 395 PHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFA 454
           PHIFN CVL+FVFSACNSDLYV SR+LY+LA+DGKAP IF +T+ WG+P+Y+L V VLF 
Sbjct: 376 PHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVSVLFC 435

Query: 455 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPF 514
            LAYMNVS+GSA++FNYFVNVVS+FG+LSWI I I YI F RA + QGVD+SKFAY AP 
Sbjct: 436 CLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAYVAPG 495

Query: 515 QPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV 574
           Q YG YF+L +C+ IA IKNFTVFLGH+FDYK FITGYIGLP++V  + GYK I KTK+V
Sbjct: 496 QRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYKTKVV 555

Query: 575 KSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625
           K  + DL+T KE++D++E +GK+ DQEK+ RL+ N  +LEW YEKFLGNIF
Sbjct: 556 KPADADLYTLKEIYDREEEQGKLQDQEKEERLQRNGKNLEWFYEKFLGNIF 606

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/527 (66%), Positives = 415/527 (78%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK L+ARH+SM                      GP +M IAY+FVG+LVFFTMA +GEM
Sbjct: 80  LKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFFTMACLGEM 139

Query: 159 ASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
           ASYIP+DGFTSYASRYVDPALGFA+GY YLFKY IL PNQLTAA+LVIQYWI RD VNPG
Sbjct: 140 ASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPG 199

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
           VWITIFLVVIV IN+ GVKFFGEFEFWLSSFK                   PDHDRLGFR
Sbjct: 200 VWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHDRLGFR 259

Query: 279 YWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAV 338
           YW+ PGAFK YS AI GS GKF +FV+VFVY+LF+Y GIELTGIV +EA NPRKSVP+A+
Sbjct: 260 YWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAI 319

Query: 339 KLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIF 398
           KLTV+RI++FYL T+FLLGMCVAYNDPRLL            PFVVAIQNSGI+VLPHIF
Sbjct: 320 KLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPHIF 379

Query: 399 NACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAY 458
           NACVL+FVFSACNSDLYV SR+LY+LA+DGKAP IF +T+ WG+P+ +L + VLF  LAY
Sbjct: 380 NACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLAY 439

Query: 459 MNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYG 518
           MNVSSGSA++FNYFVNVVS+FG+LSWI I I YI F +A + QG+D+SKFAY AP Q YG
Sbjct: 440 MNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYG 499

Query: 519 TYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHE 578
            YF+L++C+ IA IKNFTVFLGH FDYK FITGYIGLPV+++ + GYK I KTK++KS +
Sbjct: 500 AYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKVIKSTD 559

Query: 579 VDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625
           VDL+T KE++D++E EG+I DQE++ RL+ N  ++EW YEKFLG IF
Sbjct: 560 VDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/533 (68%), Positives = 418/533 (78%), Gaps = 2/533 (0%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           +HT  L+K+L+ARH+SM                     AGP SMFIAY+FVG+LVFFTMA
Sbjct: 82  EHTR-LRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFFTMA 140

Query: 154 AIGEMASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           A+GEMASYIP+DGFTSYASRY DPALGFAVGY YL KYLIL PNQLTAA+LVIQYW+DR+
Sbjct: 141 ALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDRE 200

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            VNPGVWITIFLV+IV +N  GVKFFGEFEFWLS+FK                   P HD
Sbjct: 201 QVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHD 260

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
           RLGFR++ HPGAFKPYS +IDGS GKFVAFV+V VYALFAYLGIELTGIVAAEA NPRKS
Sbjct: 261 RLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGIELTGIVAAEAANPRKS 320

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P+A+KLT++RI++FYLVTIFLLGMCVAY+DP L             P+VVAI NSGI+ 
Sbjct: 321 IPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAASPYVVAIINSGIKA 380

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LPHIFNACVL+FVFSACNSDLYV SR+LY LA+D KAP IF  T  WG+P+YSL +   F
Sbjct: 381 LPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCF 440

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LLAYM+VSSGSA++FNYFVNVVSIFGLLSWI I ITY+ F RAVK Q VDRS+FAY AP
Sbjct: 441 CLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAP 500

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKI 573
           FQPYG+YF+LA+C+ IAFIKNFTVFL H FDYKNFITGYIG+PVFVI YFGYKF+KKTKI
Sbjct: 501 FQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKI 560

Query: 574 VKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFS-LEWIYEKFLGNIF 625
            K  EVDL+T K   D++E +GKI D E++ RL+ +K    +W YEK LGNIF
Sbjct: 561 WKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKVLGNIF 613

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/531 (66%), Positives = 416/531 (78%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
            T  L+K+L+ARH+SM                      GP +M IAY+FVG+LVFFTMA 
Sbjct: 77  ETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFFTMAC 136

Query: 155 IGEMASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDT 214
           +GEMASYIP+DGFTSYASRYVDPALGFA+GY YLFKY IL PNQLTAA+LVIQYW+ RD 
Sbjct: 137 LGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDR 196

Query: 215 VNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 274
           VNPGVWITIF+VVIV INV GVKFFGEFEFWLSSFK                   PDHDR
Sbjct: 197 VNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGPDHDR 256

Query: 275 LGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSV 334
           LGFRYW+ PGAFK YS AI G  GKFV+F++VFVY+LF+Y GIELTGIV +EA NPRKSV
Sbjct: 257 LGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNPRKSV 316

Query: 335 PRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVL 394
           P+A+KLTV+RI++FYL T+FLLGMCVAYNDPRL+            PFVVAIQNSGI+VL
Sbjct: 317 PKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNSGIKVL 376

Query: 395 PHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFA 454
           PHIFNACVL+FVFSACNSDLYV SR+LY+LA+DGKAP IF +T  WG+P+ +L   VLF 
Sbjct: 377 PHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFSVLFC 436

Query: 455 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPF 514
            LAYMNVS+GSA++FNYFVNVVS+FG+LSWI I I YI F +A + QG+D+SKFAY AP 
Sbjct: 437 CLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPG 496

Query: 515 QPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV 574
           Q YG YF+L +C+FIA IKNFTVFLGH FDYK FITGYIGLPV+V  + GYK I KTK++
Sbjct: 497 QRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVYVFSWVGYKLIYKTKVI 556

Query: 575 KSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625
           KS +VDL+T KE++D++E +GKI DQEK+ RL++N  ++EW YEKFLG+IF
Sbjct: 557 KSTDVDLYTFKEIYDREEEQGKIEDQEKEERLKKNGKNMEWFYEKFLGHIF 607

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/527 (66%), Positives = 415/527 (78%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L+K+L+ARH+SM                      GP +M IAY+FVG+LVF+TMA +GEM
Sbjct: 82  LRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFYTMACLGEM 141

Query: 159 ASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
           ASYIP+DGFTSYASRYVDPALGFA+GY YLFKY IL PNQLTAA+LVIQYWI RD VNPG
Sbjct: 142 ASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPG 201

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
           VWITIFLVVIV INV GVKFFGEFEFWLSSFK                   P+HDRLGFR
Sbjct: 202 VWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPNHDRLGFR 261

Query: 279 YWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAV 338
           YW+ PGAFK YS AI G  GKFV+FV+VFVY+LF+Y GIELTGIV +EA NPRKSVP+A+
Sbjct: 262 YWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAI 321

Query: 339 KLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIF 398
           KLTV+RI++FYL T+FLLGMCVAYNDPRLL            PFVVAIQNSGI VLPHIF
Sbjct: 322 KLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPHIF 381

Query: 399 NACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAY 458
           NACVL+FVFSACNSDLYV SR+LY+LA+DGKAP IF +T+ WG+P+ +L + VLF  LAY
Sbjct: 382 NACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGLAY 441

Query: 459 MNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYG 518
           MNVSSGSA++FNYFVNVVS+FG+LSWI I I YI F +A + QG+D+SKFAY AP Q YG
Sbjct: 442 MNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYG 501

Query: 519 TYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHE 578
            YF+L +C+ IA IKNFTVFLGH FDYK FITGYIGLPV++I + GYK I KTK++KS +
Sbjct: 502 AYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKVIKSTD 561

Query: 579 VDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625
           VDL+T KE++D++E EG++ DQEK+ RL+ N  ++EW YEKFLGNIF
Sbjct: 562 VDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/530 (66%), Positives = 412/530 (77%), Gaps = 3/530 (0%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK+L+ARH+SM                     AGPAS+ IAY+FVG LVFFTMAA+GEM
Sbjct: 82  LKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFTMAALGEM 141

Query: 159 ASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
           A+YIP+DGFTSYASRY DPALGFAVGY YLFKY I+ PNQLTAA+LVIQYW+DRDTVNPG
Sbjct: 142 AAYIPLDGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWVDRDTVNPG 201

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
           VWITIFLVVI+ IN  GVK+FGEFEFWLSSFK                   P+HDRLGFR
Sbjct: 202 VWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGPNHDRLGFR 261

Query: 279 YWQHPGAFKPYSDA---IDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVP 335
           YW+ PGAFKPYS +   I+GS GKFVAFV+VFVYALFAYLGIELTGIVAAEA NPR+++P
Sbjct: 262 YWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEAENPRRNIP 321

Query: 336 RAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLP 395
           RA+KLTVWRI+ FY+ TIFLLGMCVAY+DP LL            PFVVAIQNSG+ VLP
Sbjct: 322 RAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQNSGVDVLP 381

Query: 396 HIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFAL 455
           HIFN CVL+FVFSACNSDLYVG+RSLYSLAVDGKAP IF +T  WG+P+ ++G CVLF L
Sbjct: 382 HIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAMGGCVLFCL 441

Query: 456 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQ 515
           LAYMNVSSGSA++FNYFVNVVSIFG+LSW  I IT+I F RAV+ QG+DRS FAY APFQ
Sbjct: 442 LAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRSTFAYVAPFQ 501

Query: 516 PYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVK 575
           PYG+YF+L +CV +A IKNF+VFLG+ FDYK FITGYIGLPV+   + GYK   KTK VK
Sbjct: 502 PYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYKLYYKTKTVK 561

Query: 576 SHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625
            HE DL + K   D++E EGKI + E++ RL+  K  LEW YEK++ +IF
Sbjct: 562 PHEADLNSYKAAVDREEEEGKIKEAERKERLKHGKKDLEWFYEKYISSIF 611

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/533 (66%), Positives = 408/533 (76%), Gaps = 2/533 (0%)

Query: 95  HTDG--LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTM 152
            T+G  LKK L+ARHVSM                     AGP S  IAY+FVG+LVFFTM
Sbjct: 62  KTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFTM 121

Query: 153 AAIGEMASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
           A +GEMA+YIP+DGFTSYASRY DPALGFAVGY YLFKY IL PNQLTAA+LVIQYW+D+
Sbjct: 122 ACLGEMATYIPLDGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDK 181

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
           + VNPGVW+TIFLVVIV INV GV+FFGEFEFWLSSFK                   PDH
Sbjct: 182 EKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGPDH 241

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
           DRLGFRYW+HPG+FK YS+ I G  G+FVAFVSVFVYA +AYLGIELTGIVAAEA NPRK
Sbjct: 242 DRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRK 301

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           S+P+A+KLT++RIVIFYL++IFLLGMCVAY+DP L+            PFVVAI NSGI 
Sbjct: 302 SIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINSGIN 361

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
            LPHI NACVL+FVFSACNSDLYV SRSLYSLA+D KAP IF +T  WG+P+Y+L V VL
Sbjct: 362 ALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVL 421

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
           F LLAYM VSS SA++FNYFVNVVSIFG+LSWI I ITYI F RAV+ QGVD+S FAY A
Sbjct: 422 FCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVA 481

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK 572
           PFQPYG +FSL +C  IA IKNFTVFL H FDYKNFITGYIGLPVF   YFGYKF  KTK
Sbjct: 482 PFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTK 541

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625
           ++   +VDL+T K   DQ+E +GK+ D EK  R+++N  + EW Y+KFLGNIF
Sbjct: 542 VIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGKNFEWFYDKFLGNIF 594

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/533 (66%), Positives = 404/533 (75%), Gaps = 2/533 (0%)

Query: 95  HTDG--LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTM 152
            T+G  LKK L+ R VSM                     AGP SM IAY+FVG+LVFFTM
Sbjct: 65  KTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFTM 124

Query: 153 AAIGEMASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
           A++GEMASYIP+DGFTSYA+RY DPALGFAVGYCYLFKY IL PNQLTAA+LVIQYWI R
Sbjct: 125 ASLGEMASYIPLDGFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWIPR 184

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
           + VNPGVWITIFLVVIV IN  GV+FFGEFEFWLSSFK                   P+H
Sbjct: 185 EKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGGGPNH 244

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
           DRLGFR+W+HPGAF  YS AI G  GKFVAFVSVFVYA FAYLG EL GIV  EA NPRK
Sbjct: 245 DRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIVVGEARNPRK 304

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           SVP+A+KLT++RI+IFYL++I LLGMCV Y+DP LL            PFVVAI NSGI+
Sbjct: 305 SVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGIK 364

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
           VLPHIFNACVL+FVFSACNSDLYV SRSLYSLA+D KAP IF RT  WG+P+YSLG+ VL
Sbjct: 365 VLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSVL 424

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
           F LLAYM+VSSGSA++FNYFVNVVSIFGLLSWICI +TY+ F RAV+ QG+D+S F+Y A
Sbjct: 425 FCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYVA 484

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK 572
           P Q YG YF+L +C  IA IKNFTVFLGH FDYK FITGYIG+PVF I YFGYK I KTK
Sbjct: 485 PGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYKTFITGYIGIPVFFISYFGYKLIYKTK 544

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625
           I+   EVDL+T K   DQ+E +GK+ D  ++ R++ N  + EW Y+KFL NIF
Sbjct: 545 IIDPLEVDLYTFKAAIDQEEEDGKLEDIARKERIKANGRNFEWFYDKFLSNIF 597

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/534 (65%), Positives = 405/534 (75%), Gaps = 3/534 (0%)

Query: 94  KHTDG--LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFT 151
           KH DG  LKK L+ARHVSM                     AGP S+ IAYSFVG LV+  
Sbjct: 49  KH-DGIRLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIV 107

Query: 152 MAAIGEMASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           M  +GEMA+YIP+DGFTSYASRY DPALGFAVGY YLFKYLI+ PNQLTAA+LV+QYW+ 
Sbjct: 108 MTCLGEMATYIPLDGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVS 167

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
           R+ VNPGVWITIFLV+IV INV GVKFFGEFEFWLSSFK                   P 
Sbjct: 168 REKVNPGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPS 227

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
           HDRLGFR+++ PGAF+PYS+AI GS GKFV+FV+VFVYALFAYLG EL GIVAAE  NPR
Sbjct: 228 HDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPR 287

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           ++VPRA+KLT++RIV+FYLVTIFLLGM VAYNDP LL            PFVVAI+N+GI
Sbjct: 288 RNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGI 347

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
            VLPHIFNACVL+FVFSACNSDLYV SRSLY LA+D KAP IF +T  WG+P+ SL +C+
Sbjct: 348 PVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCI 407

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           LF LLAYMNVSSGSAQVFNYFVNVVSIFGL+SWI I ITYI F RA++ QGVD+S  AY+
Sbjct: 408 LFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYA 467

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT 571
           AP    G YF+L +C  IA IKNFTVFLGH FDYKNFITGYIG+PVF+I +FGYK+I+ T
Sbjct: 468 APLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGT 527

Query: 572 KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625
           K VK  E DL+T KE+ D +E EGK+ D  ++ ++  +  + +W YEKFLG IF
Sbjct: 528 KFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/527 (65%), Positives = 400/527 (75%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK+L+ARHVSM                     AGP SM I+YSFVG+LVFF M+ IGEM
Sbjct: 62  LKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCIGEM 121

Query: 159 ASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
           A+YIP+DGFTSYASRY DPALGFAVGY YL KY IL PNQLTAA+LVIQYWI R+ VNPG
Sbjct: 122 AAYIPLDGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREKVNPG 181

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
           VWITI LVVIV+IN  GVKFFGEFEFWLSSFK                   P HDRLGFR
Sbjct: 182 VWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRLGFR 241

Query: 279 YWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAV 338
           YW+HPGAFK YS +I G +G+FV+FVS FVY LF YLGIELTGIVAAEA NPRK++P+A+
Sbjct: 242 YWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNIPKAI 301

Query: 339 KLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIF 398
           KLT+WRI+IFY++TIFLLGMCV+ NDP LL            PFVVAI NSGI  LPHIF
Sbjct: 302 KLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEALPHIF 361

Query: 399 NACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAY 458
           NACVL+FVFSACNSDLYV SR+LYSLA+D KAP IF +T  +G+P+ SLGV VLF LLAY
Sbjct: 362 NACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCLLAY 421

Query: 459 MNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYG 518
           M+VSSGSA++FNYFVNVVSI G+L+WI I ITYI F RAV+ QG+D+S FAY AP QPYG
Sbjct: 422 MSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPLQPYG 481

Query: 519 TYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHE 578
            YFSL +C  +A IKNFTVFL H FDY+NFITGYIGLP+F I YFGYKF+KKTKI K  E
Sbjct: 482 AYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICYFGYKFVKKTKIRKPEE 541

Query: 579 VDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625
           VDLF+ K   DQ+E +G+I D     R+++N  + EW YE +LG IF
Sbjct: 542 VDLFSFKAAIDQEEEDGRIKDAATAERIKKNGKNWEWFYETYLGKIF 588

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/536 (61%), Positives = 392/536 (73%), Gaps = 5/536 (0%)

Query: 95  HTDG--LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTM 152
            T+G  LKKNL+ARHVSM                     AGP S+FI YSFVG+LVFFTM
Sbjct: 58  KTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTM 117

Query: 153 AAIGEMASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
           + +GEMA++IP+DGFTSYASRYVDPALGFAVGY YL KYLIL  NQLTA ++V+QYW+DR
Sbjct: 118 SCLGEMAAFIPLDGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVDR 177

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
           DT+NPGV+ITIFL++IV IN+ GVK FGEFEFWLSSFK                   P+H
Sbjct: 178 DTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNH 237

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGS---VGKFVAFVSVFVYALFAYLGIELTGIVAAEAYN 329
           DRLGFRYW+ PG+FKPYS +I       GKFV+F S FVYALF YLGIELTGIVAAEA N
Sbjct: 238 DRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQN 297

Query: 330 PRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNS 389
           PRK++P+A+KLT++RI+IFY++TI LL MCVAYNDP LL            PFVVAI+NS
Sbjct: 298 PRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIENS 357

Query: 390 GIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGV 449
           GI +LPHIFN CVL FV SA NSDLYV SRSLYSLA+D KAP  F +T  WG+P++SL  
Sbjct: 358 GINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAF 417

Query: 450 CVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFA 509
              F+ LAYMNVSS ++ VFNYFVN VSIFG++SWICI +TYI F +A K QG+D+S F 
Sbjct: 418 STAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFT 477

Query: 510 YSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIK 569
           Y AP+QPYG YF+L +C  +A +KNFTVFLG  FDYKNFITGYIG+PVF I + GYK + 
Sbjct: 478 YVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKIVY 537

Query: 570 KTKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625
           KTK  +  EVDL T K + DQ+E +GKI D E++ RL+       W Y++FLG IF
Sbjct: 538 KTKTHRPEEVDLVTLKALIDQEEEDGKIEDAEREERLKNGNKDWAWFYDRFLGKIF 593

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/527 (62%), Positives = 398/527 (75%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK L+ARHVSM                     AGPAS+ I+YSFVG+LV+  MA +GEM
Sbjct: 51  LKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVMACLGEM 110

Query: 159 ASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
           A++IP+DGFTSYASRYVDPALGFAVGYCYLFKY I+ PNQLTA ++V+QYW+ R+ VNPG
Sbjct: 111 AAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPG 170

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
           VWITIFLV+IV+IN  GV+FFGEFEFWLSS K                   P+HDR GFR
Sbjct: 171 VWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFR 230

Query: 279 YWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAV 338
           YW+ PGAFKPYS+AI GS GKFV+F SVF  ALFAY G EL GIVAAEA NPR+SVPRA+
Sbjct: 231 YWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAI 290

Query: 339 KLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIF 398
           KLT++RIV+FY+++I LLGM VAYNDP L+            PFVVAI+N+GI VLPHIF
Sbjct: 291 KLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAGIPVLPHIF 350

Query: 399 NACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAY 458
           NACVL+FVFSACNSDLYV SR+LY LA+D KAP IF +T  WG+P+YSL V VLF LLAY
Sbjct: 351 NACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAY 410

Query: 459 MNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYG 518
           MNVSSGSAQ+FNYFVNVVSIFGLLSWI I ITY+ F +AV  Q  D+S F+Y+APFQP+ 
Sbjct: 411 MNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWS 470

Query: 519 TYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHE 578
           T+ SL +C  I  IKN+TVFLGH+FDYK FI+GYIG+PV+ I Y GYK + ++K++K  +
Sbjct: 471 TWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPED 530

Query: 579 VDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625
           VDL+T K   D +E EGK+L+ E++ +L+ +  +L W Y+ FLG IF
Sbjct: 531 VDLYTFKAAIDAEEEEGKLLELERKEQLKSSPKNLTWFYDTFLGWIF 577

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/527 (61%), Positives = 393/527 (74%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK L+ARHVSM                     AGP S+ I+YSFVG+LV+  M+ +GEM
Sbjct: 50  LKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEM 109

Query: 159 ASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
           A++IP+DGFTSYASRYVDPA+GFAVGY YLFKY I+ PNQLTA ++V+Q+W+ RD VNPG
Sbjct: 110 AAFIPLDGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPG 169

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
           VWITIFL +IV+IN  GV+FFGEFEFWLSS K                   P+HDR GFR
Sbjct: 170 VWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFR 229

Query: 279 YWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAV 338
           +W+ PGAFKPYS+AI GS GKFV+F SVF  ALFAY G EL GIVAAEA NPR+SVPRA+
Sbjct: 230 FWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAI 289

Query: 339 KLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIF 398
           KLT++RIV+FY++TI LLGM VAYNDPRLL            PFVVAI+N+ I VLPHIF
Sbjct: 290 KLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIF 349

Query: 399 NACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAY 458
           N CVL+FVFSACNSDLYV SRSLY LA+DGKAP IF  T  WG+P+YSLG+ VLF LLAY
Sbjct: 350 NVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAY 409

Query: 459 MNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYG 518
           MNVSSGSAQVFNYFVNVVSIFGLLSWI I ITYI F +A++VQ  D+S  +Y+A FQP+ 
Sbjct: 410 MNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWS 469

Query: 519 TYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHE 578
           TY +L +C  I  IKN+TVFLGH FDYK FI+GYIG+PV++I Y GYK + +TK++K  +
Sbjct: 470 TYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPED 529

Query: 579 VDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625
           VDL+T K+  D +E E K+L++E+   +  +  + +W YE FLG IF
Sbjct: 530 VDLYTFKDAIDAEEEEYKLLEKERLENMENSPKNFKWFYETFLGWIF 576

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/531 (59%), Positives = 387/531 (72%), Gaps = 3/531 (0%)

Query: 94  KHTDG--LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFT 151
           KH DG  LKK L+ARHVSM                     AGPA++ IAY+FVG+LVFF 
Sbjct: 73  KH-DGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFV 131

Query: 152 MAAIGEMASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           M+ +GEMA+YIP+DGFTSY++RY DPALGFAVGY YLFKY I+ PNQLTA +LVIQYW+D
Sbjct: 132 MSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVD 191

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
           RD VNPGVWITI LV I+ IN  GV+FFGE E+++S+ K                   P+
Sbjct: 192 RDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGPN 251

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
           H+ LGF+YW++PGAFK YS AI G+ G+FV+F SVFV ALFAYLG EL GIV +E  NPR
Sbjct: 252 HEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPR 311

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           K+VP+A+KLT++RI++FYL++IFLLGMCV +NDP L+            PFVVAI N+GI
Sbjct: 312 KAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAGI 371

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
            VLPHI NAC+LIFVFSA NSDLYV SRSLY LA+D KAP IF +T   G+P++SL V V
Sbjct: 372 PVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGV 431

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           LFALLAYMNVSSGS++VF YFVN VSIFGLLSWI I ITYI F +A +VQG+D+S  AY 
Sbjct: 432 LFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQ 491

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT 571
           +P QPYG +FSL +C+ I  IKNF  FLG +FDYK+FITGYIG+P ++I Y GYK   KT
Sbjct: 492 SPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYKT 551

Query: 572 KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLG 622
           KI+ S EVDL + KE  D +E EGK+LD+E+   L  +   L+W YEK  G
Sbjct: 552 KIIPSEEVDLVSFKEAVDLEEEEGKMLDEERAAHLAAHGKDLKWCYEKIFG 602

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/529 (59%), Positives = 383/529 (72%), Gaps = 6/529 (1%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK+LQARHVSM                     AGP ++ IAYS +G +VF  M+ +GEM
Sbjct: 58  LKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTVMSCLGEM 117

Query: 159 ASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
           A+YIP+DGFTSYA+RY DPALGFAVGY YLFKYL+L PNQLTAA+LV+QYW+ R  VNPG
Sbjct: 118 AAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVNPG 177

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
           VWIT+FL VI+ IN+ GVKFFGEFEFWLSSFK                   P H+RLGFR
Sbjct: 178 VWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGPSHNRLGFR 237

Query: 279 YWQHPGAFKPYSDA--IDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
           YW+ PG FKPYS A  I G  GKFV+F SVFVYALFAYLG EL GIVAAE  NPR++VPR
Sbjct: 238 YWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPRRNVPR 297

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A+KLT++RIV+FYL T+FLLG+ VAYNDP LL            P+VVAI+N+GI VLPH
Sbjct: 298 AIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKNAGIPVLPH 357

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           IFNACVL FVFSACNSDLYVGSRSLY LA+D KAP IF +T SWG+P+ SL +C LF  L
Sbjct: 358 IFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCTLFCCL 417

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           AYMNVSS +  +F+YFVNV SIFGLLSWI I ITYI F RA +VQG+D++  +Y APFQP
Sbjct: 418 AYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQAPFQP 477

Query: 517 YGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKS 576
              + +L +C+ +A +KNFTVFLG +FDYK FITGYIG+PV+++ +  YK + KTK +KS
Sbjct: 478 VTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKTKWIKS 537

Query: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625
             VDLFT K   D +E EGK+    + +RL+E +    W +++F   IF
Sbjct: 538 ANVDLFTYKTAIDLEEEEGKL----EMMRLKEERKQHGWTWKQFYDYIF 582

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/528 (59%), Positives = 381/528 (72%), Gaps = 4/528 (0%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK L++RH+SM                     AGP S  IAY+FVGI+VFFTMA +GEM
Sbjct: 65  LKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTMACLGEM 124

Query: 159 ASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
           A++IP+DGFTSYASRY DPALGFAVGY YL KY IL PNQLTAA++V+QYW+ RDTVNPG
Sbjct: 125 ATFIPLDGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWVPRDTVNPG 184

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
           +W+T+   VI +IN+ GV+FFGEFEFWLSS K                     HDRLGFR
Sbjct: 185 IWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAGSHDRLGFR 244

Query: 279 YWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAV 338
           YW+HPGAF  YSD I GS+GKFV+FV+V V  +FAYLGIELTGIVAAEA NPR+SVP+A+
Sbjct: 245 YWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNPRRSVPKAI 304

Query: 339 KLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIF 398
           KLT +RI++FY+V+IFLLGMCV YND +L+            PF +AI N+GI VLP IF
Sbjct: 305 KLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTAS--PFSIAILNAGITVLPDIF 362

Query: 399 NACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAY 458
           N C+LIFVFSA NSDLYV SR+LYSLAVD KAP IF  T  WG+P+ SL V  LF LLAY
Sbjct: 363 NGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLFCLLAY 422

Query: 459 MNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYG 518
           M VSS SAQVF YFVNVVSI GLL+WI I ITYI F RAV+ Q VD+S FAY APFQPYG
Sbjct: 423 MTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYVAPFQPYG 482

Query: 519 TYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHE 578
            Y SL +C  IA IKNFTVFLGH FDYK FITGYIGLP+FV+ YFGYK   K++I  +  
Sbjct: 483 AYVSLFFCCLIAIIKNFTVFLGH-FDYKTFITGYIGLPIFVLCYFGYKITCKSEIRSARY 541

Query: 579 VDLFTGKEVFDQQEIEGKILDQEKQIRLREN-KFSLEWIYEKFLGNIF 625
           VDL + K + D++++E ++++Q K+  +  N K+S+     ++  N F
Sbjct: 542 VDLVSQKSLVDREQVEYELIEQLKREEMIANTKYSIVIALRRWFSNFF 589

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/532 (57%), Positives = 369/532 (69%), Gaps = 7/532 (1%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK+LQARHVSM                     AGP S+ IAYS +G +VF  M+ +GEM
Sbjct: 59  LKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTVMSCLGEM 118

Query: 159 ASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
           A+YIP+DGFTSYA+RY DPALGFAVG+ YLFKYL+L PNQLTA +LVIQ+WI    V+PG
Sbjct: 119 AAYIPLDGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWIPAARVSPG 178

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
           VWIT+ L VIV+IN  GV+FFGEFEFWLSSFK                   P HDRLGFR
Sbjct: 179 VWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGPTHDRLGFR 238

Query: 279 YWQHPGAFKPYSDA---IDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVP 335
           YW  PGAFK YS     I G +GKFVAF+SVFVYALFAYLG EL GIVAAE  +PR++VP
Sbjct: 239 YWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAECKDPRRNVP 298

Query: 336 RAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLP 395
           RA+KLT++RIV+FYLVTIFLLGMCVAYNDP L+            P+VVAI+N+ I VLP
Sbjct: 299 RAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIENAVIPVLP 358

Query: 396 HIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFAL 455
           ++FNACVL FVFSACNSDLYVGSRSLY LA+DGKAP +F RT  WG+P+ +L  C LF  
Sbjct: 359 NLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNALACCTLFCC 418

Query: 456 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQ 515
           LAYM+VS  +   F YFVNV SIFGL+SW+ I ITYI F RA + QG+ +S  +Y AP Q
Sbjct: 419 LAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKSTLSYVAPCQ 478

Query: 516 PYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVK 575
           PY  + +L +C+F+A IKNF  F+G   D   FITGYIGLP+++  + GYK + KTK + 
Sbjct: 479 PYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLPIYIFCFIGYKIVHKTKWIP 538

Query: 576 SHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEW--IYEKFLGNIF 625
           S EVDLFT KE  D +E E   + +   ++ +  K  L W  IY+  LG IF
Sbjct: 539 SKEVDLFTFKEAIDLEEEE--CIRERALMKEQLAKGGLSWKKIYDNVLGWIF 588

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  345 bits (884), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 200/535 (37%), Positives = 291/535 (54%), Gaps = 29/535 (5%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK+ LQ+RHV +                      GPA +FI+Y  +  +++  M A+GEM
Sbjct: 106 LKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEM 165

Query: 159 ASYIPMDGFTSYAS------RYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
             ++P DG  S  S      RYVDP+LGFA G+ Y + Y+IL   + TAAS V++YW   
Sbjct: 166 VCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYWTT- 224

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
             V  GVWITIFL V+VI+N + VK +GE EFW +S K                   P+H
Sbjct: 225 -AVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNH 283

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAAEAYNPR 331
           DRLGFRYWQHPGAF  +     GS+G F    +  +   FA+ LG EL  + +AE  + R
Sbjct: 284 DRLGFRYWQHPGAFAHH--LTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQR 341

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPFVVAIQNSG 390
           +++ +A +  VWR++ FY++    + + V YNDP L+             PFV+ IQN+G
Sbjct: 342 RNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAG 401

Query: 391 IRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVC 450
           I+VLPHI N C+L   +SA N+ ++  +RSL ++A  G+AP    R   WG+P+ ++GV 
Sbjct: 402 IKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVS 461

Query: 451 VLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGV-DRSKFA 509
            L + LAY+NVSS +A VFN+F N+ +I G L W+C  I Y+ F +A+   G+ DR  F 
Sbjct: 462 FLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGLYDRLPFK 521

Query: 510 YSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIK 569
                QPY  +FSL     I     + +F+   +   +FI  YI LP+F++ +FG+K   
Sbjct: 522 TWG--QPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLYT 579

Query: 570 KT---KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFL 621
           +T     +   E+D+ TG       EIE K  + E ++RL    F      +KFL
Sbjct: 580 RTWRQWWLPVSEIDVTTG-----LVEIEEKSREIE-EMRLPPTGFK-----DKFL 623

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  338 bits (868), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/525 (36%), Positives = 287/525 (54%), Gaps = 24/525 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK+ LQ+RHV +                      GPA +FI+Y  +  +++  M A+GEM
Sbjct: 110 LKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEM 169

Query: 159 ASYIPMDGFTSYAS------RYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
             ++P DG  S  S      RYVD +LGFA G+ Y + Y+IL   + TAAS V++YW   
Sbjct: 170 VCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTT- 228

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
             V  GVWITIFL V+V++N++ VK +GE EFW +S K                   P+H
Sbjct: 229 -AVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNH 287

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAAEAYNPR 331
           DRLGFRYWQHPGAF  +     GS+G F    +  +   FA+ LG EL  + +AE  + R
Sbjct: 288 DRLGFRYWQHPGAFAHH--LTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQR 345

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPFVVAIQNSG 390
           +++ +A +  VWR++ FY++    + + V YNDP L+             PFV+ IQN+G
Sbjct: 346 RNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQNAG 405

Query: 391 IRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVC 450
           I+VLPHI N C+L   +SA N+ ++  +RSL ++A  G+AP    R   WG+P+ ++GV 
Sbjct: 406 IKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVGVS 465

Query: 451 VLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGV-DRSKFA 509
            L + LAY+NVSS +A VFN+F N+ +I G L W+C  I Y+ F +A+   G+ DR  F 
Sbjct: 466 FLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGLFDRLPFK 525

Query: 510 YSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIK 569
                QPY  + SL     I     + +F+   +   +FI  YI LP+F++ +FG+K   
Sbjct: 526 TWG--QPYTVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLYT 583

Query: 570 KTKI---VKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
           +T     +   E+D+ TG       EIE K  + E ++RL  + F
Sbjct: 584 RTWSQWWLPVSEIDVTTG-----LIEIEEKSREIE-EMRLPPSSF 622

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  335 bits (858), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/536 (35%), Positives = 294/536 (54%), Gaps = 21/536 (3%)

Query: 93  PKHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTM 152
           P+    LKK L++RH+ +                      GPA +F +Y  + ++++  M
Sbjct: 45  PQGDHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVM 104

Query: 153 AAIGEMASYIPMDGFT------SYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVI 206
            A+GEM  Y+P DG +         +RYVDP+LGFA G+ Y + Y+IL   + TAAS V+
Sbjct: 105 NALGEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVV 164

Query: 207 QYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 266
           QYW     V  G WITIFL V+V++N   VKF+GE EFW +S K                
Sbjct: 165 QYW--TTAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFW 222

Query: 267 XXXPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAA 325
              P HDRLGFRYWQ PGAF  +     G+ G+F+   +  +   FA+ LG EL  + +A
Sbjct: 223 GGGPHHDRLGFRYWQKPGAFAYH--ITSGNTGRFLDIWTGVIKGGFAFILGPELVALTSA 280

Query: 326 EAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRL-LXXXXXXXXXXXXPFVV 384
           EA + R+++ +A +  V+R++ FY+ +   +G  VAYND  L              PFV+
Sbjct: 281 EAQDARRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVI 340

Query: 385 AIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPH 444
            IQN+GI+VLPHI N C+L   +S+ NS ++  SRSL S++ +G AP I  R   +G+P+
Sbjct: 341 GIQNAGIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPY 400

Query: 445 YSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVD 504
            ++ +  L + +AY+NVSS +A VF +F N+ +I G + WICI I Y+ F +A+  Q + 
Sbjct: 401 AAVALTSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL- 459

Query: 505 RSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFG 564
             +  +  PFQPYGT+F +     I     + +F+  +++  +FI  Y+ LP+F++ + G
Sbjct: 460 YERVPFKTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIG 519

Query: 565 YKFIK---KTKIVKSHEVDLFTG-KEVFDQQEIEGKILDQEKQIRLRENKFSLEWI 616
           +K      KT  +   E+D+ TG KE+    E E K  D+++ +        +EW+
Sbjct: 520 HKLWTRTWKTWAIPVPEIDVTTGLKEI----EEESKECDEKRIVPTTAGGKFMEWL 571

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  335 bits (859), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/519 (36%), Positives = 286/519 (55%), Gaps = 22/519 (4%)

Query: 93  PKHTD----GLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILV 148
           P +TD     LK+ L++RHV +                      GPA +FI+Y  +  ++
Sbjct: 65  PHYTDMTGHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVI 124

Query: 149 FFTMAAIGEMASYIP-----MDGFTSY-ASRYVDPALGFAVGYCYLFKYLILCPNQLTAA 202
           +  M  IGEM  Y+P      +GF +Y   +YVD +LGFA  + Y + Y+IL   + TAA
Sbjct: 125 YPIMQGIGEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAA 184

Query: 203 SLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXX 262
           S V++YW    +V    WITIFL  +VI+N   VKF+GE EFW +S K            
Sbjct: 185 SGVVEYWTT--SVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSF 242

Query: 263 XXXXXXXPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTG 321
                  P+HDRLGFRYWQ+PG F  +     GS G F+   +  +   FA+ LG E+  
Sbjct: 243 ILFWGGGPNHDRLGFRYWQNPGGFAHHIRG--GSFGSFLDIYTGIIKGGFAFILGPEMIA 300

Query: 322 IVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXX 380
           + ++E  + R+++ +A +  VWR++ FY++    + + VAYNDP L              
Sbjct: 301 MTSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSS 360

Query: 381 PFVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSW 440
           PFV+ IQN+GI+VLPHI NAC+L   +SA N+ ++  SRSL ++A +G+AP IF +   W
Sbjct: 361 PFVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRW 420

Query: 441 GLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKV 500
           G+P+Y++G+    + LAY+N SS +A VFN+F N+  I G + WIC+ I YI F +A+  
Sbjct: 421 GVPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILF 480

Query: 501 QGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVI 560
            G+ +S+  Y+A   PY  Y+ L     I     + VF+   +D KNF+  YI LPVF +
Sbjct: 481 HGM-QSRLPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWV 539

Query: 561 FYFGYKFIKKT----KIVKS-HEVDLFTGKEVFDQQEIE 594
            + G++  ++     K  KS  E+D+ TG E  +++  E
Sbjct: 540 LWIGHRVYRRKIFTLKWWKSIEEIDVVTGVEEIEEKTRE 578

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  332 bits (852), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 183/513 (35%), Positives = 286/513 (55%), Gaps = 14/513 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+SM                     AGP    IAY F+G L +    ++GEM
Sbjct: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEM 101

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+   FT +  R++ PALG A GY Y   + I    +L+    +IQ+W   D V  
Sbjct: 102 ATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFW--TDAVPL 159

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI IF V++ I N+  VK++GE EFW++  K                        +GF
Sbjct: 160 TAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPVGF 218

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PG + P   + D + G+F+ +VS  + A F Y G EL GI A EA NPRK+VPRA
Sbjct: 219 RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRA 278

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +    +RI+ FY++++  +G+ V +NDP+L             PFV+AI+NSG +VLPHI
Sbjct: 279 INKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENSGTKVLPHI 335

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA +L  + SA NS++YVGSR  YS+A++G AP     TT  G+P+ ++    +   LA
Sbjct: 336 FNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLA 395

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           Y+  SSG++ VFN+ +N+ ++ G  +WI I I++I FM+A+K QG+ R    + A F P+
Sbjct: 396 YLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPW 455

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYK-FIKKTKIVKS 576
           G Y++  +   I  I+ FT F    F   +F T YI + +F +F+ G++ + +    +K+
Sbjct: 456 GAYYAAFFIGVIIIIQGFTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKT 514

Query: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609
            ++DL T     D++EI+  + +++K   L E 
Sbjct: 515 EDIDLDT-----DRREIDDVVWEEQKPRNLWEK 542

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  334 bits (857), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 196/535 (36%), Positives = 289/535 (54%), Gaps = 29/535 (5%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK+ LQ+RHV +                      GPA +FI+Y  +  +++  M A+GEM
Sbjct: 162 LKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEM 221

Query: 159 ASYIPMDGFTSYAS------RYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
             ++P DG  S  S      RYVD +LGFA G+ Y + Y+IL   + TAAS V++YW   
Sbjct: 222 VCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWTT- 280

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
             V  GVWITIFL V+V++N + VK +GE EFW +S K                   P H
Sbjct: 281 -AVPKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKH 339

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAAEAYNPR 331
           DRLGFRYWQHPG+F  +     GS+G F    +  +   FA+ LG EL  + +AE  + R
Sbjct: 340 DRLGFRYWQHPGSFAHH--LAGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQR 397

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSG 390
           +++ +A +  VWR++ FY++    + + V YNDP L+             P+V+ IQN+G
Sbjct: 398 RNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAG 457

Query: 391 IRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVC 450
           I+VLPHI N C+L   +SA N+ ++  +RSL ++A  G+AP    +   +G+P+ ++GV 
Sbjct: 458 IKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVS 517

Query: 451 VLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGV-DRSKFA 509
            L + LAY+NVSS +A VFN+F N+ +I G L WIC  I Y+ F +A+   G+ DR  F 
Sbjct: 518 FLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGLYDRLPFK 577

Query: 510 YSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIK 569
                QPY  +FSL     I     + +F+   ++  +FI  YI LP+F++ + G+K   
Sbjct: 578 TWG--QPYTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYT 635

Query: 570 KTKIVKSH---EVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFL 621
           +T     H   E+D+ TG       EIE K  D E ++RL    F      EKF+
Sbjct: 636 RTWNHWWHSVSEIDVTTG-----LVEIEEKSRDIE-ELRLPPATFK-----EKFM 679

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  330 bits (847), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 196/540 (36%), Positives = 293/540 (54%), Gaps = 33/540 (6%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           HT  LK+ LQ+RH+ +                      GPA +  +Y  + ++++  M A
Sbjct: 47  HT--LKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNA 104

Query: 155 IGEMASYIPMDGFTS------YASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQY 208
           +GEM  Y+P  G  S        SRY DP+LGFA G+ Y + Y+IL   + TAAS V+ Y
Sbjct: 105 LGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTY 164

Query: 209 WIDRDTVNP-GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXX 267
           W    TV P   WITIFL V+ ++N   VKF+GE EFW +  K                 
Sbjct: 165 W---TTVVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWG 221

Query: 268 XXPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAAE 326
             P HDRLGFRYWQ PGAF  +     G+ G+F+   +  +   FA+ LG EL  + ++E
Sbjct: 222 GGPSHDRLGFRYWQKPGAFAYH--ITTGNTGRFLDVWTGVIKGGFAFILGPELVAVTSSE 279

Query: 327 AYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLL-XXXXXXXXXXXXPFVVA 385
           A + R+++ +A +   +R++ FY+ +   +G+ VA NDP L              PFV+A
Sbjct: 280 AMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIA 339

Query: 386 IQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHY 445
           IQN+ I++LPHI NAC+L   +S+ NS ++  SRSL S+A DG AP +FK+    G+P+ 
Sbjct: 340 IQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYN 399

Query: 446 SLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGV-D 504
           ++ V   F+ LAY+NVSSGSA+ F +F N+ +I G + WICI + Y+ F +A+  +G+ D
Sbjct: 400 AVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGLYD 459

Query: 505 RSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFG 564
           R  F   +PFQPYGTYF +     I     +  F+   +   +F+  YI LPVFV+ + G
Sbjct: 460 RVPF--KSPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLWVG 517

Query: 565 YKFIKKTK---IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFL 621
           +K   +T    ++   EVD+ TG       EIE ++  +   +R+  N       +EKF+
Sbjct: 518 HKIYTRTLSTWVIPVAEVDVTTG-----LAEIE-ELTKELDALRVPPNS-----AWEKFM 566

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  328 bits (840), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 176/494 (35%), Positives = 274/494 (55%), Gaps = 9/494 (1%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           +   LKK L  RH+ +                      GPA +F+++  +  +V+  M  
Sbjct: 47  YEHNLKKGLSNRHIQLIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCT 106

Query: 155 IGEMASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           + EM  Y+P  G      +RYVDP+LGFA G+ Y + Y +L   +LTAA+ +++YW D+ 
Sbjct: 107 LAEMVCYLPQQGSVPELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQ- 165

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            V  GVWITIFL+V+V++N + V+F+GE EFW +S K                   P+HD
Sbjct: 166 -VPQGVWITIFLIVVVVLNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHD 224

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAAEAYNPRK 332
           R+GFRYW++PGAF  +     G++G+F+   +  + + FA+ L  EL G+   EA + R+
Sbjct: 225 RVGFRYWRNPGAFGYHITG--GNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRR 282

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXX-XXXXPFVVAIQNSGI 391
           ++ +A +  ++RI+ FYL +  ++G+ VA ND  LL             PFV  I NSGI
Sbjct: 283 NIEKASRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGI 342

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
            VL H+ N  +L   +SA NS  Y  SRS+ +L+  G AP IF +   +G+P+ ++ +C 
Sbjct: 343 PVLNHVINVAILTSAWSAGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCS 402

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           L A LAY+NVSS S++VF +  N+ +I G + W  I + YI F +A+    +   +  Y 
Sbjct: 403 LVACLAYLNVSSTSSKVFQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRL-LDRIPYR 461

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT 571
           +P QP+  YF       I     + VF+   +DYK+F+T YI LP+F+ FY G+K I KT
Sbjct: 462 SPLQPFSAYFFTIVVAIITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKT 521

Query: 572 K-IVKSHEVDLFTG 584
           +  +   ++D+ TG
Sbjct: 522 RFCIPVDQIDVITG 535

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  327 bits (838), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 179/510 (35%), Positives = 289/510 (56%), Gaps = 15/510 (2%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           +H D +K++L+ RH+ M                     AGP    +AY F+G +VF    
Sbjct: 62  EHHD-VKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQ 120

Query: 154 AIGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
           ++GEMA++IP+   F+ +A R++ PALG A GY Y   +      +L+    +IQ+W  +
Sbjct: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
             V    WI+IF V++   N+  VKF+GEFEFW++S K                      
Sbjct: 181 --VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAG-KT 237

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
             +GFRYW++PGA  P   + +    +F+ +VS  + A F Y G EL GI A EA NPRK
Sbjct: 238 GPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 297

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           +VPRA++  + RI++FY+ ++F +G+ V YNDP+L             PF++ IQN+G R
Sbjct: 298 AVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKL---TSTDSYVSSSPFIITIQNAGTR 354

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
           VLPHIFNA +L  + SA NS++YVGSR L+S+A +G AP    +TT  G+P+ S+     
Sbjct: 355 VLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISA 414

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
           F  L+YM +S+G A+ FN+ +N+  + G  +W+ I  +++ FM+A+K +G+ R    Y A
Sbjct: 415 FGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKA 474

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK 572
            + P+  Y+++ + V I  I+ FT F  H F  ++F+  YI + +F++F+  ++   + +
Sbjct: 475 LWMPWLAYYAIFFMVVIILIQGFTSFAPH-FSGRDFVAAYISVGLFLVFWGFFQIYFRCR 533

Query: 573 IV-KSHEVDLFTGKEVFDQQEIEGKILDQE 601
           I+ K  +VD+ T     D++EIE  + + +
Sbjct: 534 IIWKLEDVDIDT-----DRREIESVVWEDD 558

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  325 bits (834), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/518 (35%), Positives = 287/518 (55%), Gaps = 20/518 (3%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
               G+++ L+ RHVSM                     AGP    I+Y F+G L FF   
Sbjct: 44  SQERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQ 103

Query: 154 AIGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
           ++GEMA++IP+   FT +  R++ PALG A GY Y F + I    +L+    +IQYW   
Sbjct: 104 SLGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTL- 162

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
             V    WI IF V I + N+  VKF+GEF+FW++  K                      
Sbjct: 163 -GVPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAG-KT 220

Query: 273 DRLGFRYWQHPGAFKPYSDAI---DGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYN 329
             +GFRYW++PG   P+ D I     S G+F+ +VS  V A F Y G EL G+ A E+ N
Sbjct: 221 GPVGFRYWRNPG---PWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESAN 277

Query: 330 PRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNS 389
           PRK+VP+A++    RI++FY+ ++F +G+ V +NDP+L             PF++AIQNS
Sbjct: 278 PRKTVPKAIRKVFLRILLFYVGSLFFIGLLVPFNDPKL---DSTANYSASSPFIIAIQNS 334

Query: 390 GIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGV 449
           G R LP IFNA +L  + SA NS++YVGSR LY LA +G AP I  R    G+P+  +G+
Sbjct: 335 GTRALPDIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGI 394

Query: 450 CVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFA 509
             LF  L Y++VSSGSA+ F++ +N+ +I G  +W+ I + +I FM+A+K QG+ R    
Sbjct: 395 VSLFGFLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLP 454

Query: 510 YSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIK 569
           + A   P+G Y++  + + I  I+ FT F    F+  NF   Y+ + +F+  +  ++ I 
Sbjct: 455 FKAKLMPWGAYYAAFFILLIIIIQGFTAF-APKFNVSNFFAAYVSVFLFIAVWVIFQVIF 513

Query: 570 KTKIV-KSHEVDLFTGKEVFDQQEIEGKILDQEKQIRL 606
           K++++ K  +VD+ +     D++EIE ++ + ++   L
Sbjct: 514 KSRLIHKVEDVDIDS-----DRREIEAEVWEDDEPTNL 546

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  327 bits (837), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/513 (36%), Positives = 282/513 (54%), Gaps = 15/513 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+ M                     AGP    I+Y F+G +V+F   ++GEM
Sbjct: 107 VKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQSLGEM 166

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+    T ++ R++ PA G A GY Y F + I    +++    VIQYW D+  V  
Sbjct: 167 ATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDK--VPL 224

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
            VWI IF V+I ++N   VK +GEFEFW++S K                        +GF
Sbjct: 225 AVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-HQGPIGF 283

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PGA+ P   + D + G+F+ +VS  + A F Y G EL GI A EA NPRK+VPRA
Sbjct: 284 RYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 343

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +   V+RIV+FY++++F +G+ V YN+PRL             PFV++IQN+G   LP I
Sbjct: 344 INKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASS---PFVISIQNAGTYALPDI 400

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA VLI V SA NS++YVGSR LYSLA  G AP  F   T  G+P+  +       LLA
Sbjct: 401 FNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLA 460

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++ V++ +   FN+ +N+ ++ GL +W+ I + +I FM+A++ +G+ R    + A   PY
Sbjct: 461 FLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPY 520

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KS 576
           G Y++  +   I FI+ F  F    F   +F T YI L +  + + G +   K + + K 
Sbjct: 521 GAYYAAFFVTVIIFIQGFQAFC--PFKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKL 578

Query: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609
            ++D+ T     D++EIE  I + ++   L E 
Sbjct: 579 EDIDIDT-----DRREIEAIIWEDDEPKNLWEK 606

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  324 bits (830), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/515 (34%), Positives = 282/515 (54%), Gaps = 19/515 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L++ L ARH+ +                      GPA +FI+Y  +  +++  M A GEM
Sbjct: 56  LQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAFGEM 115

Query: 159 ASYIPMDGFTSYAS------RYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
             Y+P +G  S  S      RYVDP+L FA G+ Y + Y+IL   + TAAS V++YW D 
Sbjct: 116 VCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYWTD- 174

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
             V    WITIFL ++V++N+  VK++GE EFW +S K                   P+H
Sbjct: 175 -AVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPNH 233

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAAEAYNPR 331
           DRLGFRYW++PG F  +     G++G F+   S  +   FA+ LG EL  + ++E  + R
Sbjct: 234 DRLGFRYWKNPGGFAHHITG--GNLGNFLDVYSGIIKGAFAFILGPELIALASSECKDQR 291

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPFVVAIQNSG 390
           +++ +A K  VWR++ FY++    + + VA NDP L              PFV+ IQN+G
Sbjct: 292 RNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNAG 351

Query: 391 IRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVC 450
           I++LPHI NAC+L   +SA N+ ++  SRSL ++A +G+AP IF +   +G+P  ++   
Sbjct: 352 IKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTFS 411

Query: 451 VLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAY 510
            L + LAY+NVSS +A VF +F N+ +I G + W C  + Y+ F +A+K  G++ ++  Y
Sbjct: 412 ALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYNGLE-NRLPY 470

Query: 511 SAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIK- 569
           +  FQ Y  ++S+     + F   + VF+   ++  +FI  YI LP+FV+ + G+K    
Sbjct: 471 APRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYTR 530

Query: 570 --KTKIVKSHEVDLFTGKEVFDQQEIEGKILDQEK 602
             K       E+D+ TG     + E   +ILD+E+
Sbjct: 531 DFKKWWYPVEEIDVVTG---LTEIEERTRILDEER 562

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  322 bits (825), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/494 (37%), Positives = 262/494 (53%), Gaps = 9/494 (1%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           +    L + L+ R VS+                      GP S+FIAY F G L+   + 
Sbjct: 27  EKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIF 86

Query: 154 AIGEMASYIPMD-GFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
           ++ EMAS+ PMD GF+ Y +RYVDPA GFA G+ Y  KY I+    LTA  LVI YW  R
Sbjct: 87  SLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--R 144

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
             VN GVW+T+  V +  +N   VK+FGE E  L+ FK                   P+H
Sbjct: 145 PDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNH 204

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
              GFRYW+  GA  PY   + G  GKF+ + +  V ++F ++G E+ GIV  E  NP+K
Sbjct: 205 TTTGFRYWRESGAL-PY--LVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKK 261

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           ++P++     +RI   Y+  +F+LG+ ++  + +L+            PFV+AI +SGI+
Sbjct: 262 TIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANAS--PFVIAISSSGIK 319

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
           VLP+  NA +L+F+ S+ N+D+Y+ SR LY LA DG AP IF     + +P        L
Sbjct: 320 VLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSL 379

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
              LAYMN    +A VF+Y  + VS+FG+L+W  I I YI + RA+K +G+      +  
Sbjct: 380 LGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRM 439

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK 572
            FQPY  Y +L +   I F   +  F+   F YK FIT YIG+   ++   GYK   KTK
Sbjct: 440 WFQPYAAYVTLFFVTIITFFNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKTK 498

Query: 573 IVKSHEVDLFTGKE 586
            VK  E+   T  E
Sbjct: 499 FVKPSEISFRTRNE 512

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  325 bits (832), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/512 (36%), Positives = 279/512 (54%), Gaps = 15/512 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+ M                     AGP    IAY F+G +V+F   ++GEM
Sbjct: 106 VKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEM 165

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+    T ++ R++ PA G + GY Y F + I    +++    VI+YW D+  V  
Sbjct: 166 ATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDK--VPL 223

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI IF V+I ++N   VK +GEFEFW++S K                        +GF
Sbjct: 224 AAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGS-HQGPIGF 282

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PGA+ P   + D S G+F+ +VS  + A F Y G EL GI A EA NPRK+VPRA
Sbjct: 283 RYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 342

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +   V+RIV+FY++++F +G+ V YND RL             PFV++IQN+G   LP I
Sbjct: 343 INKVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSAVIASS---PFVISIQNAGTYALPDI 399

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA VLI V SA NS++YVGSR LYSLA  G AP  F   T  G+P+  +       LLA
Sbjct: 400 FNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLA 459

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++ V++ +   FN+ +N+ ++ GL +W+ I + +I FM+A+K +G+ R    + A   PY
Sbjct: 460 FLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLMPY 519

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KS 576
           G Y++  +   I FI+ F  F    F    F T YI L +  + + G +   K + + K 
Sbjct: 520 GAYYAAFFVTVIIFIQGFQAFC--PFKVSEFFTSYISLILLAVVFIGCQIYYKCRFIWKL 577

Query: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRLRE 608
            ++D+ +     D++EIE  I + ++   L E
Sbjct: 578 EDIDIDS-----DRREIEAIIWEDDEPKNLWE 604

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  324 bits (830), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/510 (34%), Positives = 281/510 (55%), Gaps = 14/510 (2%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           H   +K+ L+ RH+ M                     +GP    IAY F+G +++F   +
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VI+YW D+ 
Sbjct: 149 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDK- 207

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            V    WI IF V+I ++N   VK +GE EFW++ F                        
Sbjct: 208 -VPLAAWIAIFWVLITLLNFFPVKVYGEIEFWIA-FIKVLAIMGYLLYALIIVCGGSSQG 265

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +GFRYW++PG + P   + D + G+F+ +VS  + A F Y G EL GI A EA NPRK+
Sbjct: 266 PIGFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 325

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           VPRA+   V+RI +FY++++F +GM V YND RL             PFV++IQN+G +V
Sbjct: 326 VPRAINKVVFRIALFYIMSLFFIGMLVPYNDERL---ASTSAVIASSPFVISIQNAGTKV 382

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP IFNA V+I + SA NS++YVGSR LY+LA+ G AP  F   T +G+P+  + V    
Sbjct: 383 LPDIFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSAL 442

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LLA++ V++ +   FN+ +N+ ++ GL +W+ I I++I FM+A+K +G+ R    + A 
Sbjct: 443 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAK 502

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKI 573
             P+G Y++  +   I FI+ F  F  H +D   F T YI L +  + + G +   + + 
Sbjct: 503 LMPFGAYYATFFVTVIIFIQGFQAFSPH-WDTTAFFTSYISLIILAVLFIGCQIFYRCRF 561

Query: 574 V-KSHEVDLFTGKEVFDQQEIEGKILDQEK 602
             +  ++D+ +     D++EIE  I + ++
Sbjct: 562 FWRVEDIDIDS-----DRREIEAVIWEDDE 586

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  323 bits (829), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/619 (31%), Positives = 321/619 (51%), Gaps = 59/619 (9%)

Query: 1   MAESIQSTDISHTRIEIDNIAVQQKGLDSSQD----GGIKFVDQTNYNIY------GNLD 50
           M +  Q+T+I    +  + +      +++SQ     G +   D+ N  +Y        +D
Sbjct: 1   MTDPKQNTEIEEKHMYNEPVTTLFHDVEASQTHRRRGSLPLKDEKNKELYPLHSFSTRVD 60

Query: 51  -----NMGDYSKDYYEKSQYQQQNLDIEXXXXXXXXXXXXXXXXXXXPKHTDGLKKNLQA 105
                +MGD  +D   + Q + +N ++                           K+ L+ 
Sbjct: 61  GEDTFSMGDVIRD---EDQGEVRNAEV---------------------------KRELKQ 90

Query: 106 RHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMASYIPM- 164
           RH+ M                     AGP    I+Y F+G L +    ++GEMA++IP+ 
Sbjct: 91  RHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVT 150

Query: 165 DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGVWITIF 224
             FT ++ R++ PA G A GY Y F + I    +L+    VI++W ++  V    WI+IF
Sbjct: 151 SSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTNK--VPLAAWISIF 208

Query: 225 LVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYWQHPG 284
            V+I I+N+  VK++GEFEFW++S K                        +GFRYW++PG
Sbjct: 209 WVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPG 267

Query: 285 AFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWR 344
           A+ P   + D + G+F+ +VS  + A F + G EL GI A EA NPRK+VPRA+K  V+R
Sbjct: 268 AWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFR 327

Query: 345 IVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIFNACVLI 404
           I+ FY+ ++  +G+ V YNDP+L             PF++AI+NSG +VLPHIFNA +L 
Sbjct: 328 ILTFYIGSLLFIGLLVPYNDPKL---TTATSYVSVSPFIIAIENSGTKVLPHIFNAVILT 384

Query: 405 FVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSG 464
            + SA NS++YVGSR L+ L+ +  AP    RTT  G+P+ ++ +  +F  LAYM  S+G
Sbjct: 385 TIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGALAYMETSTG 444

Query: 465 SAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLA 524
             +VF + +N+  + G  +W+ I I++I FM+A+K +G+ R +  + A   P   YF+  
Sbjct: 445 GDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMPGLAYFAAT 504

Query: 525 WCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KSHEVDLFT 583
           + + I  I+ FT F    FD  +F+  YI + +F+  +  ++ I + + + K  +VD+ +
Sbjct: 505 FMIIIILIQGFTAF-APKFDGIDFLAAYISIFLFLAIWILFEIIFRCRFIWKIEDVDIDS 563

Query: 584 GKEVFDQQEIEGKILDQEK 602
                D+++IE  + +  +
Sbjct: 564 -----DRRDIEAIVWEDHE 577

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  325 bits (832), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/515 (35%), Positives = 281/515 (54%), Gaps = 21/515 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK LQ+RH+ +                      GPA +  +Y  + ++++  M ++GEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 159 ASYIPMDGFTSYAS------RYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
             ++P     S  S      RY DP+LGFA G+ Y + Y+IL   + TAAS V+ YW   
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTT- 223

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
             V  G WI IFL V+ ++N + VK +GE EFW +  K                   P H
Sbjct: 224 -AVPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTH 282

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAAEAYNPR 331
           DRLGFRYWQHPGAF  +     G+ G+F+   +  +   FA+ LG EL  I ++EA + R
Sbjct: 283 DRLGFRYWQHPGAFAYH--ITTGNTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDAR 340

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSG 390
           +++ +A +   +R+V FY+ +   +G+ V+  DP L              PFV+AIQN+ 
Sbjct: 341 RNIEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAH 400

Query: 391 IRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVC 450
           I+VLPHI NAC+L   +S+ NS ++  SRSL S+A DG AP I  R    G+P+Y++ + 
Sbjct: 401 IKVLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALS 460

Query: 451 VLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAY 510
             F+ LA++NVSSGSA+ F +F N+ +I G + WICI + Y+ F +AV  +G+   +  +
Sbjct: 461 AAFSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPF 519

Query: 511 SAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKK 570
            +P QPYGTYF +     I     +  F+  +++  +F+  YI LP+FV+ + G+K   +
Sbjct: 520 KSPLQPYGTYFFIVVVSLICLTNGYASFV--NWNASDFVAAYITLPIFVVLWVGHKIYTR 577

Query: 571 ---TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEK 602
              T ++   EVD+ TG     + E E KILD ++
Sbjct: 578 TWSTWLLPVAEVDVTTG---LAEIEEETKILDAQR 609

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  323 bits (827), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/494 (36%), Positives = 271/494 (54%), Gaps = 9/494 (1%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           H   +K+ L+ RH+ M                     AGP    IAY F+G +V+F   +
Sbjct: 63  HDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQS 122

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VIQ+W    
Sbjct: 123 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFW--TS 180

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            V    WI IF V + ++N   VK +GE EFW++S K                       
Sbjct: 181 AVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGS-SQG 239

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +GFRYW++PG + P   + D + G+F+ +VS  + A F Y G EL GI A EA NPRKS
Sbjct: 240 PIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 299

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           VPRA+   V+RIVIFY++++F +GM V +NDPRL             PFV++IQN+G RV
Sbjct: 300 VPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRL---ASNVAVIASSPFVISIQNAGTRV 356

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LPHIFNA V++ + SA NS++YVGSR LY+L+  G AP  F   T  G+P+  +    L 
Sbjct: 357 LPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLL 416

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LLA++ V++ +   FN+ +N+ ++ GL +W+ I +++I FM+A+K +G+ R    + A 
Sbjct: 417 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAK 476

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKI 573
             P+G Y++  +   I FI+ F  F    FD   F T YI L + V+   G +   + + 
Sbjct: 477 LMPWGAYYAAFFVTVIIFIQGFEAF-SPKFDVSGFFTAYISLIILVVLLIGCQLYYRCRF 535

Query: 574 V-KSHEVDLFTGKE 586
           + K  ++D+ T + 
Sbjct: 536 LWKLEDIDIDTDRR 549

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  323 bits (828), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/521 (34%), Positives = 280/521 (53%), Gaps = 17/521 (3%)

Query: 93  PKHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTM 152
           P+    LK+ L++RHV +                      GPA +F +Y  +   ++  M
Sbjct: 64  PEENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIM 123

Query: 153 AAIGEMASYIPMDGFTSYAS------RYVDPALGFAVGYCYLFKYLILCPNQLTAASLVI 206
            A GEM  Y+P +G  S  S      +YVD +LGFA  + Y + ++IL   + TAA+ V+
Sbjct: 124 NAFGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGVV 183

Query: 207 QYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 266
           +YW     V  G WITIFL  +V +N+  V F+GE EFW +S K                
Sbjct: 184 EYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSFILFW 243

Query: 267 XXXPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAA 325
              P HDRLGFRYWQ PGAF  +    DG+ G F+   +  +   FA+ LG EL  + ++
Sbjct: 244 GGGPSHDRLGFRYWQRPGAFADH--ITDGTGGNFLDVYTGVIKGGFAFVLGPELVSLTSS 301

Query: 326 EAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVV 384
           E ++ R+++ +A +  VWR++IFY++    + + VAYNDP L              PFV+
Sbjct: 302 ECHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVI 361

Query: 385 AIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPH 444
            IQN+GI+VLPHI N C++   +SA N+ ++  SRSL ++A  G AP  F +   +G+P+
Sbjct: 362 GIQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPY 421

Query: 445 YSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVD 504
            ++G   LF  LAY+NVSS +A VFN+F N+ +I G + WIC  + YI F +A+    + 
Sbjct: 422 VAVGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDL- 480

Query: 505 RSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFG 564
             +  Y    Q Y  ++SL     I     + +F+   +DYK+FI  YI LPVF++ + G
Sbjct: 481 YDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWIG 540

Query: 565 YKFIKKT---KIVKSHEVDLFTGKEVFDQQEIEGKILDQEK 602
           +K + ++     +   ++D+FTG E  ++   E   LD+++
Sbjct: 541 HKLVTRSWRQWYIPVDKIDVFTGLEEIEELTNE---LDEKR 578

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  323 bits (829), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/512 (35%), Positives = 282/512 (55%), Gaps = 15/512 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +++ L+ RH+ M                     AGP    IAY F+G +V+F   ++GEM
Sbjct: 106 VRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQSLGEM 165

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+    T ++ R++ PA G + GY Y F + I    +++    VI+YW  +  V  
Sbjct: 166 ATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTK--VPL 223

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           GVWI IF V+I ++N   VK +GEFEFW++S K                        +GF
Sbjct: 224 GVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-KQGPIGF 282

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PGA+ P   + D + G+F+ +VS  + A F Y G EL GI A EA NPRK+VPRA
Sbjct: 283 RYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 342

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +   V+RIV+FY++++F +G+ V Y DPRL             PFV++IQN+G   LP I
Sbjct: 343 INKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASS---PFVISIQNAGTYALPDI 399

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA VLI V SA NS++YVGSR LYSLA  G AP  F   T  G+P+  +       LLA
Sbjct: 400 FNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLA 459

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++ V++ +   FN+ +N+ ++ GL +W+ I +++I FM+A+  +G+ R    + A F PY
Sbjct: 460 FLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPY 519

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KS 576
           G Y++  +   I FI+ F  F    F   +F T YI L +  + + G +   K + + K 
Sbjct: 520 GAYYASFFVTVIIFIQGFQSFC--PFRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKL 577

Query: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRLRE 608
            ++D+ +     D++EIE  I + ++   L E
Sbjct: 578 EDIDIDS-----DRREIEAIIWEDDEPKNLWE 604

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  322 bits (824), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/516 (34%), Positives = 282/516 (54%), Gaps = 14/516 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+SM                     AGP    IAY F+G L +    ++GEM
Sbjct: 42  VKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEM 101

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+   F  +  R++ PALG A GY Y   + I    +L+    VIQ+W   D V  
Sbjct: 102 ATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFW--TDAVPL 159

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI I  VV+V  N+A VKF+GE EFW++  K                        +GF
Sbjct: 160 TAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPVGF 218

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PG + P   + D + G+F+ +VS  + A F Y G EL GI A EA NPRK+VPRA
Sbjct: 219 RYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRA 278

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +    +RI+ FY++++  +G+ V +NDP+L             PFV+AI+NSG +VLPHI
Sbjct: 279 INKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENSGTKVLPHI 335

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA +L  + SA NSD+Y+ SR LYS+ ++G AP     TT  G+P+ ++    L   LA
Sbjct: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           Y+  S G++ VF++ +N+ ++ G  +W+ I + +I FM+A+K QG+ R    + A F P+
Sbjct: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYK-FIKKTKIVKS 576
           G Y++  +   I  I+ FT F    F+  +F T Y+ + +F   + G++ + +     K+
Sbjct: 456 GAYYAAFFIGVIIIIQGFTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKT 514

Query: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFS 612
            ++DL T     D++EI+  + ++++   L E  +S
Sbjct: 515 EDIDLDT-----DRREIDNDVWEEDEPKNLWEKFWS 545

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  322 bits (826), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/517 (35%), Positives = 281/517 (54%), Gaps = 14/517 (2%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           H   +K+ L+ RH+ M                     +GP    IAY F+G +++F   +
Sbjct: 87  HDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQS 146

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VIQYW  + 
Sbjct: 147 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK- 205

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            V    WI IF V+I ++N   VK +GEFEFW++S K                       
Sbjct: 206 -VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGS-HQG 263

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +GFRYW++PGA      + D    +F+ +VS  + A F Y G EL GI A EA NPRKS
Sbjct: 264 PIGFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 323

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           VPRA+   V+RIV+FY++++F +G+ V YNDPRL             PFV++IQN+G +V
Sbjct: 324 VPRAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASS---PFVISIQNAGTKV 380

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP IFNA VL+ V SA NS++YVGSR LY+LA  G AP  F   T  G+P+  +    L 
Sbjct: 381 LPDIFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALL 440

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LLA++ V+  +   FN+ +N+ ++ GL +W+ I + +I FM+A+K +G+ R    + A 
Sbjct: 441 GLLAFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAK 500

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKI 573
           F P+G Y++  +   I FI+ F  F    FD   F T YI L + V+ + G +   + + 
Sbjct: 501 FMPWGAYYASFFVTVIIFIQGFQAF-APKFDVSEFFTAYISLILLVVLFAGCQLYYRCRF 559

Query: 574 V-KSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609
           + K  ++D+ +     D++EI+  + + ++   L E 
Sbjct: 560 LWKLEDIDIDS-----DRREIDAIVWEDDEPQNLWEK 591

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  322 bits (825), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/517 (35%), Positives = 283/517 (54%), Gaps = 14/517 (2%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           H   +K+ L+ RH+ M                     AGP    IAY F+  LV+  + +
Sbjct: 73  HEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYSVVQS 132

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GEMA++IP+   FT ++SR++ PA G A GY Y F + I    +L+    +I++W    
Sbjct: 133 LGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW--TT 190

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            V    WITIF V++ + N+  VK++GEFEFW++  K                       
Sbjct: 191 AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGP 250

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +GFRYW++PGA+ P   + D + G+F+ +VS  + A F Y G EL GI A EA NPRKS
Sbjct: 251 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           VPRA+K  V+RI++FY      +G+ V YNDP+L             PF++AI+NSG +V
Sbjct: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFIIAIENSGTKV 366

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LPHIFNA VL  + SA NS++YVGSR +Y LA    AP+ F RT + G+P++++     F
Sbjct: 367 LPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAF 426

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
             LAYM +S+G A  FN+ +N+  + G  +W+ I   +I FM+A+K +G+ R    + A 
Sbjct: 427 GALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAK 486

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKI 573
           F P+  Y++L + V I  I+ FT F   +F   +F   Y+ + +F+  + G +   + +I
Sbjct: 487 FMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRI 545

Query: 574 V-KSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609
             +  EVD+ T     D+++IE  + D E    L + 
Sbjct: 546 FHRLDEVDIDT-----DRRDIEAVVWDDEPPKTLWDK 577

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  322 bits (826), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/515 (34%), Positives = 287/515 (55%), Gaps = 15/515 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+ M                     +GP    IAY F+G +V+F   A+GEM
Sbjct: 102 VKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQALGEM 161

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+    T ++SR++ PA G + GY Y F + I    +++    VI++W  +  V  
Sbjct: 162 ATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTK--VPL 219

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI+IF V++  +N   V  +GE EFW++S K                        +GF
Sbjct: 220 AAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGS-KQGPIGF 278

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW+H  A      + D +  +F+ +V+  + A F Y G EL GI A EA NPRKSVPRA
Sbjct: 279 RYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSVPRA 338

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +   V+RIVIFY++++F +G+ V YNDP+L             PFV++I+N+G R LPHI
Sbjct: 339 INKVVFRIVIFYILSLFFIGLLVPYNDPKL---NSATSYIASSPFVISIENAGTRALPHI 395

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA ++I + SA NS++YV SR LYSLA+ G AP IF R T  G+P   + V  L  LLA
Sbjct: 396 FNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLLA 455

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++ V++ + + FN+ +N+ ++ GL +W+ I ++++ FM A+K +G+ R    + A F PY
Sbjct: 456 FLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPY 515

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KS 576
           G+Y++  +   I FI+ FT F    FD  +F T YI L +  + + G +   + +   K 
Sbjct: 516 GSYYACFFITVIIFIQGFTAF-SPKFDVASFFTAYISLILLAVLFIGCQLYYRCRFFWKV 574

Query: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
            ++D+ T     D++EI+ +I+ ++ + +   +KF
Sbjct: 575 EDIDIDT-----DRREID-EIVWEDDEPKTAWDKF 603

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  322 bits (826), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/512 (35%), Positives = 279/512 (54%), Gaps = 15/512 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+ M                     AGP    IAY F+G +++F   ++GEM
Sbjct: 106 VKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGEM 165

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+    T ++ R++ PA G + GY Y F + I    +++    VIQYW D+  V  
Sbjct: 166 ATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDK--VPL 223

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI IF V+I ++N   VK +GEFEFW++S K                        +GF
Sbjct: 224 AAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGS-HQGPIGF 282

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PGA+ P   + + S G+F+ +VS  + A F Y G EL GI A EA NPRK+VPRA
Sbjct: 283 RYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 342

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +   V+RIVIFY++++F +G+ V YN+PRL             PFV++IQN+G   LP I
Sbjct: 343 INKVVFRIVIFYIMSLFFIGLLVPYNEPRL---SPSSAVIASSPFVISIQNAGTYALPDI 399

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA VLI V SA NS++YVGSR LYSLA  G AP  F   T  G+P+  +       LLA
Sbjct: 400 FNAVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLA 459

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++ V++ +   FN+ +++ ++ GL +W+ I + +I FM+A+K +G+ R    + A   PY
Sbjct: 460 FLVVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPY 519

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KS 576
           G Y++  +   I FI+ F  F    F    F T YI L +  + +   +   K + + K 
Sbjct: 520 GAYYASFFVTIIIFIQGFQAFC--PFSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKL 577

Query: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRLRE 608
            ++D+ +     D++EIE  I + ++   L E
Sbjct: 578 EDIDIDS-----DRREIEAIIWEDDEPKNLWE 604

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  322 bits (824), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 187/541 (34%), Positives = 291/541 (53%), Gaps = 30/541 (5%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           +T+ LK+ L++RHV +                      GPA +FIAY  +  +++  M A
Sbjct: 71  YTNTLKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNA 130

Query: 155 IGEMASYIPMDGFTSYAS------RYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQY 208
           +GEM  Y+P DG  S  S      RYVD +L FA G+ Y + Y+IL   + TAA+ V++Y
Sbjct: 131 VGEMVCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVVEY 190

Query: 209 WIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 268
           W     V    WITIFL +I ++N++ VK+FGE EFW +S K                  
Sbjct: 191 W--TLAVPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFWGG 248

Query: 269 XPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAAEA 327
            P HDRLGFRYW++PGAF  +    DGS+G F+   S  +   FA+ LG EL  + ++E 
Sbjct: 249 GPSHDRLGFRYWKNPGAFAHH--VTDGSLGNFLDIYSGIIKGAFAFILGPELVALTSSEC 306

Query: 328 YNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPFVVAI 386
            + R+++ +A K  ++R++ FY++    +G+ VA+NDP L              PFV+ I
Sbjct: 307 SDQRRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGI 366

Query: 387 QNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYS 446
           QN+GI VLPHI NAC+L   +S+ N+ ++  SRSL+++A +G AP IF R   +G+P+ +
Sbjct: 367 QNAGIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMA 426

Query: 447 LGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGV-DR 505
           + +  L + LAY+N SS +A+VF +  N+ +I G L WIC  I Y+ F +A+    + DR
Sbjct: 427 VILSTLISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAIFYNNLYDR 486

Query: 506 SKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGY 565
             F      QPY   +SL     I     +  F+   ++  +FI  YI LP+F+  Y G+
Sbjct: 487 MPFKTWG--QPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGH 544

Query: 566 K----FIKKTKIVK----SHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFS--LEW 615
           K    F     ++K      ++D+ TG +     EIE K  + ++   L  N++   ++W
Sbjct: 545 KVYNHFKNDYPLMKLAYSVEDIDVITGLD-----EIETKTCELDENRILPTNRWERFIDW 599

Query: 616 I 616
           +
Sbjct: 600 L 600

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  321 bits (823), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 178/512 (34%), Positives = 279/512 (54%), Gaps = 14/512 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+ M                     AGP    IAY F+G +V+F   ++GEM
Sbjct: 104 VKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYFVTQSLGEM 163

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+    T ++ R++ PA G A GY Y F + I    +++    VIQYW     V  
Sbjct: 164 ATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTK--AVPL 221

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI IF V++ ++N   VK +GEFEFW++S K                        +GF
Sbjct: 222 AAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGS-HQGPIGF 280

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PG + P   +      +F+ +VS  + A F Y G EL GI A EA NPRKSVPRA
Sbjct: 281 RYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 340

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +   V+RI +FY++++F +G+ V +ND RL             PFV++IQN+G R LP I
Sbjct: 341 INKVVFRIALFYIMSLFFIGLLVPFNDDRL---ANDSAVIASSPFVISIQNAGTRALPDI 397

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA VL+ + SA NS++YVGSR LY+LA+ G AP IF   T +G+P+  +       LLA
Sbjct: 398 FNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVICTAALGLLA 457

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++ V++ +   FN+ +N+ ++ GL +W+ I +++I FM+A+K +G+ R    + A   P+
Sbjct: 458 FLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKAKLMPW 517

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KS 576
           G Y++  +   I FI+ F  F    FD   F T YI L +  + + G +   + + + K 
Sbjct: 518 GAYYASFFVTVIIFIQGFQAFT-PKFDVSTFFTSYISLILLAVLFSGCQLYYRCRFIWKV 576

Query: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRLRE 608
            ++D+ +     D++EIE  I ++++   L E
Sbjct: 577 EDIDIDS-----DRREIEAIIWEEDEPKNLWE 603

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  319 bits (818), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 180/503 (35%), Positives = 282/503 (56%), Gaps = 15/503 (2%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           KH   +K+ L+ RH++M                     AGP    IAY FVG ++F    
Sbjct: 89  KHRS-VKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVTQ 147

Query: 154 AIGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
           ++GEM ++IP+   FT ++ R++ PA G A GY Y F + +    +L+    VIQ+W   
Sbjct: 148 SLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFW--T 205

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
             V    WI IF  ++ + N+  VK++GE EFW++  K                   P H
Sbjct: 206 TAVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGP-H 264

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
              GFRYW+ PGA+ P   A D S  +F+ +VS  + A F Y G EL GI A EA NPRK
Sbjct: 265 GPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 324

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           +VP+A+K  + RI+ FY+ ++F +GM V +NDP+L             PF++AIQNSG+ 
Sbjct: 325 AVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKL---TSATSFVSSSPFIIAIQNSGVS 381

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
           +LP IFN  +LI + SA NS++YVGSR L+ LA    AP  F RTT  G+P  ++    L
Sbjct: 382 LLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSL 441

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
           F  LA++ +++   +VFN+ +++V+I G  +W+ I +++I FM+A++ +G+ R+   + A
Sbjct: 442 FGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKA 501

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK 572
            F P+  Y++ A+ + I  I+ FT F    F+  +F+  YI L +FVI +  ++ +KK +
Sbjct: 502 IFMPWLAYYATAFIILIILIQGFTAF-APRFNVSDFVASYISLLLFVIIWGVFQAMKKCR 560

Query: 573 IV-KSHEVDLFTGKEVFDQQEIE 594
           I  K  ++DL +     D+++IE
Sbjct: 561 IFWKVEDIDLDS-----DRKDIE 578

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  318 bits (815), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 172/514 (33%), Positives = 288/514 (56%), Gaps = 15/514 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K++L+ RH+SM                     AGP    +AY F+G + F    ++GEM
Sbjct: 62  VKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEM 121

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+   FT Y  R++ PALG A GY Y F + +    +L+    +IQYW     V  
Sbjct: 122 ATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF--AVPL 179

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
            VWI +F +++   N+  V+F+GE EFW+++ K                    +   LGF
Sbjct: 180 SVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSE-GALGF 238

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PG +     + +    +F+ +VS  + A F Y G EL GI A E+ NPRK+VP+A
Sbjct: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +    +RI+ FY++++F +G+ V Y DPRL             PFV+AIQNSG +VLP +
Sbjct: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRL--STTSDSDINTSPFVMAIQNSGTKVLPSV 356

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FN  +L+ + SA NS++Y+GSR LY L+  G AP++FK+T   G+P Y++    +F  LA
Sbjct: 357 FNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLA 416

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           Y+N+S  + +VF++ + + ++ G  +W+ I +++I FM+ +K +G+ R+   + A F P+
Sbjct: 417 YLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPW 476

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK-IVKS 576
           G Y++  +   I  I+ F  F    F +  FI  YI + +F++ + G++ + KT+ I++ 
Sbjct: 477 GAYYAAFFITVIILIQGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRK 535

Query: 577 HEVDLFTGKEVFDQQEIEGKIL--DQEKQIRLRE 608
            +VD+ T     D++EI+  +   D E +  L++
Sbjct: 536 EDVDIDT-----DRREIDALVWSDDDEPKTLLQK 564

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  318 bits (814), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 172/519 (33%), Positives = 287/519 (55%), Gaps = 14/519 (2%)

Query: 93  PKHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTM 152
           P+    +++ L+ RH+ M                     AGP    I+Y F+G +++   
Sbjct: 60  PRSRGEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVT 119

Query: 153 AAIGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
            ++GEMA++IP+   F+ +A R++ PALG   GY Y   +      +L+    +IQYW  
Sbjct: 120 QSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTH 179

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
              V    WI IF  ++ ++N+  VK++GEFEF ++S K                     
Sbjct: 180 --AVPLAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQP 237

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +GFRYW++PGA+ P   + + + G+F+ +VS  + A F Y G EL GI A EA NPR
Sbjct: 238 DGPIGFRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 297

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           K+VPRA+K  V RI++FY++++F +G+ V YNDP+L             PF+++I+NSG 
Sbjct: 298 KAVPRAIKKVVIRILVFYILSLFFIGLLVPYNDPKL---DSDGTFVSASPFMISIENSGT 354

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           +VLP IFNA VLI +FSA NS++Y+GSR LYSL+ +  AP      T  G+P+ ++ +  
Sbjct: 355 KVLPDIFNAVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTS 414

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           LF  LA++  S+GS + FN+ +N+  + G  +W+ I  ++I FM+A+K +G+ R    Y 
Sbjct: 415 LFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYK 474

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT 571
           A   P+  Y++  +   I  I+ FT F   +F   +F+  YI + +F I +  ++   K 
Sbjct: 475 ARMMPFLAYYASFFIALIVLIQGFTAF-APTFQPVDFVAAYISVFLFAIIWLSFQLWFKC 533

Query: 572 KIV-KSHEVDLFTGKEVFDQQEIEGKI-LDQEKQIRLRE 608
           +++ K  ++D+ +     D++EIE ++ ++ E + R + 
Sbjct: 534 RLICKLQDIDIDS-----DRREIEEQVWIEPECKTRWQR 567

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  318 bits (815), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 185/527 (35%), Positives = 286/527 (54%), Gaps = 23/527 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L++ L++RH+ M                      GPA +FI+Y  +  +V+  M   GEM
Sbjct: 77  LQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCGFGEM 136

Query: 159 ASYIPMDGFTSYAS------RYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
             Y+P +G  +  S      RYVD +LGFA  + Y + Y+IL   + TAAS V++YW   
Sbjct: 137 VCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEYWTV- 195

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
             V  GVWI IFL ++VI+N   VK++GE EFW +S K                   P+H
Sbjct: 196 -AVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGPNH 254

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAAEAYNPR 331
           DRLGFRYWQ PGAF  +   + G  G+F+   S  +   FA+ LG EL  + +AE  + R
Sbjct: 255 DRLGFRYWQRPGAFTEH--IMKGGFGRFLDIYSGVIKGGFAFILGPELVCLTSAECEDQR 312

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPFVVAIQNSG 390
           +++ +A +  +WR++ FY++    + + VAYNDP L+             PFV+ IQN+G
Sbjct: 313 RNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNAG 372

Query: 391 IRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVC 450
           IRVLPHI NAC+L   +SA N+ ++  +RSL ++A +G AP +F +   +G+P+ ++ + 
Sbjct: 373 IRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISLS 432

Query: 451 VLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGV-DRSKFA 509
              + LA++NVSS +A VFN+F N+ +I G + WIC  + YI F +A+   G+ DR  F 
Sbjct: 433 GGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFFNGMYDRLPFK 492

Query: 510 YSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIK 569
                QPY  Y+SL     I     +  F+  ++   +F+  YI LP+FV+ + G+K   
Sbjct: 493 TWG--QPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLWT 550

Query: 570 KTKI----VKSHEVDLFTGKEVFDQQEIEGKILDQEK-QIRLRENKF 611
           +T       +  ++D+ TG  + D +E   KILD+ + +   R  KF
Sbjct: 551 RTFTKRWWRRVDQIDVTTG--LVDIEE-RTKILDETRVEPSTRWQKF 594

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  318 bits (815), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/510 (34%), Positives = 278/510 (54%), Gaps = 15/510 (2%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           H   +K+ L+ RH+ M                     AGP    IAY F+G +++F   +
Sbjct: 88  HETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYFVTQS 147

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VIQYW    
Sbjct: 148 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTK-- 205

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            V    WI IF V++ ++N   VK +GE EFW++ F                        
Sbjct: 206 AVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIA-FVKVLAIVGYLIYALVIVCGGSHQG 264

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +GFRYW+HPGAF P   + + + GKF+ +V+  + A F Y G EL GI A EA NPRK+
Sbjct: 265 PIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITAGEAANPRKT 324

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           VPRA+   V+RIV+FY++++F +GM + YND RL             PFV++I+N+  +V
Sbjct: 325 VPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRL---SAQDAVIASSPFVISIKNAHTKV 381

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP IFNA V++ V SA NS++YVGSR LY+LA+ G AP  F   T +G+P+  +      
Sbjct: 382 LPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTASL 441

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LLA++ V++ +   FN+ +N+ ++ GL +W+ I + +I FM+A+K +G+ R    + A 
Sbjct: 442 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAK 501

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK- 572
             P+G Y++  +   I FI+ +  F    +D   F T YI L +  +   G +   + + 
Sbjct: 502 LMPWGAYYAAFFVTVIIFIQGYQAFC--PWDVSTFFTSYISLILLAVLVVGCQLYYRGRF 559

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEK 602
           ++K  ++D+ T     D++EIE  + + ++
Sbjct: 560 LLKLEDIDIDT-----DRREIESIVWEDDE 584

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  318 bits (814), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/515 (34%), Positives = 279/515 (54%), Gaps = 25/515 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+ M                     AGP    IAY F+G +V+F   A+GEM
Sbjct: 84  VKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQALGEM 143

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+    T ++ R++ PA G A GY Y F + I    +++    VIQYW D   V  
Sbjct: 144 ATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYWTD--AVPL 201

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI IF V++ ++N   VK +GE EFW++  K                        +GF
Sbjct: 202 AAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPIGF 261

Query: 278 RYWQHPGAF--------KP-YSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAY 328
           RYW++PGA+        +P YS   +G   +F+ +V+  + A F Y G EL GI A EA 
Sbjct: 262 RYWRNPGAWGNGLTSDGEPIYSSKYEG---RFLGWVASLINAAFTYQGTELVGITAGEAA 318

Query: 329 NPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQN 388
           NPRK+VPRA+   V+RIV+FY++++F +G+ V + D RL             PFV++I+N
Sbjct: 319 NPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRL---SDDTTVIASSPFVISIEN 375

Query: 389 SGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLG 448
           +G ++LP IFNA V++ V SA NS++YVGSR LYSLA    AP IF R T  G+P   + 
Sbjct: 376 AGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGVI 435

Query: 449 VCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKF 508
              L  LLA++ V + +   FN+ V++ ++ GL +W+ I + ++ FM+ +K +G+ R   
Sbjct: 436 CTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDDL 495

Query: 509 AYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFI 568
            + A F P+G+Y++  W   I F++ F  F  H FD   F T YI L +  + + G +  
Sbjct: 496 PFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSPH-FDVTTFFTDYISLILLAVVFIGAQLY 554

Query: 569 KKTKIV-KSHEVDLFTGKEVFDQQEIEGKILDQEK 602
            + + + K  +VD+ +     D++EIE  I + ++
Sbjct: 555 YRCRFLWKLEDVDIDS-----DRREIEDAIWEDDE 584

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  313 bits (802), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 172/450 (38%), Positives = 254/450 (56%), Gaps = 9/450 (2%)

Query: 132 AGPASMFIAYSFVGILVFFTMAAIGEMASYIPMD-GFTSYASRYVDPALGFAVGYCYLFK 190
            GP S+F+AY F G ++   + ++ EMA++ PMD GF+ Y ++YVDPA GFA G+ Y  K
Sbjct: 66  GGPISIFLAYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLK 125

Query: 191 YLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFK 250
           Y I+    LTA  LVI YW  R  +N  VW+T+      ++N   V++FG+ E +++  K
Sbjct: 126 YAIVLSANLTAFGLVIGYW--RPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAK 183

Query: 251 XXXXXXXXXXXXXXXXXXXPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYA 310
                              PDH  +GFRYW+  G F PY   + G+ GKF+ + +  + +
Sbjct: 184 LTILLLIFIVCLVITCGGGPDHTTIGFRYWRESG-FLPY--LVKGNTGKFLGWWACVIQS 240

Query: 311 LFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXX 370
           +F ++G E+ GI+  E  NPRK++P+A +  + RI +FY+  +F+LG+ V+ ++ +L+  
Sbjct: 241 IFGFMGSEMIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHA 300

Query: 371 XXXXXXXXXXPFVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKA 430
                     PFV+AI  SGI+VLP   NA +L+F+ S+  +D+Y+ SR LY LA DG A
Sbjct: 301 HSTDANAS--PFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAA 358

Query: 431 PAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFIT 490
           P IF R     +P     V  L   LAYMN    +A VF Y  + VS+FG+L+W  I + 
Sbjct: 359 PKIFLRLNKHKIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVA 418

Query: 491 YIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFIT 550
           YI + R VK  GV   +  +  PFQPY  Y +L +   I F   ++ F+   F+YK FIT
Sbjct: 419 YIHYDRVVKSHGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFI-LKFNYKLFIT 477

Query: 551 GYIGLPVFVIFYFGYKFIKKTKIVKSHEVD 580
            YIG+   V+   GYK   KTK VK  E+ 
Sbjct: 478 SYIGIFANVLLVLGYKLYYKTKWVKPEEIT 507

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  317 bits (811), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 187/536 (34%), Positives = 283/536 (52%), Gaps = 23/536 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK+ LQ+RHV +                      GP  +FI+Y  +  +++  M A+GEM
Sbjct: 105 LKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYPIMCALGEM 164

Query: 159 ASYIPMDGFTSYAS------RYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
             ++P DG  S  S      RYVD +LGFA G+ Y + Y+IL   + TAAS V++YW   
Sbjct: 165 VCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTT- 223

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
             V  GVWIT+FL+V+V++N + VK +GE EFW +S K                   P H
Sbjct: 224 -AVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKH 282

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAAEAYNPR 331
           DRLGFRYWQHPGAF  +     GS+G F    +  +   FA+ LG EL  + +AE  + R
Sbjct: 283 DRLGFRYWQHPGAFAHH--LTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQR 340

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPFVVAIQNSG 390
           +++ +A +  VWR++ FY++    + + V YNDP L+             PFV+ IQN+G
Sbjct: 341 RNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNAG 400

Query: 391 IRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVC 450
           I+VLPHI N C+L   +SA N+ ++  +RSL ++A  G+AP    +   WG+P+ ++   
Sbjct: 401 IKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAAS 460

Query: 451 VLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGV-DRSKFA 509
            L + LAY+NVSS +A VFN+F N+ +I G L WIC  I Y+ F +A+   G+ DR  F 
Sbjct: 461 FLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFYNGLYDRLPFK 520

Query: 510 YSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIK 569
                QPY  +FSL     I     + +F+   +   +FI  Y+ LP+F++ + G+K   
Sbjct: 521 TWG--QPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIFLVLWLGHKLYT 578

Query: 570 KTKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625
           +T     H+  L     V +     G +  +EK   + E +     I +KF+  + 
Sbjct: 579 RTW----HQWWL----PVSEIDVTRGLVEIEEKSREIEELRLPPTSIKDKFMDTLL 626

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  315 bits (806), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 177/506 (34%), Positives = 281/506 (55%), Gaps = 14/506 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+ M                     AGP    I+Y F+G L +    ++GEM
Sbjct: 84  VKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VIQ+W  +  V  
Sbjct: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK--VPL 201

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI+IF V+I I+N+  VK++GEFEFW++S K                        +GF
Sbjct: 202 AAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VGF 260

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PGA+ P   + D + G+F+ +VS  + A F + G EL GI A EA NPRKSVPRA
Sbjct: 261 RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRA 320

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +K  V+RI+ FY+ ++  +G+ V YNDP+L             PF++AI+NSG +VLPHI
Sbjct: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TQSTSYVSTSPFIIAIENSGTKVLPHI 377

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA +L  + SA NS++YVGSR L+ L+ +  AP    RTT  G+P+ ++ V   F  LA
Sbjct: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           YM  S+G  +VF + +N+  + G  +W+ I I++I FM+A+K +G+ R +  + A   P 
Sbjct: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KS 576
             Y++  +   I  I+ FT F    F+  +F   YI + +F+  +  ++ I + + + K 
Sbjct: 498 LAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKI 556

Query: 577 HEVDLFTGKEVFDQQEIEGKILDQEK 602
            +VD+ +     D+++IE  + +  +
Sbjct: 557 GDVDIDS-----DRRDIEAIVWEDHE 577

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  311 bits (796), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 173/486 (35%), Positives = 277/486 (56%), Gaps = 17/486 (3%)

Query: 132 AGPASMFIAYSFVGILVFFTMAAIGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFK 190
           AGP    I+Y F+G +++    ++GEMA++IP+   F+ +A R++ PALG   GY Y   
Sbjct: 23  AGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLS 82

Query: 191 YLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFK 250
           +      +L+    +IQYW   D V    WI IF  ++ ++N+  VK++GEFEF ++S K
Sbjct: 83  WCFTFALELSVLGQIIQYW--TDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIK 140

Query: 251 XXXXXXXXXXXXXXXXXXXPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYA 310
                                   +GFRYW++PGA+ P   + D + G+F+ +VS  + A
Sbjct: 141 VIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINA 200

Query: 311 LFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXX 370
            F Y G EL GI A EA NPRK+VPRA+K  V RI++FY++++F +G+ V YNDP+L   
Sbjct: 201 AFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKL--- 257

Query: 371 XXXXXXXXXXPFVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKA 430
                     PF+++I+NSG +VLP IFNA VLI + SA NS++Y+GSR LYSL+ +  A
Sbjct: 258 DSDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLA 317

Query: 431 PAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFIT 490
           P      T  G+P++++    +F  LA++  S+GS + FN+ +N+  + G  +W+ I  +
Sbjct: 318 PRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFS 377

Query: 491 YIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFIT 550
           +I FM+A+  +G+ R+   Y A   PY  Y++  +   I  I+ FT F   SF   +F+ 
Sbjct: 378 HIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAF-APSFQPVDFVA 436

Query: 551 GYIGLPVFVIFYFGYKFIKKTKIV-KSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609
            YI + +FV  +F ++   K  I+ K  +VD+ +     D++EIE ++  +     LR+ 
Sbjct: 437 AYISVFLFVAIWFSFQLWFKCPIILKLQDVDIDS-----DRREIEEQVWIEP----LRKT 487

Query: 610 KFSLEW 615
           K+   W
Sbjct: 488 KWQCVW 493

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  313 bits (802), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 173/516 (33%), Positives = 286/516 (55%), Gaps = 14/516 (2%)

Query: 93  PKHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTM 152
           P+    +K+ L+ RH+ M                     AGP    I+Y F+G +++   
Sbjct: 60  PRKGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVT 119

Query: 153 AAIGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
            ++GEMA++IP+   F+ +A R++ PALG   GY Y   +      +L+    +IQYW D
Sbjct: 120 QSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTD 179

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
              V    WI IF  ++ ++N+  VK++GEFEF ++S K                     
Sbjct: 180 --AVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQS 237

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +GFRYW++PGA+ P   + + + G+F+ +VS  + A F Y G EL GI A EA NPR
Sbjct: 238 GGPIGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 297

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           ++VPRA+K  V RI++FY++++F +G+ V YNDP+L             PF+++I+NSG 
Sbjct: 298 RAVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL---DSEGTFVSSSPFMISIENSGT 354

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           +VLP IFNA VLI + SA NS++Y+GSR LYSL+ +  AP      T  G+P++++    
Sbjct: 355 KVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTS 414

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
            F  LA++  S+GS +VFN+ +N+  + G  +W+ I +++I FM+A+K +G+ R    Y 
Sbjct: 415 AFGFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYR 474

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT 571
           A   P+  Y++  +   I  I+ FT F   +F   +FI  YI + +F+  +  ++   K 
Sbjct: 475 ARMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFIAAYISVFLFIAIWLLFQVWFKC 533

Query: 572 KIV-KSHEVDLFTGKEVFDQQEIEGKI-LDQEKQIR 605
           + V K  +VD+ +     D+++IE ++ ++ E + R
Sbjct: 534 RFVWKLQDVDIDS-----DRRDIEEQVWIEPECKTR 564

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  313 bits (803), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 178/506 (35%), Positives = 283/506 (55%), Gaps = 14/506 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+ M                     AGP    IAY F+G L F    ++GEM
Sbjct: 84  VKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFSVTQSLGEM 143

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VIQ+W  +  V  
Sbjct: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHK--VPL 201

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI+IF V+I I+N+  VK++GEFEFW++S K                        +GF
Sbjct: 202 AAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGF 260

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PGA+ P   + + + G+F+ +VS  + A F + G EL GI A EA NPRK+VPRA
Sbjct: 261 RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRA 320

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +K  V+RI+ FY+ ++  +G+ V YNDP+L             PF+VAIQNSG +VLPHI
Sbjct: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TEATSYVSTSPFIVAIQNSGTKVLPHI 377

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA +L  + SA NS++YVGSR L+ L+ +  AP    RT+  G+P+ ++    +F  LA
Sbjct: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALA 437

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           YM  S+G  +VF + +N+  + G  +W+ I I++I FM+A+K +G+ R +  + A   P 
Sbjct: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KS 576
             Y+S  + + I  I+ FT F    F+  +F+  YI + +F+  +  ++ I + + + K 
Sbjct: 498 LAYYSSFFMIIIIIIQGFTAF-APKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKI 556

Query: 577 HEVDLFTGKEVFDQQEIEGKILDQEK 602
            +VD+ +     D+++IE  + +  +
Sbjct: 557 EDVDIDS-----DRRDIEAIVWEDHE 577

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  314 bits (805), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 184/570 (32%), Positives = 292/570 (51%), Gaps = 20/570 (3%)

Query: 31  QDGGIKFVD-QTNYNIYGNLDNMGDYSKDYYEKSQYQQQNLDIEXXXXXXXXXXXXXXXX 89
            + GI  VD   +     + DN     +  Y +  Y Q  L                   
Sbjct: 26  NNNGIDLVDVDIDIEATASNDNNKKNPQIIYNEKSYSQDELQTTSPTIIDSIDDEAEKEQ 85

Query: 90  XXXPKHTDG-LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILV 148
                 ++G LK+ L++RH+ +                      GPA +FI+Y  +   V
Sbjct: 86  GKERSSSNGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFV 145

Query: 149 FFTMAAIGEMASYIPMDGFTSYAS------RYVDPALGFAVGYCYLFKYLILCPNQLTAA 202
           +  M A+GEM  ++P +G  S  S      +YVDP+LGFA  + Y + ++IL   +++AA
Sbjct: 146 YPIMNALGEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAA 205

Query: 203 SLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXX 262
           S VI+YW   + V  G WITIFL +IVI+N   V  +GE EFW +S K            
Sbjct: 206 SGVIEYWAWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSF 265

Query: 263 XXXXXXXPDHDR-LGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELT 320
                  P  D  LGFRYW++PG+F  +     G  G F+   +  +   F+  LG EL 
Sbjct: 266 ILFWGGGPKSDGILGFRYWKNPGSFAHH--ITGGGGGNFLDIYTGIIKGGFSVILGPELV 323

Query: 321 GIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXX-X 379
            + ++E  + R+++ +A K  VWR++ FY++    +G+ VAYNDP L             
Sbjct: 324 CLTSSECADQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGS 383

Query: 380 XPFVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTS 439
            PFV+ IQN+GIR +PHI N C+L   +SA N+ ++  SRSL ++A +G AP IF R   
Sbjct: 384 SPFVIGIQNAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQ 443

Query: 440 WGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVK 499
            G+P+ ++G  +L + LAY+NVSS +A VFN+F N+ +I G + WIC  + YI F +A+ 
Sbjct: 444 LGVPYTAVGASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKAIT 503

Query: 500 VQGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFV 559
              +   +  + A  Q Y  ++SL W   I     + +F+  +++ K+FI  YI LP+F+
Sbjct: 504 YNKLTH-RIPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFI 562

Query: 560 IFYFGYKFIKKTKIVKS-----HEVDLFTG 584
           + + G+K   +T ++K+      ++D++TG
Sbjct: 563 VLWIGHKVFTRT-LLKAWLRPIDKIDVYTG 591

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  312 bits (799), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 177/515 (34%), Positives = 287/515 (55%), Gaps = 15/515 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+ M                     AGP    I+Y F+G L +    ++GEM
Sbjct: 84  VKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+   FT ++ R++ PA G A GY Y F + +    +L+    VIQ+W     V  
Sbjct: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTY--AVPL 201

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI+IF V+I  +N+  VK++GEFEFW++S K                        +GF
Sbjct: 202 AAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGP-VGF 260

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PGA+ P   + + +  +F+ +VS  + A F + G EL GI A EA NPRK+VPRA
Sbjct: 261 RYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRA 320

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +K  V+RI+ FY+ ++  +G+ V YNDP+L             PF++AI+NSG +VLPHI
Sbjct: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TSATSYVSTSPFIIAIENSGTKVLPHI 377

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA +L  + SA NS++YVGSR L+ L+    AP  F +TT  G+P+ ++    +F  LA
Sbjct: 378 FNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALA 437

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           YM  S+G  +VF + +N+  + G  +W+ I +++I FM+A+K +G+ R +  + A   P 
Sbjct: 438 YMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPG 497

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KS 576
             Y++  + V I  I+ FT F   +F+  NF+  YI + +F+  +  ++ I + + V K 
Sbjct: 498 LAYYATFFMVVIILIQGFTSFT-PTFNGVNFLAAYISVFLFLAIWILFELIFRCRFVWKI 556

Query: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
            +VD+ +     D+++IE  I+ +E + +   +KF
Sbjct: 557 EDVDIDS-----DRRDIEA-IVWEEPEPKTLWDKF 585

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  311 bits (796), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 170/477 (35%), Positives = 263/477 (55%), Gaps = 8/477 (1%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+SM                     +GP    IAY F+G +V+F   ++GEM
Sbjct: 56  VKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYFVTQSLGEM 115

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+    T ++ R++ PA G A GY Y F + I    ++     VIQYW   D V  
Sbjct: 116 ATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYW--TDAVPL 173

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI IF V++ + N   VKF+GE EFW++S K                        +GF
Sbjct: 174 AAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGS-HQGPIGF 232

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PG + P   + D + G+F+ +VS  + A F Y G EL GI A EA NPRK+VPRA
Sbjct: 233 RYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 292

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +    +RI+ FY++++F +G+ V Y+D RL             PFV++IQN+G +VLPHI
Sbjct: 293 INKVFFRILFFYILSLFFIGLLVPYDDLRL---SNTTAVIASSPFVISIQNAGTKVLPHI 349

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA V+I + SA NS++YVGSR LYSLA+ G AP  F   T  G+P+  + V  L  LLA
Sbjct: 350 FNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLA 409

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++ V++ + + FN+ VN+ ++ GL +W+ I ++++ FM+ +K +G+ R    + A   P+
Sbjct: 410 FLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLMPW 469

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV 574
           G Y++  +   I  I+ F  F    F   +F T YI L +  + + G +   + + +
Sbjct: 470 GAYYAAFFIGVIIIIQGFKAFT-PKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFI 525

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  311 bits (796), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 170/519 (32%), Positives = 285/519 (54%), Gaps = 14/519 (2%)

Query: 93  PKHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTM 152
           P+    +K+ L+ RH+ M                     AGP    I+Y F+G +++   
Sbjct: 60  PQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVT 119

Query: 153 AAIGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
            ++GEM ++IP+   F+ +A R++ PALG   GY Y   +      +L+    VIQYW +
Sbjct: 120 QSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTE 179

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
              V    WI IF  ++  +N+  VK++GEFEF ++S K                     
Sbjct: 180 --AVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQS 237

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +GFRYW++PGA+ P   + D + G+F+ +VS  + A F Y G EL GI A EA NPR
Sbjct: 238 DGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 297

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           K++PRA+K  V RI++FY++++F +G+ V YNDP+L             PF+++I+NSG 
Sbjct: 298 KALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL---DSDGIFVSSSPFMISIENSGT 354

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           +VLP IFNA VLI + SA NS++Y+GSR LYSL+ +  AP      T  G+P++S+    
Sbjct: 355 KVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTS 414

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           +F  LA++ VS+GS + FN+ +N+  + G  +W+ I  ++I FM+A++ +G+ R    Y 
Sbjct: 415 VFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYK 474

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT 571
           A   P+  Y++  +   I  I+ FT F   +F   +F+  YI + +F+  +  ++   K 
Sbjct: 475 AQMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAIWLSFQVWFKC 533

Query: 572 KIV-KSHEVDLFTGKEVFDQQEIEGKI-LDQEKQIRLRE 608
           +++ K  ++D+ +     D+++IE  + ++ E + R + 
Sbjct: 534 RLLWKLQDIDIDS-----DRRQIEELVWIEPECKTRWQR 567

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  311 bits (797), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 173/479 (36%), Positives = 268/479 (55%), Gaps = 6/479 (1%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RHVSM                     AGP    IA+  +G L +    ++GEM
Sbjct: 73  VKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEM 132

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+   FT ++ R++ PA+G A GY Y F + I    +L+    +IQYW   D V  
Sbjct: 133 ATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYW--TDAVPL 190

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI IF V++V  N+  VK++GEFEFW++S K                   P+   +GF
Sbjct: 191 EAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGPEGP-IGF 249

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW+ PG +     A + +  +F+ +VS  + A F Y G EL GI A E  NPRK+VPRA
Sbjct: 250 RYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRA 309

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +    +RI+IFY+ ++F +G+ V YNDP+L             PF++AI N    VLPHI
Sbjct: 310 INKVFFRILIFYIGSLFFIGLLVPYNDPKL-EGSDNGSYIAQSPFLIAILNCRTPVLPHI 368

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA +L  + SA NS++YVGSR L+ L+ +  AP  F +TT  G+P  ++ +  +F  LA
Sbjct: 369 FNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLA 428

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           Y+NVS+ + +VF++ +N+ +I G ++W+ I I++I FM+ +K +G+ R    Y A F PY
Sbjct: 429 YLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPY 488

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKS 576
             Y++  +   I  I+ FT F  H F+  +F   YI + +F I +  ++ I +TK+ ++
Sbjct: 489 AAYYAAFFITVIIIIQGFTAFAPH-FNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRT 546

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  311 bits (798), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 178/512 (34%), Positives = 275/512 (53%), Gaps = 15/512 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+ M                     AGP    IAY F+G +++F   ++GEM
Sbjct: 94  VKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFITQSLGEM 153

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+    T ++ R++ PA G   GY Y F + I    +++    VIQYW   D V  
Sbjct: 154 ATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYW--TDAVPL 211

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI IF V + ++N   VK +GE EFW++S K                        +GF
Sbjct: 212 AAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGS-SQGPIGF 270

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PG + P   + D + G+F+ +VS  + A F Y G EL GI A EA NPRKSVPRA
Sbjct: 271 RYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 330

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +   V+RI +FY++++F +G+ V YND  L             PFV++IQN+G   LP I
Sbjct: 331 INKVVFRIALFYIMSLFFIGLLVPYNDHTL---SSGDSYIASSPFVISIQNAGTYALPDI 387

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA V++ + SA NS++YVGSR LY+LA  G AP  F   T  G+P   + V     LLA
Sbjct: 388 FNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASLGLLA 447

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++ V++ +   FN+ +N+ ++ GL +W  I +++I FM+A+K +G+ R    + A   P+
Sbjct: 448 FLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKLMPW 507

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK-IVKS 576
           G Y+S  +   I FI+ F  F    +D   F T YI L + V+ + G +   + + ++K 
Sbjct: 508 GAYYSAFFVFVIIFIQGFEAF--TPWDTTTFFTSYISLILLVVVFIGCQLYYRCRFLLKV 565

Query: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRLRE 608
            ++D+ T     D++EIE  I + ++   L E
Sbjct: 566 EDIDIDT-----DRREIEAIIWEDDEPKNLWE 592

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  310 bits (794), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 189/540 (35%), Positives = 286/540 (52%), Gaps = 26/540 (4%)

Query: 93  PKHTD-GLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFT 151
           P+  D  LKK L++ H+ +                      GPA +FI+Y  +  +++  
Sbjct: 45  PQSGDHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPV 104

Query: 152 MAAIGEMASYIPM--------DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAAS 203
           M A+ EM  ++P            ++  +RYVD +LGFAVG+ Y++ Y+IL   + TAAS
Sbjct: 105 MNALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAAS 164

Query: 204 LVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXX 263
            V+ YW     V    WITIFL +IV++N   V+F+G  E    S K             
Sbjct: 165 GVVTYWTT--AVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIV 222

Query: 264 XXXXXXPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGI 322
                 P+HDRLGFR+W+ PGA+  +    DG  G+    ++  + A FA+ LG EL  +
Sbjct: 223 LFFGGGPNHDRLGFRFWKDPGAWAYH--LADGGAGRLSDIITGVIRAGFAFILGPELVVL 280

Query: 323 VAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXP 381
            + EA + R+++ +A +  VWR++ FY V+    G+ V+ NDP LL             P
Sbjct: 281 TSTEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSP 340

Query: 382 FVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWG 441
           FV+ IQN+GI+VLPHI N C+L   +S+ NS +Y  +RSL SL+ +G AP IF R   WG
Sbjct: 341 FVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWG 400

Query: 442 LPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQ 501
           +P+  +     F+ LAY+NVSS +A VFN+F N+ +I G L WIC  + Y+ F +AV   
Sbjct: 401 VPYTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFN 460

Query: 502 GV-DRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVI 560
            + DR  F    PFQPY T+F +     I  I  +  F+   ++YK+FI  YI LP+F+I
Sbjct: 461 NLYDRLPF--KTPFQPYFTWFYIILIAIICLINGYESFV--HWNYKDFIAAYITLPLFLI 516

Query: 561 FYFGYKFIKKT---KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIY 617
            + G+K   +T    ++   E+D+ TG     + E E K L+  +       +  LEW++
Sbjct: 517 LWLGHKAYTRTWSQWMISVSEIDVTTG---LREIEEETKELNARRIPPRNLWEKILEWLF 573

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  310 bits (793), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 178/508 (35%), Positives = 277/508 (54%), Gaps = 14/508 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+ M                     AGP    IAY F+G LV+    ++GEM
Sbjct: 59  VKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEM 118

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+   FT ++ R++ P+ G A GY Y F + I    +L+    +IQ+W     V  
Sbjct: 119 ATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW--TSAVPI 176

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI+IF V++V +N+  V+F+GEFEFW++S K                        +GF
Sbjct: 177 VAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP-VGF 235

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PG   P   A + +  KF+ +VS  + A F Y G EL GI A EA NPRKSVPRA
Sbjct: 236 RYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 295

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +K  V+RI+ FY+ ++F +G+ V YNDP+L             PF+++IQNSG  +LPHI
Sbjct: 296 IKKVVFRILFFYIGSLFFIGLLVPYNDPKL---TSDDSYVAASPFIISIQNSGTPILPHI 352

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA +L  + SA NS++YVGSR ++ L+    AP I  RT   G+P  S+    LF  LA
Sbjct: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           YM  S+G    FN+ +N+  + G  SW+ I I+++ FM+A++ +G+ R    + A F P 
Sbjct: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KS 576
             Y+++ +   I  I+ FT F   SFD  +F+  YI   +F+  +  ++   + +++ K 
Sbjct: 473 LAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKI 531

Query: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQI 604
            +VD+ T     D+++IE  + +    +
Sbjct: 532 EDVDIDT-----DRRDIEEVVWEDPPPV 554

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  310 bits (795), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 178/479 (37%), Positives = 260/479 (54%), Gaps = 9/479 (1%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+ M                     AGP    IAY F+G LVF    ++GEM
Sbjct: 102 VKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEM 161

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+   FT +ASR+V    G A GY Y F + I    +L+    VI++W  +  V  
Sbjct: 162 ATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK--VPL 219

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI+IF V+IVI+N   VK +GEFEFW++S K                        +GF
Sbjct: 220 AAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP-VGF 278

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW+HPG + P   + D +  +F+ +VS  + A F Y G EL GI A EA NPRKSVPRA
Sbjct: 279 RYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 338

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +K    RI++FY++++F +G+ V YNDP+L             PF++AIQNSG +VLPHI
Sbjct: 339 IKKVSVRILLFYILSLFFIGLLVPYNDPKL---SSTDSYVSASPFIIAIQNSGTKVLPHI 395

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA +L  + SA NS++YVGSR LY L+    AP  F++T + G+P  ++     F  LA
Sbjct: 396 FNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFIAVLFTAAFGALA 454

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           YM  S+G    FN+ +N+  + G  +W+ I I++I FM+ +K +G+ R    Y A   P 
Sbjct: 455 YMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPG 514

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKS 576
             Y+   +   I  I+ FT F    FD   F+T YI   +F+  Y   +   +T++ ++
Sbjct: 515 LAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRT 572

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  310 bits (795), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 174/510 (34%), Positives = 274/510 (53%), Gaps = 14/510 (2%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           H   +K+ L+ RH+ M                     +GP    IAY F+G +++    +
Sbjct: 97  HDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQS 156

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GEMA++IP+    T ++ R++ PA G A GY Y F + I    +++    VI+YW  + 
Sbjct: 157 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKK- 215

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            V    WI IF V + ++N   VK +GE EFW++ F                        
Sbjct: 216 -VPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIA-FMKVLAIAGYLLYALIIVCGGSSQG 273

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +GFRYW++PG +     + D +  +F+ +VS  + A F Y G EL GI A EA NPRKS
Sbjct: 274 PIGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 333

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           VPRA+   V+RI +FY++++F +G+ V Y+DPRL             PFV++IQN+G ++
Sbjct: 334 VPRAINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASS---PFVISIQNAGTKI 390

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP IFNA V+I V SA NS++YVGSR LY+LA  G AP  F   T  G+P+  +      
Sbjct: 391 LPDIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAAL 450

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LLA++ V++ +   FN+ +N+ ++ GL +W+ I I++I FM+A+K +G+ R    + A 
Sbjct: 451 GLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAK 510

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKI 573
           F P+  Y++  +   I FI+ F  F  H FD   F T YI L +  + + G +   + + 
Sbjct: 511 FMPWAAYYATFFVTVIIFIQGFQAFSPH-FDVTAFFTAYISLIILAVLFIGCQIYYRCRF 569

Query: 574 V-KSHEVDLFTGKEVFDQQEIEGKILDQEK 602
             K  ++D+ T     D++EIE  I + ++
Sbjct: 570 FWKLEDIDIDT-----DRREIEEVIWEDDE 594

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  310 bits (793), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 174/510 (34%), Positives = 273/510 (53%), Gaps = 14/510 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RHVSM                     +GP    IAY F+G +V+F   ++GEM
Sbjct: 115 VKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYFVTQSMGEM 174

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+    T ++SR++ PA G A GY Y F + I    +L+    VI+YW +   V  
Sbjct: 175 ATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEYWTE--AVPR 232

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI IF V++ + N   V+F+GE EFW++S K                        +GF
Sbjct: 233 AAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGS-KQGPIGF 291

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PG +     + D   G+F+ +V+  + A F Y G EL GI A EA NPR++VPRA
Sbjct: 292 RYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAANPRRTVPRA 351

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +    +RI+ FY++++F +G+ V YN   L             PFV++IQN+G R LP I
Sbjct: 352 INKVFFRILFFYILSLFFVGLLVPYNHSSL---DKTTTVIASSPFVISIQNAGTRALPDI 408

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA VL+ + SA NS++YVGSR L+SLA  G AP +F   T  G+P   + V  L  LLA
Sbjct: 409 FNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTSLLGLLA 468

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++ V+  + + FN+ +N+ ++ GL +W+ I I++I FM+ +K +G+ R    + +   PY
Sbjct: 469 FLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPY 528

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSH 577
           G Y++  W   I F++ F  F  H F    F T YI L + V+ + G +   + +     
Sbjct: 529 GAYYAAFWVTVIIFVQGFQAFSPH-FKVTEFFTSYISLMLLVVVFCGAQLFYRCRFFNRL 587

Query: 578 E-VDLFTGKEVFDQQEIEGKILDQEKQIRL 606
           E +D+ +     D++E +  I + ++   L
Sbjct: 588 EDIDIDS-----DRREADALIWEDDEPTTL 612

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  309 bits (791), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 176/493 (35%), Positives = 280/493 (56%), Gaps = 9/493 (1%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+ M                     AGP    IAY F+  +VF    ++GEM
Sbjct: 97  VKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQSLGEM 156

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+   FT ++SR++ PA+G A GY Y F + +    +L+    +IQ+W     V  
Sbjct: 157 ATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTH--AVPL 214

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI I+ V++ I+N+  VKF+GEFEFW++S K                        +GF
Sbjct: 215 SAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVTGP-VGF 273

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PG + P   + D + G+F+ +VS  + A F Y G EL GI A EA NPRK+VPRA
Sbjct: 274 RYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 333

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +K   +RI+IFY++++F +G+ V Y+D +L             PF++AI+NSG ++LPHI
Sbjct: 334 IKKVTFRILIFYILSLFFIGLLVPYDDEKL---TSTDSYISASPFIIAIENSGTKILPHI 390

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA +L  + SA NS++YVGSR L+ LA    AP  F  T+  G+P+YS+     F  LA
Sbjct: 391 FNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGALA 450

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++ VSSG A+ FN+ +N++S+ G  +W+ I I ++ FM+A+K +G+ R    + A F P+
Sbjct: 451 FLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMPH 510

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKS- 576
             Y+S+ +   I  I+ FT F   +F+  +F+  YI + +F   +  ++   ++K++ + 
Sbjct: 511 LAYYSIFFMTIIIIIQGFTAF-APTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWTV 569

Query: 577 HEVDLFTGKEVFD 589
            EVD+ T +   D
Sbjct: 570 EEVDIDTDRRDVD 582

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  307 bits (787), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 170/520 (32%), Positives = 282/520 (54%), Gaps = 13/520 (2%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           H   +K+ L+ARH+SM                     AGP    IAY F+G +V+    +
Sbjct: 56  HETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYSITQS 115

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GEMA++IP+    T ++ R++ PA G A GY Y F + I    +L+    +I YW    
Sbjct: 116 LGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYW--TS 173

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            V  G WITIF +++ ++N   V+F+GE EFW++S K                       
Sbjct: 174 VVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGS-SQG 232

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +GFR W++PG +     + + +  +F+ +VS  + A F Y G EL GI A E+ NPRK+
Sbjct: 233 PIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKT 292

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           VP+A+    +RI+ FY++++F +G+ V YNDPR+             PFV++I+N+G ++
Sbjct: 293 VPKAINKVFFRILFFYILSLFFVGLLVPYNDPRM--DNTSDTDVNASPFVISIRNAGTKI 350

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP IFNA VL+ V SA NS++Y+GSR +YSLA  G AP  F      G+P   + V  L 
Sbjct: 351 LPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTALM 410

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            L+A++ V++ +   FN+ VN+ ++ GL +W+ I + +I FM+ +K +G+ R    + A 
Sbjct: 411 GLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFKAK 470

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKI 573
           F P+  Y++ ++   I FI+ +T F    FD   F T YI L + ++ + G +   K + 
Sbjct: 471 FMPWAAYYAASFVFVIIFIQGYTAF-SPKFDVTQFFTAYISLMLMLVVFIGCQIYYKCRF 529

Query: 574 V-KSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFS 612
           + K  ++D+ T     +++EI+  + + ++   L +  +S
Sbjct: 530 LWKLEDIDIDT-----NRREIDAIVWEDDEPKNLWDKFWS 564

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  305 bits (782), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 177/555 (31%), Positives = 297/555 (53%), Gaps = 38/555 (6%)

Query: 52  MGDYSKDYYEKSQYQQQNLDIEXXXXXXXXXXXXXXXXXXXPKHTDGLKKNLQARHVSMX 111
           +G +++D   K + ++ ++++E                       + +++ L+ RH+ M 
Sbjct: 2   LGGHNQDSKMKEEIREISVEVE----------------------AETVRRELKQRHMGMI 39

Query: 112 XXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMASYIPM-DGFTSY 170
                               AGP    IAY F+  L +    ++GEMA++IP+   FT +
Sbjct: 40  ALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVF 99

Query: 171 ASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVI 230
           + R+V PA G A GY Y F + I    +L+    VIQ+W     V    WI+IF V++  
Sbjct: 100 SQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFW--TFAVPLAAWISIFWVLLTG 157

Query: 231 INVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYWQHPGAFKPYS 290
           +N+  VK++GEFEFW++  K                        +GFRYW+HPGAF P  
Sbjct: 158 MNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGI 216

Query: 291 DAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYL 350
            A D +  +F+ +VS  + A F + G EL GI A EA NPRK+VPRA+K  V+RI+ FY+
Sbjct: 217 IAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILFFYI 276

Query: 351 VTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIFNACVLIFVFSAC 410
           +++F +G+ V Y+D +L             PF++AI+NSG  VLPHIFNA ++  + SA 
Sbjct: 277 LSLFFIGLLVPYDDWKL---TSTDSYVSASPFIIAIENSGTHVLPHIFNAVIVATIISAG 333

Query: 411 NSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFN 470
           NS++YVGSR +Y L+    AP I  RTT  G+P  ++ V  LF  LAYM  S+G  + FN
Sbjct: 334 NSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFN 393

Query: 471 YFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIA 530
           + +N+  + G  +W+ I +++I FM+A++++G+ R    + A + P   Y+ + +   I 
Sbjct: 394 WLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLII 453

Query: 531 FIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KSHEVDLFTGKEVFD 589
            I+ FT F    ++  +F+T YI + +F+  +  ++   + +++ +  +VD+ T     D
Sbjct: 454 IIQGFTSFC--PWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVEDVDIDT-----D 506

Query: 590 QQEIEGKI-LDQEKQ 603
           ++ +E  + ++QE +
Sbjct: 507 RRAVEEAVWIEQEPR 521

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  306 bits (783), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 178/513 (34%), Positives = 275/513 (53%), Gaps = 20/513 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RHVSM                     AGP    IAY F+G +V+F   ++GEM
Sbjct: 54  VKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYFVTQSMGEM 113

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+    T +++R++ PA G A GY Y F + I    +++    VIQYW     V  
Sbjct: 114 ATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYW--TKAVPL 171

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI IF V I + N   V+F+GE EFW++S K                        +GF
Sbjct: 172 AAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGS-KQGPIGF 230

Query: 278 RYWQHPGAFKPYSDAI---DGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSV 334
           RYW++PG   P+ D I   D   G+F+ +V+  + A F Y G EL GI A EA NPRK+V
Sbjct: 231 RYWRNPG---PWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPRKTV 287

Query: 335 PRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVL 394
           P+A+    +RI+ FY++++F +G+ V YN P L             PFV++IQ++G R+L
Sbjct: 288 PKAINKVFFRILFFYILSLFFVGLLVPYNHPGL---DKHTSVIASSPFVISIQSAGTRIL 344

Query: 395 PHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFA 454
           P IFNA VL+ + SA NS++YVGSR L+SLA  G AP  F   T+ G+P+  +    L  
Sbjct: 345 PDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLG 404

Query: 455 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPF 514
           LLA++ V   + + FN+ +N+ ++ GL +W+ I I++I FM+ +K +G+ R    + +  
Sbjct: 405 LLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKL 464

Query: 515 QPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVF-VIFYFGYKFIKKTKI 573
            PYG Y++  W   I F++ F  F    F    F TGYI L +  V+F     + +    
Sbjct: 465 MPYGAYYAAFWVAVIIFVQGFQAFC-PKFKVAEFFTGYISLILLAVVFCLAQLYYRCRFF 523

Query: 574 VKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRL 606
            +  ++D+ +     D++EI+  I ++E+   L
Sbjct: 524 NRLEDIDIDS-----DRREIDALIWEEEEPTTL 551

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  306 bits (784), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 182/521 (34%), Positives = 280/521 (53%), Gaps = 26/521 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK+ L +RHV                        GP  + I+Y  +  +++  M A+GEM
Sbjct: 58  LKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNALGEM 117

Query: 159 ASYIPMDGFTSYAS------RYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
             Y+P +G  S  S      RYVD +L FA G+ Y + ++IL   + TAAS V+ YW   
Sbjct: 118 VCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTYW--T 175

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
            +V   VWITIFL ++ ++N + VK+FGE EFW +S K                   P H
Sbjct: 176 TSVPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGGPSH 235

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAAEAYNPR 331
            RLGF YW+ PG F  +     GS G F+   +  +   FA+ LG EL  + ++E  + R
Sbjct: 236 VRLGFHYWKDPGTFAHHITG--GSWGSFLDIYTGIIKGAFAFILGPELVALTSSECNDQR 293

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXX-XXXXPFVVAIQNSG 390
           +++ +A K  +WR++ FY++    + + VAYNDP LL             PFV+ IQN+G
Sbjct: 294 RNIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIGIQNAG 353

Query: 391 IRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVC 450
           I+VLPHI NAC+L   +SA NS ++  SRSL ++A +G AP IF +   +G+P+YS+G+ 
Sbjct: 354 IKVLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGLS 413

Query: 451 VLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGV-DRSKFA 509
            + + LA++NVSS +AQVF++F N+ +I G L WIC  I Y+ F +A+    + DR  F 
Sbjct: 414 AMLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNMYDRLPFK 473

Query: 510 YSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIK 569
                QPY  ++SL     I     +  F+   +   +F+  YI LP+F+I + G+KF  
Sbjct: 474 TFG--QPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVGHKFWA 531

Query: 570 KTK----IVKSH----EVDLFTGKEVFDQQEIEGKILDQEK 602
           + K    ++K +    E+D+ TG  + + +E+  K LD  +
Sbjct: 532 RYKHAVPLLKLYYPVDEIDVITG--LAEAEEVAEK-LDMNR 569

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  306 bits (783), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 167/477 (35%), Positives = 264/477 (55%), Gaps = 8/477 (1%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+SM                     AGP    IAY F+G + +F   ++GEM
Sbjct: 82  VKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQSLGEM 141

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+   FT +  R++ PA G A GY Y F + I    +L+    +IQ+W     V  
Sbjct: 142 ATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFW--TFAVPL 199

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G WI IF V++   N+  VK++GE EFW++  K                        +GF
Sbjct: 200 GAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPVGF 258

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PG + P   + D + G+F+ +VS  + A F Y G EL GI A E+ NPR++VPRA
Sbjct: 259 RYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKNPRRTVPRA 318

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +    +RI+ FY++++  +G+ V +NDP+L             PFV+AI+NSG +VLPHI
Sbjct: 319 INKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENSGTKVLPHI 375

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA +L  + SA NS++YVGSR LY LA +  AP +F R T  G+P+ S+     F  LA
Sbjct: 376 FNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAAFGFLA 435

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           Y+N+S+ + +VF++ +N+ +I G  +W+ I + +I FM+ +K + + R+   + A F P+
Sbjct: 436 YLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPW 495

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV 574
           G Y+S  +   I  I+ FT F    F+  NF   YI + +F+  +  ++   +T+ +
Sbjct: 496 GAYYSAFFISLIIIIQGFTAF-APKFNVSNFFAAYISVFLFLAIWVVFQIRFRTRFI 551

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  304 bits (778), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 171/512 (33%), Positives = 277/512 (54%), Gaps = 10/512 (1%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           K  D +K+ L+ RH+SM                     AGP    IAY F+G +VF    
Sbjct: 31  KQQD-VKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFSVTQ 89

Query: 154 AIGEMASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
           ++GEM ++IP+   FT +A R++ PA G A GY Y F + +    +L+    +IQ+W   
Sbjct: 90  SLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW--T 147

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
             V    WI+I  V++ I N+  V+ +GE EFW++S K                      
Sbjct: 148 MAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGICIICGAGVTG 207

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
             +GFRYW++PG +     + + +  +F  +VS  + A F + G EL GI A E   PRK
Sbjct: 208 P-VGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRK 266

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           +VP+A+K  V+RI++FY+ ++ ++G+ V YNDP+L             PF++ IQN+G +
Sbjct: 267 TVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL---QSNDSYVSSSPFIITIQNAGTK 323

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
           +LPHIFNA +LI + SA NS++Y+GSR LY LA +  AP  F  T+  G+P+ ++    +
Sbjct: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
           F  LAYM  ++G  + F + +N+V + G  +W+ I  ++I FM+A+K +G+ R+   Y A
Sbjct: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK 572
              P+  Y+++ + V I  I+ FT F    F   NF   YI + +F+IF+  ++   K +
Sbjct: 444 MLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVFLFIIFWVAFQIWFKCR 502

Query: 573 IV-KSHEVDLFTGKEVFDQQEIEGKILDQEKQ 603
           +V K  +VDL T +   +++     + D+ K 
Sbjct: 503 LVWKLQDVDLDTDRRDIEEEVWSDDVEDKNKN 534

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  304 bits (779), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 173/509 (33%), Positives = 272/509 (53%), Gaps = 15/509 (2%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           H   +K+ L+ RH+ M                     +GP    IAY F+G +V+F   +
Sbjct: 98  HDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFVTQS 157

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GEMA++IP+    T +  R++ PALG + GY Y F + I    +L+    +IQYW  + 
Sbjct: 158 LGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWTYK- 216

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            V    WI IF V++ ++N   VK +GE EFW+SS K                       
Sbjct: 217 -VPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGS-RQG 274

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +GFRYW+H  AF     + +    +F+ +VS  + A F Y G EL GI A EA NPRK+
Sbjct: 275 PIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPRKT 334

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           VPRA+   ++RI +FY++++F +G+ V YND RL             PFV+++ N+G   
Sbjct: 335 VPRAINKVIFRIALFYILSLFFIGLLVPYNDKRL---SDGSAIIASSPFVISMLNAGTSA 391

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP IFNA +LI V SA NSD+Y+ SR LY+LA  G AP  F     +G+P+  + V  L 
Sbjct: 392 LPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLV 451

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
             LA++ VS+ +   FN+ +N+ ++ GL +W  I   +I FM+A+K +G+ R    + A 
Sbjct: 452 GWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKAR 511

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFG-YKFIKKTK 572
           F P+G Y++  +   I FI+ +  F    +D K+F T YI L +F + Y G   + +   
Sbjct: 512 FMPWGAYYAAFFVGLIIFIQGYDAFT--PWDTKSFFTSYISLILFGVLYLGCLIYYRGRL 569

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQE 601
           ++K  ++D+ T     D++E+E  + +++
Sbjct: 570 LIKIEDIDIDT-----DRKEVEAYVWEED 593

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  303 bits (775), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 178/528 (33%), Positives = 289/528 (54%), Gaps = 27/528 (5%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           H   +K+ L+ RH+ M                     +GP    IAY FVG L +    +
Sbjct: 58  HDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQS 117

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GEMA++IP+   FT +ASR++ P++G AVGY Y F + +    +L+    ++ YW    
Sbjct: 118 LGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW--TF 175

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            V    WI+IF V++  +N+  VKF+GE EFW+++ K                       
Sbjct: 176 AVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP 235

Query: 274 RLGFRYWQHPGAFKPYSDAI---------DGSVGKFVAFVSVFVYALFAYLGIELTGIVA 324
            +GFRYW++PG   P+ D +         + + G+F+ + +  + A F Y G EL GI A
Sbjct: 236 -VGFRYWRNPG---PWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITA 291

Query: 325 AEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVV 384
            EA NPRK+VPRA+K  V+RI++FY+ ++F +G+ V ++DP+L             PF++
Sbjct: 292 GEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDDSYVSSS---PFII 348

Query: 385 AIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPH 444
           AI+NSG ++LP IFNA +LI + SA NS++YVGSR L+SLA  G AP I  RTT  G+P 
Sbjct: 349 AIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPW 408

Query: 445 YSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVD 504
            S+    +F +LAYM  + G   VF++ VN+ +I G  +W+ I I++I FM+ +K +G+ 
Sbjct: 409 VSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGIS 468

Query: 505 RSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFG 564
           R    + A   P   Y+++   V I   + FT F   +FD  +F   YI + +F + +  
Sbjct: 469 RDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFT-PTFDVSDFFAAYISVILFFLIWGA 527

Query: 565 YKFIKKTK-IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
           ++   K + I K  +VD+ +     +++++E KI+ ++ + +   +KF
Sbjct: 528 FQLWFKCRWIWKLEDVDIDS-----NRRDVE-KIIWEDPEPKTFWDKF 569

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  301 bits (770), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 171/501 (34%), Positives = 273/501 (54%), Gaps = 15/501 (2%)

Query: 97  DGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIG 156
           + +++ L+ RHVSM                     AGP    I+Y F+G + +    ++G
Sbjct: 51  NAVQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLG 110

Query: 157 EMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTV 215
           EMA++IP+   FT +  R++   LG A GY Y F + +    +L+    +I+YW     V
Sbjct: 111 EMATFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTS--AV 168

Query: 216 NPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRL 275
               WI IF V I + N+  VKF+GEF+FW++  K                        +
Sbjct: 169 PNAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAG-KTGPV 227

Query: 276 GFRYWQHPGAFKPYSDAI---DGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
           GFRYW++PG   P+ D I   D   G+F+ +VS  V A F Y G EL GI A E+ NPRK
Sbjct: 228 GFRYWRNPG---PWGDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRK 284

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           +VP+A+    +RI++FY+ ++F +G+ V +ND +L             PF++AIQNSG +
Sbjct: 285 TVPKAINKVFFRILLFYVGSLFFIGLLVPFNDEKL---TSSDSYSAGSPFIIAIQNSGTK 341

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
           +LP IFNA +L  + SA NS++YVGSR LY LA +  AP  F RT   G+P  ++     
Sbjct: 342 ILPDIFNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVAN 401

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
           F  L Y++VS+G+++ F++ +N+ +I G  SW+ I + ++ FM+A+K+QG+ R    + A
Sbjct: 402 FGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKA 461

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK 572
              P+G Y+S  +   I  I+ FT  L  +F+  NF   YI + +F++ +  ++   +T+
Sbjct: 462 KLMPWGAYYSAFFITLIIIIQGFTS-LAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTR 520

Query: 573 IVKSHE-VDLFTGKEVFDQQE 592
           I+   E VD+ + +   D Q+
Sbjct: 521 IIHRIEHVDIDSDRREVDAQQ 541

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  300 bits (767), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 167/489 (34%), Positives = 267/489 (54%), Gaps = 10/489 (2%)

Query: 93  PKHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTM 152
           P  +D +K+ L+ RHV+M                     AGP    +AY FV  + +   
Sbjct: 44  PNQSD-VKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVT 102

Query: 153 AAIGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
            ++GEMA++IP+   FT +ASR+V PALG A GY Y   + I    +++    +I YW  
Sbjct: 103 QSLGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW-- 160

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
            D V    W+ IF V++  IN+  VKF+GEFEFW++S K                     
Sbjct: 161 SDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-K 219

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
             R+GFRYW+ PG +     + +    +F+ +VS  + A F + G EL G+ A E  NPR
Sbjct: 220 LGRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPR 279

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           ++VP+A+    +RI++FY+ ++ ++G+ V Y+DP+L+            PFVVAI  +G 
Sbjct: 280 RTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANAS-PFVVAINAAGT 338

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           +VLP I N  +++ + SA NS++YVGSR LY L   G APA   RTTS G+P+ ++    
Sbjct: 339 KVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATS 398

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           +F  L Y+NVSS S  VF++ +++ ++ G  +W+ I +++I FM+ +K +G+ R    + 
Sbjct: 399 MFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFK 458

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT 571
           A F PYG Y++  + + I  ++ FT F    F   +F+  YI   +FV+ +  ++F+ K 
Sbjct: 459 AKFMPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKG 516

Query: 572 KIVKSHEVD 580
           +    H VD
Sbjct: 517 RWF--HTVD 523

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  298 bits (763), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 172/502 (34%), Positives = 277/502 (55%), Gaps = 10/502 (1%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           + +  L++  + RHV M                      GP S+ IA+ F G L+   + 
Sbjct: 41  ESSQTLQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLLIGVLM 100

Query: 154 AIGEMASYIPMD-GFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
           ++ EMAS+ PMD  F+ YA+RYVDPALGFA G+ Y  KY I   ++L+A  L++QYW  R
Sbjct: 101 SLAEMASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALASELSAIGLLVQYW--R 158

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
           + ++  ++I +FLVV++ +N   +KF+GE EFW +  K                   P  
Sbjct: 159 EDLSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGGPSK 218

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
           + +GFRYW+   AF PY   + G+ G+F+ + +  + + +AY+G E  G+V  EA NP+K
Sbjct: 219 ETIGFRYWREY-AFVPY--LVKGTTGRFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKK 275

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           ++P A +  ++RI  FY+V + +LG+ ++ +D  L             PFV+A  N+GI+
Sbjct: 276 TIPAATRNVIFRITGFYIVGVLILGLIISPHDKTL--ANAKTSDASGSPFVIAFTNAGIK 333

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
            LP   NA +++F+ SA N+ LYV SR+ Y LA DG AP IF     +G+P     +  L
Sbjct: 334 GLPSFINAMLIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGL 393

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
            +LL++MN+S+ S+ +F Y  + V++FG L+W+ + I+YIG+ RA     V R +  +  
Sbjct: 394 ISLLSFMNISNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFHDVPRDRIPFRM 453

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK 572
            FQPY  Y  L +   I F   ++ F+   F YK+FI  YIG+ VF+     +KF KK+ 
Sbjct: 454 WFQPYSAYVCLFFVSLIIFFNGYSAFIA-GFKYKSFIVSYIGIAVFIGNTLFWKFWKKSA 512

Query: 573 IVKSHEV-DLFTGKEVFDQQEI 593
             +  ++  +   + + + +EI
Sbjct: 513 ATRPEDLRSIMVEEAIVEVREI 534

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  298 bits (764), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 178/529 (33%), Positives = 281/529 (53%), Gaps = 22/529 (4%)

Query: 97  DGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIG 156
           + L+K L +RH+ +                      GP  +F+++  +  +V+  M  + 
Sbjct: 44  NNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLA 103

Query: 157 EMASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTV 215
           EM  Y+P  G      SRYVDP+LGFA G+ Y + Y IL   +L+AA+ V+QYW D+  V
Sbjct: 104 EMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTDK--V 161

Query: 216 NPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRL 275
           +  VWITIFLV++V +N A VKF+GE EFW +S K                   P HDRL
Sbjct: 162 HVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRL 221

Query: 276 GFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAAEAYNPRKSV 334
           GFRYW +PG F  +     G+ G+F+   +  + + FA+ L  EL G+   EA + R+++
Sbjct: 222 GFRYWNNPGPFAYH--ITGGNTGRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNI 279

Query: 335 PRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXX-XXXXPFVVAIQNSGIRV 393
            +A +  +WRI+ FY+ +   +G  ++ +DP+L+             PFV  I N+GI V
Sbjct: 280 EKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPV 339

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           L HI NA +L   +S+ NS +Y  SRS+ +LA  G AP +F R    G+P+ ++ +    
Sbjct: 340 LNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALSTAV 399

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
           + L Y+N SS SAQVF +  N+ +I G + W  I ITY+ F +A+    +   +  + + 
Sbjct: 400 SCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIFYNNL-YERVPFKSA 458

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK- 572
            QPY TYF + + V +     +  F+   ++  +F+  YI LP+F + Y G+K   KT+ 
Sbjct: 459 LQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKTRW 518

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFL 621
            +   E+D+ TG  + D +E E K+     Q R  +N      ++EKF+
Sbjct: 519 YIPFREIDVITG--LADAEE-EAKM----TQPRTPKN------MWEKFM 554

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  298 bits (762), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 170/513 (33%), Positives = 274/513 (53%), Gaps = 14/513 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+ M                     AGP  M IAY F+  + F  M ++GEM
Sbjct: 74  VKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQSLGEM 133

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A+YIP+   F+ ++ R++ PA G A GY Y F + I    +L+    ++QYW  +  V  
Sbjct: 134 ATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWTFKVPV-- 191

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI+IF V+I  +N   VKF+GEFEFW++  K                        +GF
Sbjct: 192 AAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGAG-KTGPVGF 250

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW+H  AF     + + +  +F+ +VS  + A F Y G EL GI A EA NPRK+VP++
Sbjct: 251 RYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPKS 310

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +K T+WRI+IFY+ ++  +G+ V +ND  L             PF++AI+NSG + LP I
Sbjct: 311 IKRTLWRILIFYIFSLLFVGLLVPFNDHGL---QDSRSYAASSPFILAIKNSGTKALPDI 367

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA +L  V SA NSD+YVGSR +YS+A +  AP I  + +  G+P+ ++        LA
Sbjct: 368 FNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGALA 427

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           Y+  SS  A VFN+ +N+  + G  SW  I  +++ FM+A+K +G+ R+   + A F P+
Sbjct: 428 YLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASFMPW 487

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYK-FIKKTKIVKS 576
              +S  +   I  ++ FT F  H F   +F+  YI + +F + +  ++ + +   +V  
Sbjct: 488 IAIYSFFFMTLIILVQGFTCFTPH-FQASDFVASYISVGLFFVIWAVFQIWFRCPLLVPI 546

Query: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609
            E+D+ T     D+++++ ++ + E    L + 
Sbjct: 547 AEIDIDT-----DRRDVDAEVWEDEPPKTLWDK 574

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  297 bits (761), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 165/476 (34%), Positives = 267/476 (56%), Gaps = 8/476 (1%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ L+ RH+ M                     AGP    IAY F+  +VF    ++GEM
Sbjct: 89  VKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+   FT ++SR++ P++G A GY Y F + I    +L+    +IQ+W   D V  
Sbjct: 149 ATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQFW--TDAVPL 206

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI I+  ++ I+N+  VKF+GEFEFW++S K                        +GF
Sbjct: 207 SAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT-GPVGF 265

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PG + P   +   + G+F+ +VS  + A F Y G EL GI A EA NPRK+VPRA
Sbjct: 266 RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 325

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           +K   +RI+IFY++++F +G+ V ++DP+L             PF++AIQNSG +VLPHI
Sbjct: 326 IKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDDSYVSSS---PFIIAIQNSGTKVLPHI 382

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FNA +L  + SA NS++YVGSR ++ LA    AP  F  TT  G+P+ ++     F  LA
Sbjct: 383 FNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALA 442

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++ VSSG A+ FN+ +N+V + G  +W+ I I ++ F++ ++ +G+ R    + A   P+
Sbjct: 443 FLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPW 502

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKI 573
             Y+++ + + I  I+ FT F   +F+  +F+  YI + +F   +  ++   + K+
Sbjct: 503 LAYYAIFFMIIIIIIQGFTAF-APTFNGSDFVAAYISVFLFFFLWVSFQLYFRCKL 557

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  296 bits (757), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 166/510 (32%), Positives = 277/510 (54%), Gaps = 14/510 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K++L  RH++M                     +GP    IAY F+G +V+    ++GEM
Sbjct: 60  VKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGEM 119

Query: 159 ASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A++IP+   FT ++ R++ PALG A GY Y F + +    +L+    +IQ+W     V  
Sbjct: 120 ATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFW--TFAVPL 177

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             WI+IF V++ I N+  V+ +GE EFW++  K                        +GF
Sbjct: 178 PAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAG-KTGPVGF 236

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW++PG +     + + +  +F+ + S  + A F + G EL GI A EA NPR++VP+A
Sbjct: 237 RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKA 296

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
           ++  V+RI++FY++++F +G+ V Y+D +L             PF++AI+NSG ++LPHI
Sbjct: 297 IRKVVFRILVFYILSLFFIGLLVPYDDVKL---KSENSYVSSSPFIIAIENSGTKILPHI 353

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
           FN  +L+ + SA NS++Y+GSR L+ LA +G  P +F +TT  G+P +++    LF  LA
Sbjct: 354 FNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALA 413

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           +M  S+G  + F + +NVV + G  SW+ I   +I FM+ ++ +G+ R+   + A F PY
Sbjct: 414 FMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPY 473

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KS 576
             Y++    + I F + FT F    FD  NF   YI + +F IF+  ++   K + V K 
Sbjct: 474 LAYYATIVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKL 532

Query: 577 HEVDLFTGKEVFDQQEIEGKILDQEKQIRL 606
            ++D+       D++EIE ++        L
Sbjct: 533 VDIDIDK-----DRREIEDRVWQDTTPANL 557

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  293 bits (750), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 173/510 (33%), Positives = 270/510 (52%), Gaps = 14/510 (2%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           H   +K+ L+ RH+ M                     AGP    I+Y F+G LV+    +
Sbjct: 69  HDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQS 128

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GEMA++IP+   FT +A R++ P++G A GY Y F + +    +L+    VIQYW    
Sbjct: 129 LGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTY-- 186

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            V    WI+IF VVI   N+  VK++GE EFW++  K                       
Sbjct: 187 AVPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTGP 246

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +GFRYW++PG + P   + D +  +F+ +VS  +   F Y G EL GI A EA NPRK+
Sbjct: 247 -VGFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKA 305

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           VPRA+K  V+RI+ FY+ ++F +G+ V YND  L             PF++AI+NSG  V
Sbjct: 306 VPRAIKKVVFRILFFYIGSLFFIGLLVPYNDDAL---NNTDSYVASSPFIIAIKNSGTPV 362

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LPHIFNA +   + SA NS++YVGSR L+ L+ +  AP I  RTT  G+P  ++ V  + 
Sbjct: 363 LPHIFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVV 422

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
             LAYM  S+G    FN+ +N+ ++ G  +W+ I +++I FM+A+K +G+ R    + A 
Sbjct: 423 GALAYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAA 482

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKI 573
             P   Y++      I  I+ FT F    F   +F   YI + +F+  +  ++ I + + 
Sbjct: 483 LMPGLAYYASFLMFVIIIIQGFTAF-APKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRF 541

Query: 574 V-KSHEVDLFTGKEVFDQQEIEGKILDQEK 602
           + K  +VD+ T     D+++IE  + +  +
Sbjct: 542 IHKVEDVDIDT-----DRRDIEAVVWEDAE 566

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  290 bits (743), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 169/529 (31%), Positives = 271/529 (51%), Gaps = 22/529 (4%)

Query: 97  DGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIG 156
           + L K LQ+RH+ +                      G A + +++  +  +V+  M ++ 
Sbjct: 44  NTLHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLA 103

Query: 157 EMASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTV 215
           EM  Y+P  G      SRYVDP+LGFA G+ Y + Y IL   +L+AA+ V+ YW   + V
Sbjct: 104 EMICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYW--DNPV 161

Query: 216 NPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRL 275
               WITIFLVV+V +N   VK++GE EFW +S K                   P+HDR 
Sbjct: 162 PMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRT 221

Query: 276 GFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAAEAYNPRKSV 334
           GFRYW++PG F        GS G+F+      + + FA+ L  EL GI   EA + R++ 
Sbjct: 222 GFRYWKNPGPFA--MSLAPGSTGRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNT 279

Query: 335 PRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXX-XXXXPFVVAIQNSGIRV 393
            +A +  ++RI+ FY+    ++G+ ++  DP+L+             PFV  I N+GI V
Sbjct: 280 EKASRRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPV 339

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           L H+ N  +L   +SA NS +Y  +R + +LA +G AP    +   +G+P+ ++ VC L 
Sbjct: 340 LDHVINVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLV 399

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
           A LAY+NV + SA VF +  N+ +I G + W  + I +I F R +    + +S+  Y  P
Sbjct: 400 ACLAYLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRFRRGIVFNNL-QSRIPYQGP 458

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK- 572
            QPY  Y+     V +     F VFL   ++  +F+  Y+ LP++++ Y G+K   +T+ 
Sbjct: 459 LQPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRW 518

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFL 621
            +   ++D+ TG     + E E K+       R+ +N      ++EKFL
Sbjct: 519 YIPVEQIDVITG---LVEAEEESKMTPP----RIPKN------LWEKFL 554

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  288 bits (738), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 175/517 (33%), Positives = 275/517 (53%), Gaps = 14/517 (2%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           H   +K+ L+ RHVSM                     +GP    IAY F+G +V+F   +
Sbjct: 69  HETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQS 128

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GEMA++IP+    T ++ R++ PA G A GY Y F + I    +L+    +I YW   D
Sbjct: 129 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINYW--TD 186

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            V    WI IF V++   N   VK++GEFEF ++S K                       
Sbjct: 187 AVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGGS-SQG 245

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +GFRYW++PG +   + A + +  +F+ +V   V A F Y G EL GI A EA NPRK+
Sbjct: 246 PIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEASNPRKT 305

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           VP+A+    +RI++FY+ ++F +G+ V YN P+L             PFV++IQN+G +V
Sbjct: 306 VPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQL---ESNSAVIASSPFVISIQNAGTKV 362

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP IFNA VL+ + SA NS++YVGSR LYSLA+ G AP  F   T  G+P+  +    L 
Sbjct: 363 LPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTALL 422

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LLA++  +  +   FN+ +N+ ++ GL +W  I + +I FM+ +K++G+ R    + A 
Sbjct: 423 GLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFKAK 482

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK- 572
             P+G Y++  +   I FI+ FT F    FD   F T YI L + V+ +   +   + + 
Sbjct: 483 LMPWGAYYAAFFVGLIVFIQGFTAF-APRFDVSEFFTAYISLILLVVLFILCQLYYRCRF 541

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609
           + K  ++D+ +     D++EI+  I + ++   L E 
Sbjct: 542 LTKIEDIDIDS-----DRREIDAIIWEDDEPKNLWEK 573

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  288 bits (736), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 178/545 (32%), Positives = 272/545 (49%), Gaps = 20/545 (3%)

Query: 49  LDNMGDYSKDYYEKSQYQ--QQNLDIEXXXXXXXXXXXXXXXXXXXPKHTDGLKKNLQAR 106
           +  +GD S +  EK + +  ++++D E                    K    LK+ L+ R
Sbjct: 1   MSEIGDESTNSQEKVKPKIYEEDVDEEHDIVSVEETVKRGVLHNDRTK----LKQGLKER 56

Query: 107 HVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMASYIPMDG 166
           H+ M                      GP  + IAY FVGI+V     AI E+AS++P  G
Sbjct: 57  HIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATG 116

Query: 167 FT-SYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFL 225
            T  +A +++D ++GF  G+  +  Y  L P +L+A +++++YW D   V+P V+IT+F 
Sbjct: 117 ATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD---VSPAVFITVFG 171

Query: 226 VVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYWQHPGA 285
           ++ V+ N+  ++F+GE E+     K                      +RLGF YW+ PG 
Sbjct: 172 ILFVVTNIYTIRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKGQERLGFHYWREPGP 231

Query: 286 FKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRI 345
           F  Y   + G +GKFV F +     +++Y GI+   I+A E  N R ++    K    RI
Sbjct: 232 FANY--LVGGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFLRI 289

Query: 346 VIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIFNACVLIF 405
           ++ YLVT+F+L + V YND  +             PFV+A+  +GI+VLPHI NA +L  
Sbjct: 290 IVLYLVTVFILTLIVPYNDKLI---ATGTGTARSSPFVIAMNRAGIKVLPHIVNALILTS 346

Query: 406 VFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGS 465
            +SA N  +  GSR+L+ LA   +AP IF RT+  G+P+  +     F  LAYM+ S  S
Sbjct: 347 AWSAGNLAIIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISSFLPLAYMSCSKSS 406

Query: 466 AQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAW 525
           A VF +F  +VS   LL WI I   +I   RA+K QG  RS   YS P  P+  +FS   
Sbjct: 407 ATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYSTPMGPFAAWFSGIM 466

Query: 526 CVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHEVDLFTGK 585
                    F  F+   FD ++F T Y  +P+ +  +  +K  KKTK ++ HEVDL   +
Sbjct: 467 SFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTKYLRPHEVDL---E 523

Query: 586 EVFDQ 590
            +FD 
Sbjct: 524 SIFDD 528

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  288 bits (736), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 162/539 (30%), Positives = 281/539 (52%), Gaps = 20/539 (3%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
             + LK+ L ARH+ +                      GPA +  +Y  +  +V+  M  
Sbjct: 98  RKNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYPIMNV 157

Query: 155 IGEMASYIPMDGFTSYAS------RYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQY 208
           +GEM  Y+P DG  S  S      RY+D +L FA G+ Y + +++L   + TAAS V++Y
Sbjct: 158 LGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASGVVEY 217

Query: 209 WIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXX 268
           W     V    WI +F ++I  +N+  V+ +GE EFW +  K                  
Sbjct: 218 W--TKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFILFWGG 275

Query: 269 XPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAAEA 327
            P+HDRLGFRYW  PG+F   +   +GS G F+      +   F++ LG EL  + ++E 
Sbjct: 276 GPNHDRLGFRYWITPGSFA--NTITNGSFGNFLDVYKGIILGAFSFILGPELVVLPSSEC 333

Query: 328 YNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRL-LXXXXXXXXXXXXPFVVAI 386
            +PR+++ +A K  +WR++ FY++    + + V+YNDP L              PFV+ I
Sbjct: 334 SDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAGSSPFVIGI 393

Query: 387 QNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYS 446
           QN+GI VLPHI N C+LI  +S+ N+ L+  SRSL ++A++ +AP    +   +G+P+ +
Sbjct: 394 QNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRFGVPYVA 453

Query: 447 LGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRS 506
           + V ++ + +AY+N S  ++ VF +F N+ +I G L WI + +TY+ F +A++  G+ + 
Sbjct: 454 VIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAIEYHGM-KD 512

Query: 507 KFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYK 566
           +  Y+   QPY   +SL   + I     F + +  +++  +FI  Y+ LP+F++ + G+K
Sbjct: 513 RLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLMIWIGHK 572

Query: 567 FIKKTKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625
           F K       +   +FT +  +  Q  +  ++   ++I +   KF  E++  + +G  F
Sbjct: 573 FYK-------YRFKIFTRQCRWWYQVEDIDVITGLEEIEMESEKFESEYVKPETVGGKF 624

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  287 bits (735), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 173/523 (33%), Positives = 267/523 (51%), Gaps = 17/523 (3%)

Query: 100 KKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA 159
           ++ L  R VSM                      GP S+ IA+    ++       +  M 
Sbjct: 118 RRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSVVFIGLSKCMCVMV 177

Query: 160 SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
           +Y+P+ G F  +  R+VD + GFAVG+ Y          ++TA  LV++YW D+  +   
Sbjct: 178 TYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWTDK--IPKA 235

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
             I++ +++   +N+  V FFGE EF+LS  K                   P H  LGF+
Sbjct: 236 ALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHTVLGFK 295

Query: 279 YWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAV 338
            W +PGAF  Y    DGSVG+F  F+S  V+AL+ + G++  G  A+EA NPRK +P + 
Sbjct: 296 NWSNPGAFAEYIS--DGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKVIPSSF 353

Query: 339 KLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGIRVLPHI 397
           +    R++IFY+     +G+ + YNDP ++             P+V A++  GIRVLPHI
Sbjct: 354 RKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIRVLPHI 413

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +L  + SA NS LY  SR L+ LA+D +AP IFK TT  G+P Y     ++   LA
Sbjct: 414 VNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLVICGLA 473

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           Y++VS+ +  V  +F+NV +    + +I I ++Y+ F +    Q VD     Y +   PY
Sbjct: 474 YLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYSSSLPY 533

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSH 577
             + SL W V +  +  +TVFL  S+D ++F+  Y  +P F++F FG+K  K TK V+  
Sbjct: 534 LAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYKGTKSVRPL 593

Query: 578 EVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKF 620
           E+DLFTG E         ++ D+++     EN  +L W    F
Sbjct: 594 EMDLFTGIE---------ELADEDRY--WAENPPTLNWFDRAF 625

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  283 bits (725), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 176/516 (34%), Positives = 263/516 (50%), Gaps = 16/516 (3%)

Query: 95  HTD--GLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTM 152
           H D   LK+ L+ RH+ M                      GP  + IAY FVGI+V    
Sbjct: 38  HNDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQ 97

Query: 153 AAIGEMASYIPMDGFT-SYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
            AI E+AS++P  G T  +A +++D ++GF  G+  +  Y  L P +L+A +++++YW D
Sbjct: 98  IAIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD 155

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
              ++P V+ITIF V+ V+ N+  ++F+GE E+     K                     
Sbjct: 156 ---ISPAVFITIFGVLFVVTNIYTIRFYGEVEYVFGWLKLILIFILIISGLVIDLGGVKG 212

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
            +RLGF YW+ PG F  Y   + GS+GKFV F S     +++Y GI+   I+A E  N R
Sbjct: 213 QERLGFHYWRDPGPFAEY--IVGGSIGKFVGFWSALSSVVYSYSGIQNIAILAGETKNSR 270

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
            ++    K    RI++ YLVT+F+L + V YND  +             PFV+A+  +GI
Sbjct: 271 HAIYHGAKNVFLRIIVLYLVTVFVLTLIVPYNDALI---ASGTGTAKSSPFVIAMNRAGI 327

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           +VLPHI NA VL   +SA N  +  GSR+L+ LA   +AP IF +T+  G+P+  +    
Sbjct: 328 KVLPHIVNALVLTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFIS 387

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
            F  LAYM+ S  S+ VF +F  +VS   LL WI I   +I   RA+K QG  RS   YS
Sbjct: 388 CFLPLAYMSCSESSSTVFGWFQELVSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYS 447

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT 571
            P  PY  +FS            F  F+   FD ++F T Y  +P+ +  +  +K  KKT
Sbjct: 448 TPIAPYAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKT 507

Query: 572 KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607
           + ++  EVDL     +FD      + +++ K I  R
Sbjct: 508 RYLRPEEVDL---ASIFDDIRENPEHIEKSKPIWAR 540

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  281 bits (719), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 164/510 (32%), Positives = 264/510 (51%), Gaps = 15/510 (2%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
               G+ + L++RHV +                      GPA + IAY+ + + V+  M 
Sbjct: 46  SQKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGALSICGPAPLLIAYAVMSLFVWSVMN 105

Query: 154 AIGEMASYIPMDGFTSYASR---YVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWI 210
            + EM + IP+ G ++  S    YV+  L F  G+   +   ++ P ++TA +L++QYW 
Sbjct: 106 QMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQAMIAPAEVTACALLVQYWT 165

Query: 211 DRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 270
           D    NP ++I+IFLV+ V I +  VK FGE EFW+SS K                   P
Sbjct: 166 D---ANPAIFISIFLVLSVAITMLPVKVFGESEFWVSSIKILTIVGLIIVGVVIFFGGGP 222

Query: 271 DHDR-LGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGI-ELTGIVAAEAY 328
             +  LGF YW+ PGAFKPY   ++G  GKF+AF +  + + F+++ + E+    AAEA 
Sbjct: 223 AQEHVLGFHYWKKPGAFKPY--LVEGGTGKFLAFWTAIIKSGFSFVLVPEIVSSCAAEAV 280

Query: 329 NPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLL-XXXXXXXXXXXXPFVVAIQ 387
            PR+++PRA K  ++R+ +FY+  I ++G+ V Y++ RLL             PFV+ I+
Sbjct: 281 APRRNMPRACKRFIYRLALFYVFGILVVGVIVGYDNDRLLNAIASGQSSAAASPFVIGIK 340

Query: 388 NSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSL 447
            +GIRVLPHI NA +L   +S     LY  SR+L+S+A  G AP I      +G+P+Y  
Sbjct: 341 EAGIRVLPHIINAAILTSAYSCGTGLLYGASRTLHSMACKGDAPRILTTVNKYGVPYYCT 400

Query: 448 GVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSK 507
           G+  LF LLAY+N S+ S+ VFN+  N+ +I G +SW+ + I YI F   + V  ++  +
Sbjct: 401 GITSLFCLLAYLNCSNSSSVVFNWLSNIATISGFVSWVLVSIAYIRFRNVIDVLKLN-DR 459

Query: 508 FAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKF 567
             +  P+Q    Y ++ +   +     F VF+  ++D  NF   YI L   ++ + G   
Sbjct: 460 IPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDTSNFFAAYITLGFVLVLFVGSTI 519

Query: 568 IKK---TKIVKSHEVDLFTGKEVFDQQEIE 594
             K    + +   E D+     + + +E E
Sbjct: 520 YYKEWRCRDIAEIEQDILPKITLAEAEEYE 549

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  276 bits (707), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 166/553 (30%), Positives = 279/553 (50%), Gaps = 43/553 (7%)

Query: 53  GDYSKDYYEKSQYQQQNLDIEXXXXXXXXXXXXXXXXXXXPKHTDGLKKNLQARHVSMXX 112
           G++ +D+ E+  YQ+  +                             K+ L+ARH+SM  
Sbjct: 38  GEFPEDHTEEGDYQETEV-----------------------------KRALKARHISMIA 68

Query: 113 XXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMASYIPM-DGFTSYA 171
                              AGP    +AY F+G +V+    ++GEMA++IP+    T ++
Sbjct: 69  LGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQSLGEMATFIPVTSSVTVFS 128

Query: 172 SRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVII 231
            R++ PA G A GY Y F + I    +L+    +IQYW DR  V    WI IF V++ ++
Sbjct: 129 KRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTDR--VPIAAWIVIFWVLVTLV 186

Query: 232 NVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYWQH-PGAFKPYS 290
           N   V+F+GE EFW++S K                        +G       P      S
Sbjct: 187 NFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGS-KQGPIGLPATGGIPARGARAS 245

Query: 291 DAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYL 350
                    F+ +VS  + A F Y G EL GI A E+ NPRK+VP+A+    +RI+ FY+
Sbjct: 246 SRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPRKNVPKAINKVFFRILFFYI 305

Query: 351 VTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIFNACVLIFVFSAC 410
            ++  +G+ V Y+DPRL             PFV++I+N+G ++LP IFNA VLI V SA 
Sbjct: 306 GSLLFVGLLVPYDDPRL--NSESSTDVNASPFVISIKNAGTKILPDIFNAVVLITVISAA 363

Query: 411 NSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFN 470
           NS++Y+GSR  YSLA+ G AP      T  G+P++ + +  L  L++++ ++  ++  F+
Sbjct: 364 NSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNHNASTAFD 423

Query: 471 YFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIA 530
           + VN+ ++ GL +W+ I + +I FM+ +K +G+ R    + A F P+  Y++  +   I 
Sbjct: 424 WLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYATFFVTVII 483

Query: 531 FIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHE-VDLFTGKEVFD 589
           FI+ +T F    FD   F T YI L + ++ + G +   K + + + E +D+ +     D
Sbjct: 484 FIQGYTAFT-PKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLWAVEDIDIDS-----D 537

Query: 590 QQEIEGKILDQEK 602
           ++EI+  + ++++
Sbjct: 538 RREIDAIVWEEDE 550

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  275 bits (702), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 165/490 (33%), Positives = 253/490 (51%), Gaps = 14/490 (2%)

Query: 95  HTD--GLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTM 152
           H D   LK+ L+ARH+ M                      GP  M IAY  VGI+V    
Sbjct: 40  HNDRTKLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQ 99

Query: 153 AAIGEMASYIPMDGFT-SYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
            AI E+AS++P  G T  ++ +++D A+GF  G+  +  Y  L P +L+A ++V+ YW D
Sbjct: 100 IAIAEVASFMPATGATIRHSEQFIDEAVGFTFGW--ISTYSSLMPGELSATAVVMTYWTD 157

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
              ++P ++ITIF V+ ++ N+  ++F+GE E++    K                     
Sbjct: 158 ---LSPAIFITIFGVLFILTNIYTIRFYGEIEYFFGWLKLALIAILIITGLVIDLGGT-K 213

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
            +RLGF YW++PG F  Y   + G  GKFV F +     +++Y GI+   I+A E  N R
Sbjct: 214 QERLGFHYWRNPGPFAEY--LVGGDTGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSR 271

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
            ++    K    RI++ YL+T+F+L + V YND  +             PFV+A++ +GI
Sbjct: 272 HAIFHGAKNVFVRIILLYLITVFVLTLIVPYNDKLI---ATGSGNARSSPFVIAMERAGI 328

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           +VLPHI NA +L   +SA N  +  GSR+L+ LA   +AP IF +T+  G+P   +    
Sbjct: 329 KVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGVLFIS 388

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
            F  LAYM+ S  SA VF++F  +VS   LL WI I   +I   RA++ QG  R    YS
Sbjct: 389 SFLPLAYMSCSESSATVFSWFQELVSSNTLLRWILISANHIHMDRALRAQGYSRKDLPYS 448

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT 571
               PY  +FS            F  F+  +FD ++F + Y  +P+ +  +  +K  KKT
Sbjct: 449 TTIAPYAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSRYFIIPLAIALFTFWKLFKKT 508

Query: 572 KIVKSHEVDL 581
           + ++ HEVDL
Sbjct: 509 RYLRPHEVDL 518

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  275 bits (703), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 164/527 (31%), Positives = 275/527 (52%), Gaps = 28/527 (5%)

Query: 96  TDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAI 155
           +  LK  LQ+RH+ +                      GPA++ I+Y  +  +V+  M   
Sbjct: 53  SRNLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMF 112

Query: 156 GEMASYIPMD-------GFTSY-ASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQ 207
           GEM  Y+P +       G+ +Y  S+YVD +LGFA  + Y + +++L   + TAAS +++
Sbjct: 113 GEMVCYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVE 172

Query: 208 YWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXX 267
           YW  +  +   V I +FL VI ++N   VKF+GE EFW +  K                 
Sbjct: 173 YWTSK--IPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCG 230

Query: 268 XXP---DHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIV 323
             P   D+  +GF YW++P +F+ Y    +GS+G F+   +  +   FA+ LG EL  + 
Sbjct: 231 GAPNNEDNSFVGFHYWKNPSSFRDY--VTNGSLGNFLDVYNALIKGAFAFILGPELVSLT 288

Query: 324 AAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPF 382
           ++E  + R+++ +A +  V+R++ FY+     + + V YNDP LL             PF
Sbjct: 289 SSECVDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPF 348

Query: 383 VVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGL 442
           V+ IQN+GI +LPHI N C+L    SA N+ L+  +R+L ++  +G AP IF R    G+
Sbjct: 349 VIGIQNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGV 408

Query: 443 PHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQG 502
           P+ +L + ++ A LA++N S+ SA+VF +F N+ +I G + W    I Y+ F R +   G
Sbjct: 409 PYVALSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNG 468

Query: 503 V-DRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIF 561
           + DR  F      Q Y T++S  +   +     +   +   ++Y++FI  YI LPVF++ 
Sbjct: 469 LYDRLPFKTKG--QVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVL 526

Query: 562 YFGY-----KFIKKTKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQ 603
           YFG+     ++ ++       E+D+ TG E   + E++ KI D+E+Q
Sbjct: 527 YFGHIIYSGRWRQRKWWKPVDEIDVVTGLE---EIELKTKIADEERQ 570

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  276 bits (705), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 186/648 (28%), Positives = 300/648 (46%), Gaps = 54/648 (8%)

Query: 2   AESIQSTDISHTRIEIDNIAVQQKGLDSSQDG-------GIKFVDQTNY---NIYGNLDN 51
           ++S  S +   +  E+ NI   +KG D+   G        +++ D+ N    NI   L +
Sbjct: 12  SQSPDSEEADVSNYELHNIDDSKKGYDNLGSGSRGATTSAVEYFDKENVDGVNIDEKLQS 71

Query: 52  MGDYSKDYY---------------EKSQYQQQNL--DIEXXXXXXXXXXXXXXXXXXXPK 94
             ++  D                 E+   QQ NL  D+E                     
Sbjct: 72  TTEFGGDEMPRGNIRRFIDSFKRAEQQPNQQHNLAEDLENDLTTAISMNSLDRVQNKPTG 131

Query: 95  H------TDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILV 148
           +       + LKK+++ RHV M                     AGPA + I Y+ +G  +
Sbjct: 132 NGQMKFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCI 191

Query: 149 FFTMAAIGEMASYIP--MDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVI 206
           +  + A GEMA      + GF +Y S  VDP  GFAV + Y  ++L +CP +L   SL I
Sbjct: 192 YCIIQAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTI 251

Query: 207 QYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXX 266
           +YW    TVNP  ++ IF VVI+ I + G + + E EF+ +  K                
Sbjct: 252 KYWTT--TVNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINA 309

Query: 267 XXXPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAE 326
               +   LG +YW  PGAF+  +      + +F   ++ FV A FA+   E   + AAE
Sbjct: 310 GGAGNDGYLGAKYWHDPGAFRGTN-----GIQRFKGIMATFVSAAFAFGATEFIALTAAE 364

Query: 327 AYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAI 386
             NPRK++P A K  ++R++  ++ TI LLG  V ++  +L+            P+V+AI
Sbjct: 365 QSNPRKAIPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKAS--PYVLAI 422

Query: 387 QNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYS 446
              G+RV+PH  NA +LI VFS  NS  Y  SR L  LA  G AP  F      G P  +
Sbjct: 423 SIHGVRVVPHFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRA 482

Query: 447 LGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRS 506
           +    LF ++A+   S    QVF + + +  +  L +WI I +++I F RA+ VQG    
Sbjct: 483 MCCAALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLG 542

Query: 507 KFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLG-----HSFDYKNFITGYIGLPVFVIF 561
           +  + A    YG+Y++    V +A I  F V +         D + F   Y+ +P+ + F
Sbjct: 543 EIGFKAQLGVYGSYYATIMMV-LALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAF 601

Query: 562 YFGYKFIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607
           YFGYK  K+     +++ ++DL + ++VFD++ ++ +  D+E + +L+
Sbjct: 602 YFGYKLWKRDWRLFIRAKDIDLDSYRQVFDEELLKQE--DEEYKEKLK 647

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  273 bits (697), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 166/519 (31%), Positives = 273/519 (52%), Gaps = 17/519 (3%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           +   L KNL  RH+                        GPAS+ + +  +   +F  + +
Sbjct: 39  NNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINS 98

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GE+A+  P+  GF  Y +R+VDP++GFAV   YL ++L+L P +L AASL I+YW   D
Sbjct: 99  LGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYW--ND 156

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            +N   W+ IF V IV+ N+  VK FGE EF LS  K                   P   
Sbjct: 157 KINSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGG 216

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            LGF+YW +PGAF   ++A      KF    SVFV A F++ GIE+  + AAE+ NPRK 
Sbjct: 217 YLGFKYWNNPGAFVGGTNA-----SKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKV 271

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P+A K T W +   Y+V + L+G  V YND RLL            P V+AI+N GI+ 
Sbjct: 272 IPKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAAS-PLVIAIENGGIKG 330

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP + NA +LI + S  NS +Y  SR + S+A  G  P +  +    G P  +L V ++F
Sbjct: 331 LPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIF 390

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LL+++  S    +VF +   +  +  +  W+ I  + I F RA++VQ     +  Y + 
Sbjct: 391 GLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQ 450

Query: 514 FQPYGTYFSLAWCVFIAFIKNF--TVF-LGHSF-DYKNFITGYIGLPVFVIFYFGYK--F 567
              +G ++ +   +F+  + +F  ++F LG +  D ++F   ++ LP+ ++ YFG+K  F
Sbjct: 451 TGIWGAWYGVL-VLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYF 509

Query: 568 IKKTKI-VKSHEVDLFTGKEVFDQQEIEGKILDQEKQIR 605
            +  ++ + + E+D+ +G+++ D++ ++ +  ++EK + 
Sbjct: 510 ARNWRLQIGAEEMDIDSGRKIIDEEGLKQEREEEEKAMN 548

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  273 bits (699), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 171/512 (33%), Positives = 266/512 (51%), Gaps = 16/512 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK  L+ RH+ M                     AGPA + I +     +++  + A+GE+
Sbjct: 95  LKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGEL 154

Query: 159 ASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+ G FT+YA+R++D + GFA  + Y  ++L   P ++ +AS+ + YW   +    
Sbjct: 155 AVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRD 214

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G ++ +F +VIVIIN+ GV+ FGE EF  S+ K                   P+   +G 
Sbjct: 215 G-FVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGG 273

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW +PGAF       D +  +F    SVFV A F++ G EL GI AAEA NPRKSVPRA
Sbjct: 274 RYWHNPGAF-----VGDNAGTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPRA 328

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K  VWRIV+FY+ ++ ++G+ V Y DPRL+            PFV+AI   GIR LP +
Sbjct: 329 AKQVVWRIVLFYMGSLIMIGLLVPYTDPRLI--GASSVDASASPFVIAIVTHGIRGLPSV 386

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +LI V S  NS ++ GSR++ +L+  G  P IF      G P   + V   F L+A
Sbjct: 387 INVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIA 446

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S    +VF + + +  +  L +W  I + +I F  A+K QG   ++  + +P    
Sbjct: 447 FIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGII 506

Query: 518 GTYFSLAWCVFIAFIKNFTVFL---GHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT--K 572
           G+ + L + + + FI  F V L   G     + F   Y+  P+ + FYFG+K  KK    
Sbjct: 507 GSSWGL-FMLLLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHKIYKKNWKL 565

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQI 604
            +K+ ++D+ TG+   D + ++ +I ++EK I
Sbjct: 566 FIKAEDMDIDTGRRETDLELLKQEI-EEEKAI 596

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  272 bits (695), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 163/510 (31%), Positives = 265/510 (51%), Gaps = 19/510 (3%)

Query: 93  PKHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTM 152
           P H   +++ L++RH+ +                      GPA + I+Y  +   V+  M
Sbjct: 55  PSHQ--MQRGLKSRHMQLIALGCAIGTGLFIGTGGALSTCGPAPLLISYIIMSFFVWTIM 112

Query: 153 AAIGEMASYIPMDGFTSY---ASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYW 209
             + EM    P+ G  S    A  Y++  L F  G+   +   ++ P+++TA++L+IQYW
Sbjct: 113 HQLTEMVVLTPIPGEASMYALARAYLNRPLSFMCGWNLFYAQAMIAPSEITASTLLIQYW 172

Query: 210 IDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 269
            D    N  ++++IF+V+ + +    VK FGE EFW+S  K                   
Sbjct: 173 TD---ANSAIFVSIFIVITIAVTALPVKVFGESEFWVSMIKLITITGLIILGVVIFFGGG 229

Query: 270 PD-HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAY-LGIELTGIVAAEA 327
           P+ H  LGF YW+HPGAFKP+     G+ GKF+A  +  + + FA+ L  E     +AEA
Sbjct: 230 PNQHHVLGFHYWKHPGAFKPHIST--GNTGKFLAVWTAIIKSGFAFILSPETLTSCSAEA 287

Query: 328 YNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXX-XXXXXXXPFVVAI 386
             PR+++PRA    VWR+++FY+    ++G+ V Y++  LL             PFV+ I
Sbjct: 288 DRPRRNMPRAANRFVWRLMLFYIGGALVVGVTVGYDNQNLLSAIASGQSNAAASPFVIGI 347

Query: 387 QNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYS 446
           +  GI+VLPHI NA +L   +SA  +++Y  SR L+S+A+ G AP IF R   +G+P+YS
Sbjct: 348 KEVGIKVLPHIINAAILTGAYSAGTAEMYGASRMLHSMALKGNAPKIFARVNRYGVPYYS 407

Query: 447 LGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGV-DR 505
           + V   F  LAY+N S+ ++QVF +  N+ +I G +SW+ + ITY+ F R +    + DR
Sbjct: 408 IIVPSCFCFLAYLNCSNSASQVFTWLTNISTISGFISWVFVSITYVRFRRVIDYLDLNDR 467

Query: 506 SKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLP-VFVIFYFG 564
            KF    PFQ    YFS  + V ++    + VF   ++   +F   YI +  V V+F  G
Sbjct: 468 IKF--RKPFQRIFAYFSGCFFVILSLTNGYAVFTKGNWSVSDFFANYITIGFVVVLFIMG 525

Query: 565 YKFIKKTKIVKSHEV--DLFTGKEVFDQQE 592
             + K+ +     E+  +L    ++ D++E
Sbjct: 526 TAYYKEWRFRDMEEIRSELIPKIDMADEEE 555

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  272 bits (696), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 171/530 (32%), Positives = 266/530 (50%), Gaps = 23/530 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L K+L  RH+                        GPAS+ +A+  V   +F  + A+GE+
Sbjct: 88  LNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNALGEL 147

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A+  P+  GF  Y +R+V+P+ GFAV   YL ++ +L P +L AAS+ I+YW   +T+N 
Sbjct: 148 AAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYW--NNTINS 205

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             W+ IF   I + N+  VK FGE EF LS  K                   P  + +G 
Sbjct: 206 DAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGEYIGG 265

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW  PGAF       D    +F    +VFV A F+Y G EL  + AAE++NPR ++P+A
Sbjct: 266 RYWNDPGAFVG-----DTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLPKA 320

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K T W I + Y+  + ++G  V YND RLL            P V+AI+N GI+ LP +
Sbjct: 321 SKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAAS-PLVIAIENGGIKGLPSL 379

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            NA +LI + S  NS +Y  SR + ++A  G  P         G P Y++   ++F LL+
Sbjct: 380 MNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGLLS 439

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S    +VF +   +  +  L  W  I +++I F +A+K Q    ++  + +    Y
Sbjct: 440 FIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSITGVY 499

Query: 518 GTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK--T 571
           G+++     +F+  I +F   L        D ++F  GY+ LP+F++ Y G+K  KK   
Sbjct: 500 GSWYGCI-VIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKKDWR 558

Query: 572 KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFL 621
             VK+ ++DL TG+     +EI+  IL QE  IRL   + + +  Y +FL
Sbjct: 559 LYVKTKDMDLDTGR-----REIDLDILKQE--IRLEREQMAQKPFYIRFL 601

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  272 bits (695), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 167/505 (33%), Positives = 258/505 (51%), Gaps = 17/505 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L+  L+ RH+ M                     AGPA + I +   G +++  + ++ E+
Sbjct: 84  LQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAEL 143

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+  GFT+YA+R++D + GFA  + Y+ ++++  P ++ AAS+ + YW        
Sbjct: 144 AIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRD 203

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G ++ +F VVIVIIN+ GV+ +GE EF  S  K                   P    +G 
Sbjct: 204 G-FVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGA 262

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW HPGAF     A D S  KF  F SVFV A F++ G EL G+ AAEA NPRK VP A
Sbjct: 263 RYWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGA 317

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K   WRI +FY++ + L+GM V Y DPRL+            PFV+AI+N GI  LP +
Sbjct: 318 AKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAAS--PFVIAIKNQGISGLPTL 375

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +LI V S  NS +Y  SR+L +LA  G  P  F      G P   + V   F L+A
Sbjct: 376 VNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIA 435

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S    +VF++ + +  +  L +W  I + +I F RA+  QG   ++ A+++P   +
Sbjct: 436 FVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVW 495

Query: 518 GTYFSLAWCVFIAFIKNFTVF--LGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT--KI 573
           G  + L  C+ +   + +     LG      +F  GY+ LP+ +  + G+K  KK     
Sbjct: 496 GAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKNWKLF 555

Query: 574 VKSHEVDLFTGKEVFD----QQEIE 594
           +K+ ++D+ TG+   D    +Q++E
Sbjct: 556 IKAEDMDIDTGRRELDLDLLRQQVE 580

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  270 bits (689), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 166/484 (34%), Positives = 254/484 (52%), Gaps = 12/484 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK+ L+ RH+ M                     AGPA MF+AY  VGI+V     AI E+
Sbjct: 50  LKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQIAIAEV 109

Query: 159 ASYIPMDGFT-SYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           AS++P  G T  +A +++D ++GF  G+  +  Y  L P +L+A ++V++YW D   +NP
Sbjct: 110 ASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVVMRYWTD---INP 164

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
            VWITIF ++ V+ N+  ++F+GE E++    K                      +RLGF
Sbjct: 165 AVWITIFGILFVLTNIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGA-KQERLGF 223

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
            YW+ PG F  Y   + G +GKFV F +     +++Y GI+   I+A E  N R ++   
Sbjct: 224 HYWREPGPFAEY--IVKGEIGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHG 281

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            +    RI++ YL+ + +L + V YND  +             P+V+AIQ + I++LPHI
Sbjct: 282 ARNVFLRIIVLYLIAVLVLTLIVPYNDKLI---ATGTGTAKSSPYVIAIQRANIKILPHI 338

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            NA +L   +SA N  +  GSR+L++LA   +AP IF  T   G+P+  +     F  L+
Sbjct: 339 INAIILTSAWSAGNLAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISAFLPLS 398

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           YM+VSS SA VF++F  +VS   LL WI I   +I   RA+K QG  RS   +S    P+
Sbjct: 399 YMSVSSSSANVFSWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHSTCLGPF 458

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSH 577
             +FS    +       F  F+   FD ++F T Y  +P+ +I +  +K  KKTK ++  
Sbjct: 459 AAWFSGIMSLIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIILFTFWKLFKKTKYLRPA 518

Query: 578 EVDL 581
           EVDL
Sbjct: 519 EVDL 522

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  272 bits (695), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 163/522 (31%), Positives = 260/522 (49%), Gaps = 20/522 (3%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
             +D LKK +Q RHV M                     AGPA + I Y  +G +++  + 
Sbjct: 111 NKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQ 170

Query: 154 AIGEMASYIP--MDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GEMA        G+ +Y S  VD   GFAV + Y  ++L +CP +L  AS+ I+YW  
Sbjct: 171 ACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 230

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
             +VNP V++ IF V+++ IN+ G + + E EF+ +  K                    +
Sbjct: 231 --SVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGN 288

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +G +YW  PGAF         S+ +F   V+  V A FA+ G E   I  AE  NPR
Sbjct: 289 DGFIGGKYWHDPGAFNGKH-----SIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPR 343

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           K+VP A K  ++RI+  +L TI LLG  V YN  +LL            P+V+A+ + G+
Sbjct: 344 KAVPGAAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKAS--PYVIAVASHGV 401

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           RV+PH  NA +L+ V S  NS  Y  +R L +L+  G AP +F      G P  ++GV  
Sbjct: 402 RVVPHFINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSA 461

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           LF ++A+   S    QVF + + +  +  L +W  I +++I F RA+KVQG    +  + 
Sbjct: 462 LFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFR 521

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYKF 567
           +    +G+ ++    + I  I  F V +        D + F   Y+ +P+ +  Y GYK 
Sbjct: 522 SQTGVWGSTYACIMMILI-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKI 580

Query: 568 IKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607
            KK     +++ ++DL + +++FD++ I+ +  D+E + RL+
Sbjct: 581 WKKDWKLFIRADKIDLISHRQIFDEELIKQE--DEEFRERLK 620

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  270 bits (689), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 161/495 (32%), Positives = 254/495 (51%), Gaps = 7/495 (1%)

Query: 100 KKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA 159
           ++ L  R VSM                      GP S+ IA+    ++       +  M 
Sbjct: 46  RRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQCMCVMV 105

Query: 160 SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
           +Y+P+ G F  +  R+VD + GF+VG+ Y          ++TA  LV+++W D+  +   
Sbjct: 106 TYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTDK--IPKA 163

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
             I+I + +   +N+  V  FGE EF+LS  K                   P H  LGF+
Sbjct: 164 ALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHKVLGFK 223

Query: 279 YWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAV 338
            W +PGAF  Y     GS GKF  F+S  ++AL+ + G++  G  A+EA NPRK +P + 
Sbjct: 224 NWSNPGAFAEYIS--KGSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKVIPSSF 281

Query: 339 KLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGIRVLPHI 397
           +    R++IFY+     +G+ V +ND  ++             P+V A++  GI VLPHI
Sbjct: 282 RKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIGVLPHI 341

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +L  + SA NS LY  SR L+ LA++G+AP +FK T   G+P Y     +L   LA
Sbjct: 342 VNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLFKITKR-GVPIYCCVAVLLVCGLA 400

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           Y++VS+ +  V  +F+NV +    + +I I I+Y+ F +  K Q +D     YS+ F PY
Sbjct: 401 YLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSSSFLPY 460

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSH 577
             + SL W V + F+  + VFL  S+D ++FI  Y  +P F++ + G+K  KKT+ VK  
Sbjct: 461 LGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTRFVKPV 520

Query: 578 EVDLFTGKEVFDQQE 592
           E+DLF+G     +++
Sbjct: 521 EMDLFSGIAELAEED 535

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  271 bits (692), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 173/527 (32%), Positives = 263/527 (49%), Gaps = 24/527 (4%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           HT  + ++L  RH+                        GPAS+ I ++ V   +F  + +
Sbjct: 82  HTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVINS 141

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GE+A+  P+  GF  Y +R+VDP+  F+V   YL ++L+L P +L AASL I+YW   D
Sbjct: 142 LGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYW--DD 199

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
           T+N   W+ IF  +I+I N+  VK FGE EF LS  K                   P   
Sbjct: 200 TINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGG 259

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +G +YW  PGAF       D +  +F    SVFV A F+Y GIE+  + AAE+ NPRK+
Sbjct: 260 YIGGKYWHDPGAFVG-----DSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKT 314

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P A K T W I   Y+  + L+G  VAYND RLL            P V+AI+N GI+ 
Sbjct: 315 IPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAAS-PLVIAIENGGIKG 373

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP + NA +LI + S  NS +Y  SR + S+A+ G  P         G P  ++   + F
Sbjct: 374 LPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFF 433

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LL+++  S    +VF +   +  +  +  W+ I I +I F +A+ VQ     +  Y + 
Sbjct: 434 GLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQ 493

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYK-FI 568
              YG+Y+  A  +F+  I +F   L    G   D + F  GY+  P+ +  Y G+K + 
Sbjct: 494 TGIYGSYYGTA-ILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYF 552

Query: 569 KKTKIVKS-HEVDLFTGKEVFDQQEIEGKILDQEKQIR---LRENKF 611
           K  +I+    E+DL TG+     +E++  IL +E +I    LR++ F
Sbjct: 553 KNWRIMTPLEEIDLLTGR-----KEVDIDILKEELKIEREALRQSSF 594

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  271 bits (692), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 168/523 (32%), Positives = 272/523 (52%), Gaps = 20/523 (3%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           + ++ LKK ++ RHV M                     AGPA++ I Y+ +G  ++  + 
Sbjct: 115 EKSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQ 174

Query: 154 AIGEMAS-YIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GE+A  Y  ++G F +Y S  VDPALGF+V + Y  ++L +CP +L  AS+ I+YW  
Sbjct: 175 AAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTT 234

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
           +  V+P V++ IF V+I+ IN  G + + E EF+ +  K                    +
Sbjct: 235 K--VDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGN 292

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              LG +YW  PGAF       D S+ +F   +  FV A FA+   E   + AAE  NPR
Sbjct: 293 DGYLGAKYWHDPGAFNG-----DKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPR 347

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           K++P A K  ++RIV  +L +I L+G  V YN  +LL            P+V+A+ + G+
Sbjct: 348 KAIPSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKAS--PYVIAVSSHGV 405

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           RV+PH  NA +L+ V S  NS  Y  SR L SLA  G AP  F      G P  ++ +  
Sbjct: 406 RVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSA 465

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           LF ++A+   S    +VF++ + +  +  L +WI I +++I F RA++VQG    +  Y 
Sbjct: 466 LFGVIAFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYL 525

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYKF 567
           +    YG+ ++ A  +F+A I  F V +        D +NF   Y+ +P+ + FYFGY+ 
Sbjct: 526 SQSGVYGSAYA-AIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRV 584

Query: 568 IKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRE 608
            K+     +++ ++DL T +++FD+  +  +  D+E + +LR 
Sbjct: 585 WKRDWKLFIRAKDIDLDTHRQIFDENILRQE--DEEYKEKLRN 625

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  270 bits (691), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 163/526 (30%), Positives = 270/526 (51%), Gaps = 20/526 (3%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           +  D L+K ++ RHV +                     AGP  + I Y+ +G  ++  + 
Sbjct: 126 EKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCIIQ 185

Query: 154 AIGEMA-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GEMA +Y  + G F +Y S  VD A GF+V + Y  ++L + P +L  AS+ IQYW  
Sbjct: 186 ACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTT 245

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
             TVN  V++ IF V+I+ INV G K + E EF+ +S K                    +
Sbjct: 246 --TVNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGN 303

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +G +YW +PGAF+      D S+ +F   +S F  A FA+   E   I A+E  NPR
Sbjct: 304 DGYIGAKYWHNPGAFRG-----DKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPR 358

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           +++P A K  ++RI+  +L +I L+G  V YN   L+            P+V+A+ + G+
Sbjct: 359 RAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKAS--PYVIAVASHGV 416

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           RV+PH  NA +L+ V S  NS  Y   R LYSL+  G AP+ F      G P  ++ +  
Sbjct: 417 RVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSA 476

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           LF+++A+   SS    VF + + +  +  L +WI I +++I F RA+KVQG    +  + 
Sbjct: 477 LFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFK 536

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYKF 567
           +    +G+ ++ A  + +A I  F V +        D +NF   Y+ +P+ ++ YFGYK 
Sbjct: 537 SQVGVWGSSYA-AIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI 595

Query: 568 IKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
            K+     +++ ++DL + ++++D + I+ +  ++E + RLR   F
Sbjct: 596 CKRDWKLFIRAKDIDLVSHRKIYDGELIKQE--EEEFKERLRNGPF 639

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  270 bits (689), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 162/524 (30%), Positives = 261/524 (49%), Gaps = 20/524 (3%)

Query: 96  TDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAI 155
           +D LKK +Q RHV M                     AGPA + I Y+ +G +++  + A 
Sbjct: 113 SDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQAC 172

Query: 156 GEMASYIP--MDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           GEMA        G+ +Y S  VD   GFAV + Y  ++L +CP +L  AS+ I+YW    
Sbjct: 173 GEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT-- 230

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
           +VNP V++ IF V+++ IN+ G + + E EF+ +  K                    +  
Sbjct: 231 SVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDG 290

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +G +YW  PGAF     AID    +F    +  V A FA+ G E   I  AE  NPRK+
Sbjct: 291 FIGGKYWHDPGAFNG-KHAID----RFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKA 345

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P A K  ++RI+  +L TI LLG  V YN  +LL            P+V+A+ + G+RV
Sbjct: 346 IPGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKAS--PYVIAVASHGVRV 403

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           +PH  NA +L+ V S  NS  Y  +R   +L+  G AP +F      G P  ++GV  LF
Sbjct: 404 VPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALF 463

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
           A++A+   S    QVF + + +  +  L +W  I ++++ F RA+KVQG    +  + + 
Sbjct: 464 AVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQ 523

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYKFIK 569
              +G+ ++    + I  I  F V +        D + F   Y+ +P+ +  Y GYK   
Sbjct: 524 TGVWGSAYACIMMILI-LIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWH 582

Query: 570 K--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
           K     +++ ++DL + +++FD++ I+ +  D+E + RLR   +
Sbjct: 583 KDWKLFIRADKIDLDSHRQIFDEELIKQE--DEEYRERLRNGPY 624

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  268 bits (685), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 169/524 (32%), Positives = 265/524 (50%), Gaps = 26/524 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L KNL  RH+                        GPAS+ I +  +   +F  + A+GEM
Sbjct: 70  LNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGEM 129

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A+  P+  GF  Y +R+VDP++GFAV   YL ++L+L P +L AAS+ I+YW   DT+N 
Sbjct: 130 AAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYW--NDTINS 187

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             W+ IF  VI   N+  VK FGE EF LS  K                   P    LG 
Sbjct: 188 DAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYLGG 247

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW +PG+F  ++        KF    SVFV A F+Y GIE+T + AAE+ +PR+++P+A
Sbjct: 248 KYWHNPGSFVGHTSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTIPKA 302

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K T W I   Y+  + L+G  V Y++PRLL            P V+AI+N GI+ LP +
Sbjct: 303 AKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASS-PLVIAIENGGIKGLPSL 361

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            NA +LI + S  NS +Y  SR + ++A  G  P + K     G P  ++   + F LL+
Sbjct: 362 MNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGLLS 421

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S   A+VF +   +  +  +  W+ I I++I F +A+K Q     +  Y +    +
Sbjct: 422 FVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTGVW 481

Query: 518 GTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYKFI--KKT 571
           G+++ +   +F+  I +F   L    G   D ++F  GY+  P+ +  Y G+K +  KK 
Sbjct: 482 GSWYGVI-VLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLVYRKKQ 540

Query: 572 KIVKSHEVDLFTGKEVFD----QQEIEGKILDQEKQIRLRENKF 611
            +V   ++D+ TG+   D    +QE+      +E+Q  L ++ F
Sbjct: 541 IVVALEDMDIDTGRRQVDLTIRRQEM------KEEQEHLAKSSF 578

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  268 bits (686), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 164/524 (31%), Positives = 260/524 (49%), Gaps = 20/524 (3%)

Query: 96  TDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAI 155
           +D LKK +Q RHV M                     AGPA + I Y+ +G +++  + A 
Sbjct: 113 SDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQAC 172

Query: 156 GEMASYIP--MDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           GEMA        G+ +Y S  VD   GFAV + Y  ++L +CP +L  AS+ I+YW    
Sbjct: 173 GEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT-- 230

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
           +VNP V++ IF V+++ IN+ G + + E EF+ +  K                    +  
Sbjct: 231 SVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDG 290

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +G +YW  PGAF     AID    +F   V+  V A FA+ G E   I  AE  NPRK+
Sbjct: 291 YIGGKYWHEPGAFNGV-HAID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKA 345

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P A K  ++RI+  +L TI ++G  V YN  +LL            P+V+AI + G+RV
Sbjct: 346 IPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKAS--PYVIAIASHGVRV 403

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
            PH  NA +L+ V S  NS  Y  +R   +L+  G AP IF      G P  ++ V  LF
Sbjct: 404 APHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALF 463

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
           A++A+   S    QVF + + +  +  L +W  I +++I F RA+KVQG    +  + + 
Sbjct: 464 AVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQ 523

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYKFIK 569
              +G+ +S    + I  I  F V +        D + F   Y+ +P+ ++ Y GYK   
Sbjct: 524 TGVWGSIYSCIMMILI-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWN 582

Query: 570 K--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
           K     +++ ++DL + +++FD++ I+ +  D E + RLR   +
Sbjct: 583 KDWKLFIRADKIDLTSHRQIFDEELIKQE--DDEYRERLRTGPY 624

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  267 bits (683), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 173/617 (28%), Positives = 290/617 (47%), Gaps = 36/617 (5%)

Query: 13  TRIEIDNIAVQQKGLDSSQDGGIKFVDQTNYNIYGNLDNMGDYSKDYYEKSQYQQQN--- 69
           T+  I  +   QK +  S +     + + N        +  +   DY EK+  Q      
Sbjct: 2   TKEHITPVGSNQKSILVSNE-----LKENNPGAVVGSSDFTNNETDYLEKTSVQNSGFEY 56

Query: 70  LDIEXXXXXXXXXXXXXXXXXXXPKHTDG----------LKKNLQARHVSMXXXXXXXXX 119
           L+ E                   P   DG          LKK +++RHV M         
Sbjct: 57  LENEGNLFRRFANSFKRAPGSNNPDKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGT 116

Query: 120 XXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA-SYIPMDG-FTSYASRYVDP 177
                        GPA + I Y+ +G  ++  + A GE+A  Y  + G F +Y S  +DP
Sbjct: 117 GMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDP 176

Query: 178 ALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVK 237
           ALGF+V + Y  ++L + P +L  AS+ I+YW    +VNP +++ IF VVI+ INV G +
Sbjct: 177 ALGFSVAWVYCLQWLCVMPLELVTASITIKYWTT--SVNPDIFVAIFYVVIITINVFGAR 234

Query: 238 FFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYWQHPGAFKPYSDAIDGSV 297
            + E EF+ ++FK                    +   +G +YW  PG+F       D  +
Sbjct: 235 GYAEAEFFFNTFKVLMISGFLILGIIVNCGGAGNDGYIGGKYWNDPGSFSG-----DKPI 289

Query: 298 GKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLG 357
             F   VS  V A FA+   E   + AAE  NPRKS+P A K  ++RI++ Y+ +I L+G
Sbjct: 290 DHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIPSAAKKILYRILVLYVGSIILIG 349

Query: 358 MCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVG 417
             V +N   L+            P+V+AI + G++V+PH+ NA +L+ V S  NS  Y  
Sbjct: 350 FLVPHNSEELMGSGGSATHAS--PYVIAIASHGVKVVPHLINAVILLSVISMGNSAFYSS 407

Query: 418 SRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVS 477
           SR L +LA  G AP+  K     G P  ++ +  +F L++++  S     VF + + +  
Sbjct: 408 SRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISSVFGLISFVAASPKEETVFTWLLAISG 467

Query: 478 IFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTV 537
           +  L +W  I +++I F RA+KVQG    +  + +    +G+Y++    + I   + +T 
Sbjct: 468 LSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTA 527

Query: 538 F--LGHS-FDYKNFITGYIGLPVFVIFYFGYKFIKK--TKIVKSHEVDLFTGKEVFDQQE 592
              +G    D + F   Y+ +P+ +  YFGYK  K+  T  + + ++DL + + +FD+  
Sbjct: 528 IAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDEDV 587

Query: 593 IEGKILDQEKQIRLREN 609
           ++ +  D E + +LR +
Sbjct: 588 LKQE--DAEYREKLRNS 602

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  266 bits (681), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 161/505 (31%), Positives = 261/505 (51%), Gaps = 20/505 (3%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           K +  L ++L  RH+                        GPAS+ IA++ +   +F  + 
Sbjct: 66  KRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFTIVN 125

Query: 154 AIGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
           A+GE+A+  P+  GF  Y +R VDP+LGFAV   YL ++ +L P +L AAS+ I+YW   
Sbjct: 126 ALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYW--N 183

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
           ++VN   W+ +F V I + ++  VK FGE EF LS  K                   P +
Sbjct: 184 NSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPKN 243

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
             +G +YW  PG+F   S        +F    SVFV A F+Y G EL G+ AAE+ NPR 
Sbjct: 244 GYIGAKYWNDPGSFVGASPG-----SQFKGLCSVFVTAAFSYSGTELVGVSAAESANPRY 298

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           ++P+A K T W I + YL+ + ++G  V ++DP+LL            P V+AI+N GI+
Sbjct: 299 TLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAAS-PLVIAIENGGIQ 357

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
            LP + NA +LI + S  NS +Y  SR + S+A  G  P IF    + G P  ++   ++
Sbjct: 358 GLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLV 417

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
           F LL+++  S+   ++F +   +  +  L  W+ I I++I F RA+  QG    +  Y +
Sbjct: 418 FGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPYLS 477

Query: 513 PFQPYGTYFSLAWCVFI--AFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYK 566
                G+++    CV I    I +F   L        D+++F  GY+ LP+F+  + G+K
Sbjct: 478 MTGVIGSWYG---CVVIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHK 534

Query: 567 FIKK--TKIVKSHEVDLFTGKEVFD 589
             K+  + +++S+++D+ TG+ + D
Sbjct: 535 LYKRNWSWMIRSNKIDVNTGRRMID 559

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  265 bits (678), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 160/515 (31%), Positives = 266/515 (51%), Gaps = 15/515 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L+++L+ RH+ M                      GPA + I +  +G++++  + ++GE+
Sbjct: 77  LQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGEL 136

Query: 159 ASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+ G FT+YA+R+VD + GFA+ Y Y+ ++L++ P ++ AAS+ + +W        
Sbjct: 137 AVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRD 196

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G ++ +F +VIVIIN  GV+ +GE EF  S  K                   P    +G 
Sbjct: 197 G-FVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGG 255

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW +PGAF       D +  +F    SVFV A F++ G EL G+ +AE  NPRK++PRA
Sbjct: 256 KYWHNPGAFSG-----DDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALPRA 310

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K   WRI++FY++++ L+G+ V +   RL+            PFV+AIQ  GI+ LP +
Sbjct: 311 AKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAAS--PFVLAIQTHGIKGLPSV 368

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +LI V S  NS +Y  SRS+ +LA  G  P IF      G P  ++    +F LL+
Sbjct: 369 INVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLS 428

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S     VFN+ + +  +  L SW  I I +I F RA+  QG    + A+ +     
Sbjct: 429 FIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIA 488

Query: 518 GTYFSLAWCVFIAFIKNFTVF---LGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT--K 572
           G+YF +   V +  I  F V    +G S + ++F + Y+  PV + FY  +K  K+    
Sbjct: 489 GSYFGVI-LVLLVLIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYIFHKIWKRNWKL 547

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607
             ++ ++D+ TG+   D + +  +I +++  +  R
Sbjct: 548 FTRAKDIDIDTGRREMDTEALRQEIAEEKMLLSTR 582

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  265 bits (676), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 163/529 (30%), Positives = 264/529 (49%), Gaps = 22/529 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK +++RHV M                      GP ++ I Y  V  + +F + A GEM
Sbjct: 66  LKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQAAGEM 125

Query: 159 ASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A   P     F +Y S ++   +GFA  + +L ++L + P +L   ++ IQYW   D++N
Sbjct: 126 AVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYW--NDSIN 183

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
             VWI IF V ++ ++V GVK +GE EF  ++ K                        +G
Sbjct: 184 ADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDGYIG 243

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW++PG+F     A   S G+F     V V A F+Y G EL  +   E  NPR+S P+
Sbjct: 244 AKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRSTPK 298

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K +++RI+I YL+T+ L+G  V +++ +L+            P+V+A    G++V+PH
Sbjct: 299 AAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHAS--PYVLAASIHGVKVVPH 356

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           I NA +LI V S  NS LY   R   SLA  G AP         G P  +L  C +  ++
Sbjct: 357 IINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACAVVGVI 416

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           A+   SS   QVF +   + ++  L +W  I +++I F  A+KVQG D ++  Y A    
Sbjct: 417 AFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTGV 476

Query: 517 YGTYFSLAWCVFIAFIKNFTVFL---GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK--T 571
           +G+ +   +CV + FI  F V L   G +   + F   Y+  P+++ FYF Y   K+  T
Sbjct: 477 WGSMWGFGFCVLV-FIAQFWVALSPPGGTISAEGFFESYLAFPLWLFFYFAYMLWKRDFT 535

Query: 572 KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKF 620
            + K  ++DL   + ++D + +  +  D+E++ ++R + F   WI  K+
Sbjct: 536 FLTKLEDIDLDAHRRIYDPEFLRQE--DEERKEKIRNSSF---WIKMKY 579

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  264 bits (675), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 151/508 (29%), Positives = 261/508 (51%), Gaps = 15/508 (2%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           K    + + L+ RH+ +                      GPA + IAY  +   V+  M 
Sbjct: 50  KPPQKIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMN 109

Query: 154 AIGEMASYIPMDG---FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWI 210
            + EM   IP+ G     S A  Y++  + F  G+   +   ++ P ++TA +L++QYW 
Sbjct: 110 QMTEMVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEITACALLVQYWT 169

Query: 211 DRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 270
           D    N  ++I+IF+VV +++ +  VK FGE EFW+SS K                   P
Sbjct: 170 D---ANSAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGP 226

Query: 271 DHDR-LGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGI-ELTGIVAAEAY 328
             D  LGF YW++PGAF P+    +G+ G+F+A  +  + + F+++ + E     +AE  
Sbjct: 227 AQDHVLGFHYWKNPGAFNPH--LAEGNTGRFLAVWTAIIKSGFSFVLVPETVTSCSAECI 284

Query: 329 NPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXX-XXXXPFVVAIQ 387
            PR+++P+A +  ++R+ IFY+V   ++G+ V +N+ RL+             PFV+ IQ
Sbjct: 285 APRRNMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQ 344

Query: 388 NSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSL 447
            +GI++LPHI NAC+L   +S     LY  SR+LYS+A+ G AP IF +   +G P+YS 
Sbjct: 345 EAGIKILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYST 404

Query: 448 GVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSK 507
           G+  LF+ LAY+N S  ++ VFN+  N+ +I G +SWI + +TYI F + +    ++  +
Sbjct: 405 GLASLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVINALDLN-DR 463

Query: 508 FAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKF 567
             +  PFQ    Y +  +   ++    + VF+  +++  +F   Y+ +   +  Y    F
Sbjct: 464 VPFRRPFQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSDFFASYVTIGFVIFLYLVGSF 523

Query: 568 IKKT---KIVKSHEVDLFTGKEVFDQQE 592
             K    +  K  EV++    ++ D++E
Sbjct: 524 YYKQWTFRDFKEIEVEILPKIDIADEEE 551

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  266 bits (679), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 160/527 (30%), Positives = 267/527 (50%), Gaps = 21/527 (3%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           ++ + LKK ++ RH+ M                     AGPA + I Y+ +G  ++  + 
Sbjct: 138 QNQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQ 197

Query: 154 AIGEMASYIP--MDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GE+A      + GF +Y S  VDPALGF+V + Y  ++L +CP +L  AS+ I+YW  
Sbjct: 198 ACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTV 257

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
           +  V+P V++ IF V+I++INV G K + E +F+ +  K                     
Sbjct: 258 K--VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGT 315

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +G RYW +PGAF+      +  + +F   V+ FV A FA+   E   + A+E  NPR
Sbjct: 316 DGYIGSRYWHNPGAFRG-----NTGIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPR 370

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           K++P A K  ++RI+  +L ++ L+G  V Y   +LL            P+V+A+ + G+
Sbjct: 371 KAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATKAS--PYVIAVASHGV 428

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           RV+PH  NA +L+ V S  N   Y  SR L SLA  G AP  F      G P  ++ V  
Sbjct: 429 RVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSS 488

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           +F ++A+   S     VF + + +  +  L +WI I +++I F RA+KVQG    +  Y 
Sbjct: 489 IFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYK 548

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYK 566
           +    +G+ +++   V +A I  F V +     G     ++F   Y+ +P+ +  Y  YK
Sbjct: 549 SQVGIWGSMYAIVMMV-LALIAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALYVFYK 607

Query: 567 FIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
             KK  T  + + ++DL T +++FD++ ++ +  D+E Q +LR   +
Sbjct: 608 VWKKDWTLFIPADKIDLVTDRQIFDEELLKQE--DEEYQEKLRNGPY 652

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  265 bits (677), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 164/522 (31%), Positives = 266/522 (50%), Gaps = 22/522 (4%)

Query: 93  PKHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTM 152
           P     LK+ ++ RHV +                     AGP  + I YS +G  ++  +
Sbjct: 111 PGENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCII 170

Query: 153 AAIGEMA---SYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYW 209
            A GE+A   S +P + F  Y +  VD A GFAV + Y  ++L +CP +L  AS+ I+YW
Sbjct: 171 QACGELAVCYSSLPSN-FNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYW 229

Query: 210 IDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXX 269
               +VNP ++++IF V+I++IN  G + + E EF+ +S K                   
Sbjct: 230 TT--SVNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGA 287

Query: 270 PDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYN 329
                +G +YW  PGAF       +  +  F   ++ F  A FA+   E   + AAE  N
Sbjct: 288 GTSGYIGAKYWHSPGAFNG-----NRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSN 342

Query: 330 PRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNS 389
           PRK++P+A K+ ++RI+  +L +I L+G  V YN P LL            P+VVA+ + 
Sbjct: 343 PRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKAS--PYVVAVASH 400

Query: 390 GIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGV 449
           G+RV+PH  NA +L+ V S  NS  Y  SR L SLA  G AP +F      G P  ++  
Sbjct: 401 GVRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVC 460

Query: 450 CVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFA 509
             LF  +A+   S    QVF + + +  +  L +W+ I I+++ F RA+KVQG    +  
Sbjct: 461 STLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIG 520

Query: 510 YSAPFQPYGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGY 565
           + +    YG+ ++ A  + +A I  F V L    G+  D +NF   Y+ +P+ ++ YFGY
Sbjct: 521 FKSQVGIYGSLYA-ATMLILALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGY 579

Query: 566 KFIKKTKI--VKSHEVDLFTGKEVFDQQEIEGKI--LDQEKQ 603
           K  K+     + +H +DL + ++VFD+  ++ ++  ++QEK+
Sbjct: 580 KIRKRDWKFWIPAHRIDLVSHRKVFDEDILKQEVAEIEQEKK 621

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  264 bits (675), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 179/612 (29%), Positives = 295/612 (48%), Gaps = 31/612 (5%)

Query: 1   MAESIQSTDISHTRIEIDNIAVQQKGLDSSQDGGIKFVDQTNYNIYGNLDNMGDYSKDYY 60
           M E + S  IS + +    +A++    + S D         N++ Y +  ++ D +K  +
Sbjct: 1   MKEEVSSAIISESSLN-GKLAIKTAVEELSPD----VESDQNHDYYKDKVHVNDPNKSRF 55

Query: 61  EKSQYQQQNLDIEXXXXXXXXXXXXXXXXXXXPKHTDGLKKNLQARHVSMXXXXXXXXXX 120
           +      + L +E                   P     LK++L+ RH+ M          
Sbjct: 56  QNFVDGFRELRMEDVDPNLTAAERAAIATASSP-----LKRHLKNRHLQMIAIGGSIGTG 110

Query: 121 XXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMASYIPMDG-FTSYASRYVDPAL 179
                       GPA++ IA+   G +V+  + A+GE+A  +P+ G + SY SR+++P+ 
Sbjct: 111 LFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGELAVALPVSGSYLSYVSRFIEPSF 170

Query: 180 GFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFF 239
           GFA+ Y YL   LI  P +L AAS+ + YW D D+     ++ +F +VIV IN+ GVK +
Sbjct: 171 GFAIAYNYLIGNLITMPLELIAASITVNYW-DVDSKYADAFVALFYIVIVGINLFGVKGY 229

Query: 240 GEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP-DHDRLGFRYWQHPGAFKPYSDAIDGSVG 298
           GE EF  S  K                   P D   +G RYW +PG F            
Sbjct: 230 GEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIGARYWYNPGGFAH---------- 279

Query: 299 KFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGM 358
            F  F ++FV + F++ G E+  + AAE  NPRK +PRA K   WRI +FY++++ L+G 
Sbjct: 280 GFKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLPRAAKQVFWRITLFYVISLTLIGC 339

Query: 359 CVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGS 418
            V Y D  L             PFV+AI  +GI+ LP + N  +LI V S  N  +Y  S
Sbjct: 340 LVPYTDKHLFAASSVDASAS--PFVIAIARAGIKGLPSVVNVVILIAVLSVGNCCVYAAS 397

Query: 419 RSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSI 478
           R++ SLA  G  P  F      G P   + +C +F LL++++ SS   +VF++ + +  +
Sbjct: 398 RAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLSFLSASSNYGEVFDWMLAISGL 457

Query: 479 FGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVF 538
                W  I + ++ F RA+ VQG    + +Y A    +G+ + +   +FI     F V 
Sbjct: 458 NSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGIWGSLYGIG-LIFIVLCFQFWVA 516

Query: 539 L---GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK--TKIVKSHEVDLFTGKEVFDQQEI 593
           L   G S +  +F + Y+ LPV + FY  +K   +  T ++KS ++D+ TG+   D + +
Sbjct: 517 LFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTRSWTFLIKSSDIDIDTGRREMDLELL 576

Query: 594 EGKILDQEKQIR 605
           + +I ++++ IR
Sbjct: 577 KQEIQEEQQYIR 588

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  264 bits (675), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 167/523 (31%), Positives = 270/523 (51%), Gaps = 16/523 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK +L+ RH+ M                      GPAS+ I +   G +++  + A+GE+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMALGEL 145

Query: 159 ASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+ G FT+YA+R++D + G+A  + Y+ ++L++ P ++ +AS+ + +W        
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G ++ +F +VIVIIN+ GVK +GE EF  S  K                   P+   +G 
Sbjct: 206 G-FVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGG 264

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW  PGAF     A D    KF    SVFV + F++ G EL G+ A+E+ +PRKSVP+A
Sbjct: 265 KYWHDPGAF-----AGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVPKA 319

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K   WRI +FY++++ ++G+ V YNDP L+            PFV+AI+  GI+ LP +
Sbjct: 320 AKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAAS--PFVIAIKTHGIKGLPTV 377

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +LI V S  NS +Y  SR++ +LA     P IF      G P   + V   F L+A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIA 437

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S     VFN+ + +  +  L +W  I I +I F +A+  QG D  + ++ +P   +
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 518 GTYFSLAWCVFIAFIKNFTVFL---GHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT--K 572
           G+Y+ L + V I FI  F V L   G S   + F   Y+  P+ V  Y G+K  K+    
Sbjct: 498 GSYWGL-FMVVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMYLGHKIYKRNWKL 556

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEW 615
            + + ++D+ TG+   D + ++ +I  +EK I   + K+   W
Sbjct: 557 FIPAEDMDIDTGRREVDLELLKQEIA-EEKAIMATKPKWYRIW 598

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  265 bits (678), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 164/523 (31%), Positives = 260/523 (49%), Gaps = 22/523 (4%)

Query: 98  GLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGE 157
            LK+ ++ RHV M                     AGPA + I YS +G +++  + A GE
Sbjct: 129 ALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQATGE 188

Query: 158 MA---SYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDT 214
           MA   S +P  G+  Y S  V+   GFA+ + Y  ++L +CP +L  ASL I+YW    +
Sbjct: 189 MAIAYSNLP-GGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTT--S 245

Query: 215 VNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 274
           VN  +++ IF  +I+IINV G K + E EF+ +  K                    +   
Sbjct: 246 VNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGY 305

Query: 275 LGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSV 334
           LG  YW  PGAF+      D S+  F       V A FAY G E   + AAE  NPR ++
Sbjct: 306 LGGLYWHTPGAFRG-----DSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPRAAI 360

Query: 335 PRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVL 394
           P A K  ++RI+  YL++I ++G  V ++  RLL            P+V+A    G+RV+
Sbjct: 361 PSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSAS--PYVLAASLHGVRVV 418

Query: 395 PHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFA 454
           PH  NA +LI V S  NS  Y  SR L SLA  G AP  F      G P  ++ +  LF 
Sbjct: 419 PHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFG 478

Query: 455 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPF 514
           ++A+   S    +VF + + +  +  L +W  I +++I F  A+KVQG    +  Y A  
Sbjct: 479 VIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQT 538

Query: 515 QPYGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYKFIKK 570
             +G++++L + +F+ +I  F V +          +NF   Y+ +P+ ++ Y GYK   K
Sbjct: 539 GVWGSWYAL-FMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYK 597

Query: 571 --TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
             T ++K+ ++DL + +++FD+  ++ +  D E + RL+   F
Sbjct: 598 DWTLLIKAEDIDLQSHRQIFDEDLLKEE--DFEYRQRLKNGPF 638

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  265 bits (676), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 161/524 (30%), Positives = 261/524 (49%), Gaps = 20/524 (3%)

Query: 96  TDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAI 155
           +  LKK +Q RHV M                     AGPA + I Y+ +G +++  + A 
Sbjct: 113 SGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQAC 172

Query: 156 GEMASYIP--MDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           GE+A        G+ +Y S  VD   GFAV + Y  ++L +CP +L  AS+ I+YW    
Sbjct: 173 GELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT-- 230

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
           +VNP V++ IF V+++ IN+ G + + E EF+ +  K                    +  
Sbjct: 231 SVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDG 290

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +G +YW  PGAF         S+ +F   V+  V A FA+ G E   I  AE  NPRK+
Sbjct: 291 FIGGKYWHDPGAFNGKH-----SIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKA 345

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P A K  ++RI+  +L TI +LG  V YN  +LL            P+V+AI + G+RV
Sbjct: 346 IPGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKAS--PYVIAIASHGVRV 403

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           +PH  NA +L+ V S  NS  Y  +R   +L+  G AP  F      G P  ++GV  LF
Sbjct: 404 VPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALF 463

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
           A++A+   S    QVF + + +  +  L +W  I  ++I F RA+KVQG    +  + + 
Sbjct: 464 AVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQ 523

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYK-FI 568
              +G+ ++    + I  I  F V +        D + F   Y+ +P+ +  Y GYK + 
Sbjct: 524 TGVWGSMYACIMMLLI-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWT 582

Query: 569 KKTKI-VKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
           K  K+ +++ ++DL + +++FD++ I+ +  D+E + RLR   +
Sbjct: 583 KDWKLFIRADKIDLESHRQIFDEELIKQE--DEEYRERLRNGPY 624

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  263 bits (673), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 174/594 (29%), Positives = 280/594 (47%), Gaps = 48/594 (8%)

Query: 19  NIAVQQKGLDSSQDGGIKFVDQTNYNIYGNLDNMGDYSKDYYEKSQYQQQNLDIEXXXXX 78
           N+  +Q+ L S  + G  F  +  +++   L  + +  KDY + +  ++   + +     
Sbjct: 7   NMDTKQQDLSSLSEVGQSFAKEETWSVEKQLKPLAE-EKDYADMNDVEKAIYNTK----- 60

Query: 79  XXXXXXXXXXXXXXPKHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMF 138
                               L K+L  RH+                        GPAS+ 
Sbjct: 61  -----------------DSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLV 103

Query: 139 IAYSFVGILVFFTMAAIGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPN 197
           IA++ +   +F  + ++GE+++  P+  GF  Y +R+V+P+ GFAV + YL ++ IL P 
Sbjct: 104 IAWTIISTCLFTIVNSLGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPL 163

Query: 198 QLTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXX 257
           +L AAS+ I+YW    ++NP  W++IF V I   N+  VK FGE EF LS  K       
Sbjct: 164 ELCAASITIRYW--NKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGF 221

Query: 258 XXXXXXXXXXXXPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGI 317
                       P    +G +YW  PGAF       D    +F    +VF+ A F+Y G+
Sbjct: 222 TILGIVLICGGGPSGGFIGGKYWNDPGAFVG-----DTPAQRFKGLSAVFITAAFSYSGL 276

Query: 318 ELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXX 377
           EL G+ AAE+ NPR ++P+A K T W I + YLV + L+G  V  NDP LL         
Sbjct: 277 ELVGVSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDP-LLLNGTSSVDA 335

Query: 378 XXXPFVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRT 437
              P V+AIQN GI+ LP + NA +LI + S  NS +Y  SR + S+A  G  P      
Sbjct: 336 AASPLVIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHV 395

Query: 438 TSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRA 497
              G P Y++ + +L  LL+++  S+   +VF +   +  +  L  W  I + ++ F  A
Sbjct: 396 DKKGRPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHA 455

Query: 498 VKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIA--FIKNFTVFL----GHSFDYKNFITG 551
           +K Q     +  Y +    +G+++    C+ I    I +F   L    G+  D  +F   
Sbjct: 456 MKHQNRSLEELPYVSMTGEWGSWYG---CIVIGLVLIASFWTSLFPAGGNGADATSFFES 512

Query: 552 YIGLPVFVIFYFGYKFIKKT--KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQ 603
           Y+ LP+F+  Y G+K  K+     +K  EVD+ +G+      + +   L QEK+
Sbjct: 513 YLSLPIFIACYLGHKIWKRNLRLYIKLSEVDVDSGR-----TDTDAATLKQEKE 561

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  263 bits (672), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 160/498 (32%), Positives = 255/498 (51%), Gaps = 16/498 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L KNL  RH+                        GPAS+ I +  +   +F  + A+GEM
Sbjct: 75  LNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINALGEM 134

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A+  P+  GF  Y +R++DP++GFAV   YL ++L+L P +L AAS+ I+YW   +T+N 
Sbjct: 135 AAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYW--NETINS 192

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             W+ IF  VI + N+  VK FGE EF LS  K                   P    +G 
Sbjct: 193 DAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGFIGG 252

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW HPG+F  ++        KF    SVFV A F+Y GIE+T + AAE+ +PR ++P+A
Sbjct: 253 KYWNHPGSFVGHNSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKA 307

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K T W I   Y+  + L+G  V Y+DPRLL            P V+AI+N GI+ LP +
Sbjct: 308 AKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASS-PLVIAIENDGIKGLPSL 366

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            NA +LI + S  NS +Y  SR + ++A  G  P I  R  + G P  ++   + F LL+
Sbjct: 367 MNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLS 426

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S   A VF +   +  +  +  W+ I +++I F +++  Q     +  + +    +
Sbjct: 427 FVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVW 486

Query: 518 GTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYK-FIKKTK 572
           G+++     +F+  + +F   L    G S D ++F  GY+  P+ +  YFG+K +++K +
Sbjct: 487 GSWYGTI-VLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKRE 545

Query: 573 -IVKSHEVDLFTGKEVFD 589
            +V   ++DL TG+   D
Sbjct: 546 FMVGLADMDLDTGRRQVD 563

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  263 bits (671), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 163/519 (31%), Positives = 263/519 (50%), Gaps = 21/519 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK++++RHV M                      GPA++ I Y  V  + +F + A GEM
Sbjct: 91  LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYFMIQAAGEM 150

Query: 159 ASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A   P     F +Y+S ++  + GFA  + Y F++L + P +L  AS+ IQ+W D+  +N
Sbjct: 151 AVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFWNDK--IN 208

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
           P ++I IF V +V I+  GVK +GE EF  +  K                    +   +G
Sbjct: 209 PDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIG 268

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
             YW +PGAF     A D S+G+F     + V A F++ G+EL  +   E  NPRKS P 
Sbjct: 269 ATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPV 323

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K +++RIV+ YL+T+ L+G  V YND +L+            P+V+A    G++++PH
Sbjct: 324 AAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHGVKIVPH 381

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           I NA +LI V S  NS LY G R + SLA  G AP         G P  +L VC +F ++
Sbjct: 382 IINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVI 441

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           A++  SS    VF +   +  +  L +W  I ++++ F +A+KVQG    +  Y A    
Sbjct: 442 AFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGI 501

Query: 517 YGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK- 570
           +G+ + + + + + F+  F V L     G   D ++F   Y+  P+++ FYFGY    + 
Sbjct: 502 WGSIYGVFFNILV-FVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRD 560

Query: 571 -TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRE 608
            T +    ++DL   + ++D + +  +  D+E + +LR 
Sbjct: 561 FTLLNPLDKIDLDFHRRIYDPELMRQE--DEENKEKLRN 597

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  262 bits (670), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 171/598 (28%), Positives = 285/598 (47%), Gaps = 42/598 (7%)

Query: 28  DSSQDGGIKFVDQTNYNIYGNLDNM-------GDYSKDYYEKSQYQQQNLDIEXXXXXXX 80
           D S++GG   +D+ N N   N +N+        DYS   Y KS  + ++           
Sbjct: 4   DISKEGGPSVIDEKNKNYISNQENVVESGASQEDYSNSSYPKSGSKWKDFK--------- 54

Query: 81  XXXXXXXXXXXXPKHTDG-----------LKKNLQARHVSMXXXXXXXXXXXXXXXXXXX 129
                       P  TD            L++ L+ RH+ M                   
Sbjct: 55  DSFKRMDSVDLDPNLTDAQKIAILTSQSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKAL 114

Query: 130 XXAGPASMFIAYSFVGILVFFTMAAIGEMASYIPMDG-FTSYASRYVDPALGFAVGYCYL 188
             AGPA + I +  +  ++     ++GEMA   P+ G +T+YA+R++D + GFA    Y+
Sbjct: 115 RTAGPAGILIGWGLMATMILCMCLSLGEMAVTFPVSGGYTTYATRFIDESYGFANNINYM 174

Query: 189 FKYLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSS 248
            + L++ P ++ AAS+ + YW  +       ++ +F + IV IN+ GVK +GE EF  S 
Sbjct: 175 MQALVVLPLEIVAASITVDYWGPKSQYR-AAFVALFWLCIVSINMFGVKGYGEAEFVFSL 233

Query: 249 FKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFV 308
            K                   P H+ +G ++W +PGAF       D +  KF    SVFV
Sbjct: 234 IKVVTVIGFIILGVILVCGGGPTHEYIGSKFWSNPGAF-----VGDTAGQKFKGICSVFV 288

Query: 309 YALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLL 368
            A F++   EL G+ AAE  +PRKSVP+A K   WRI +FY++++ ++G+ V Y DPRLL
Sbjct: 289 TAAFSFANTELVGLAAAETEDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYTDPRLL 348

Query: 369 XXXXXXXXXXXXPFVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDG 428
                       PFV+A++N GI+ LP + N  +L  V S  NS ++  SR L +L+  G
Sbjct: 349 GSSIVDAAAS--PFVLALKNHGIKGLPSVINVVILTAVLSVGNSSVFSCSRCLTALSEQG 406

Query: 429 KAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIF 488
             P +F      G P  S+     F LL ++ VS    ++F++ +++  +  L  W+ I 
Sbjct: 407 FLPNVFGYIDRKGRPLVSIIFSSAFGLLCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTIS 466

Query: 489 ITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNF--TVFLGHSF-DY 545
           + +I F +A+  Q     + A+++P   +G+Y+S+ + + +  I  F   +F GH     
Sbjct: 467 LCHIRFRKALSAQNRSIDELAFASPIGIWGSYYSV-FLIIVVLILQFWIALFPGHQKPSA 525

Query: 546 KNFITGYIGLPVFVIFYFGYKFIKKT--KIVKSHEVDLFTGKEVFDQQEIEGKILDQE 601
            NF   Y+ +P+ V  Y G+K   K    ++    +D+ TG+   D +  + ++L+Q 
Sbjct: 526 SNFFKAYLSMPIAVAMYLGHKIYTKNWKLLIDPKYMDIDTGRRELDIELFKQELLEQN 583

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  263 bits (671), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 163/528 (30%), Positives = 263/528 (49%), Gaps = 25/528 (4%)

Query: 96  TDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAI 155
            + LKK +Q RHV M                     AGPA + I Y+ +   ++  M A+
Sbjct: 96  NEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAV 155

Query: 156 GEMA-SYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           GEMA +Y+ +  GF++Y    +DP L FAV + Y  ++  +CP +L  AS+ IQYW  + 
Sbjct: 156 GEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYWTTK- 214

Query: 214 TVNPGVWITIFLVVIVIINV-AGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
            VN  +++ IF ++++ IN+  G + + E EF+ +  K                    + 
Sbjct: 215 -VNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGAGNS 273

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
             +G RYW  PGAF+      D  + +F   VS  V A FA+ G E   I A+E  NPRK
Sbjct: 274 GFIGARYWHSPGAFRG-----DNGINRFKGIVSTLVTAAFAFGGTEFLAITASEQANPRK 328

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           ++P A K  ++R +I Y+ +I ++G  V YN   LL            P+V+A+ + GIR
Sbjct: 329 AIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKAS--PYVIAVASHGIR 386

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
           V+PH  NA +LI VFS  +S  Y  SR L +LA  G AP IF      G P     V  +
Sbjct: 387 VVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGAI 446

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
            A++++   SS  A VFN+ +++  +  + +W  I +++I F RA+KVQG    +  + +
Sbjct: 447 IAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFKS 506

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYKFI 568
               +G+ ++    + +  I  F V +      S D  +F   Y+ +PVF++ YFGYK  
Sbjct: 507 QAGVWGSVYAFVMMILV-LIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYKIW 565

Query: 569 KK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQE-KQIRLRENKFSL 613
            +     +++  +DL   + ++D +     +L QE K++R R     L
Sbjct: 566 NRDWRLFIRAKNIDLIAHRHIYDPE-----LLRQERKEMRERARNAPL 608

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  261 bits (666), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 164/515 (31%), Positives = 261/515 (50%), Gaps = 15/515 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L+  L++RH+ M                     AGPA + I +S  G ++F  + A+GE+
Sbjct: 88  LQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMALGEL 147

Query: 159 ASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+ G FT+YA+R++D + GFA  + Y+ ++L++ P ++ AAS+ + YW        
Sbjct: 148 AVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVRYTD 207

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G ++ +F +V+VIIN+ GV+ +GE EF  S  K                   P    +G 
Sbjct: 208 G-FVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYVGA 266

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW +PGAF   +     S  KF  F SVFV A F++ G EL G+  +EA NPRK+VP A
Sbjct: 267 RYWHNPGAFVGST-----SGQKFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVPSA 321

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K   WRI++FY++ + L+G  V YNDPRL+            PFV+AI   GI  LP +
Sbjct: 322 AKQVFWRILLFYIICLLLIGFLVPYNDPRLI--SSSSVDASASPFVIAIVTHGISGLPSV 379

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +LI V S  NS +Y  SR+L +L+  G  P I       G P   + +   F L+A
Sbjct: 380 INVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIA 439

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S+   ++FN+ + +  +    +W  I I +I F  A+K QG    +  + +P    
Sbjct: 440 FVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPAGVI 499

Query: 518 GTYFSLAWCVFIAFIKNFTVFL---GHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK-- 572
           G+Y+ L   + +  I  F + L   G S     F + Y+  PV + FY  +K  KK    
Sbjct: 500 GSYWGLFLNILM-LIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAHKLWKKNWKF 558

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607
           ++   +VD+ TG+   D   ++ +I +++  + +R
Sbjct: 559 LIPLEDVDIDTGRRDTDVNLLKQEIAEEKAALAMR 593

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  260 bits (665), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 168/515 (32%), Positives = 267/515 (51%), Gaps = 15/515 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK  L++RH+ M                     AGPA + I ++  G +++  + A+GE+
Sbjct: 87  LKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAVGEL 146

Query: 159 ASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+ G FT+YA+R++D + GFA+ + Y+ ++LI  P ++ +AS+ + YW        
Sbjct: 147 AVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAKYRD 206

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G ++ +F V  VIIN+ GVK +GE EF  +  K                   P    +G 
Sbjct: 207 G-FVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYIGA 265

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW HPGAF       D +  KF  F +VF+ A F++ G E+ G+  +E+ NPRKSVP A
Sbjct: 266 KYWHHPGAFVG-----DTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVPGA 320

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K   WRI +FY++ + L+GM V YND RL+            PFV+A+ N GIR LP +
Sbjct: 321 AKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAAS--PFVIAVVNQGIRGLPSV 378

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +LI V S  NS +Y+ SR+L +LA  G  P I       G P  ++G+   F L+A
Sbjct: 379 INVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLIA 438

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  SS   +VFN+ + +  +  L SW  I I +I F RA+  QG    +  + +     
Sbjct: 439 FVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGIA 498

Query: 518 GTYFSLAWCVFIAFIKNFTVFL---GHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT-KI 573
           G+Y+ +  CV +  I  F V L   G S + K+F   Y+  P+ + FY  +K  KK  K+
Sbjct: 499 GSYWGIFICVLM-LIAQFYVGLFPAGASPNAKDFFMAYLSFPIVLAFYIFHKIWKKNWKL 557

Query: 574 -VKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607
            +K+ ++D+ TG+   D+  ++ ++  +   +  R
Sbjct: 558 YIKAEDMDIDTGRREVDRDLLKQEVAAERADLAAR 592

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  262 bits (670), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 159/517 (30%), Positives = 261/517 (50%), Gaps = 20/517 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L++ ++ RHV M                     AGPA + I Y  +G  ++  + A GEM
Sbjct: 159 LRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYCIIQACGEM 218

Query: 159 A-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A +Y  + G F ++ S  VDP   FAV + Y  ++L +CP +L  AS+ IQYW  +  V+
Sbjct: 219 AVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQYWTTK--VD 276

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
           P V++ IF V+I++IN  G K + E EF  ++ K                        +G
Sbjct: 277 PDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAGTDGYIG 336

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW  PGAF+  +      + +F   +  FV A FA+   E   + AAE  NPRK++P 
Sbjct: 337 AKYWNDPGAFRGQT-----KIERFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPS 391

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K  ++R+++ +L TI L+G  V Y+  +LL            P+V+AI   G+RV  H
Sbjct: 392 AAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKAS--PYVLAISLHGVRVAQH 449

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
             NA +LI V S  NS  Y  SR L SLA  G AP IF      G P  ++    + A++
Sbjct: 450 FVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCSAVIAVI 509

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           A+   S    +VF + + +  +  L +W  I ++++ F RA+KVQG    +  Y +    
Sbjct: 510 AFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGYLSQTGI 569

Query: 517 YGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK-- 570
            G+ ++ A  + +A I  F V L     H+ D  +F + Y+ +P+ ++FYFGYK  K+  
Sbjct: 570 LGSLYA-AIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKIWKRDW 628

Query: 571 TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607
              +++ ++DL + + ++D++ +  +  D+E + +LR
Sbjct: 629 RLFIRAKDIDLISHRTIYDEELLRQE--DEEYREKLR 663

>Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}
           complement(18362..20104) [1743 nt, 581 aa]
          Length = 580

 Score =  260 bits (664), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 163/507 (32%), Positives = 254/507 (50%), Gaps = 15/507 (2%)

Query: 101 KNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMAS 160
           + L  RHV +                      GPA + IA++   I +     +  EM S
Sbjct: 69  RKLLNRHVQLIAISGVIGTALFVAIGKALYHGGPAFLLIAFALWCIPILCITVSTAEMVS 128

Query: 161 YIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGV 219
           ++P+   F   AS+  D +L     + + F   +  P ++ + + +I YW  RD  N  +
Sbjct: 129 FLPVASPFLRLASKCADESLAVTASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYNAAI 186

Query: 220 WITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRY 279
            + + +V+ + I++A VK++GE EFWL+SFK                   P HDR GFRY
Sbjct: 187 PLVVQVVLYLFISIATVKYYGEMEFWLASFKIILAIGLFFFTLVTMLGGNPKHDRYGFRY 246

Query: 280 WQHPGAFKPYSDA-IDG--SVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
           W      K Y D   +G  S+G F  F++  + A F   G E   ++A E   PRK +P+
Sbjct: 247 WGEEPFKKYYPDNNTNGTDSLGYFQGFLTCLIQAAFTIAGGEYISMLAGEIKLPRKVLPK 306

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGIRVLP 395
           A K   WR+ I +L T   LG+  + NDP L              PFV+A+ N  IRVLP
Sbjct: 307 AFKQVFWRLTIIFLGTCLCLGIVCSPNDPSLTAAINEARPGAGSSPFVIAMNNLRIRVLP 366

Query: 396 HIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFAL 455
            I NA ++   FSA N+  Y  SR+LY +A+DG AP IF R   +G+P Y++GV +L+AL
Sbjct: 367 DIVNAALITSAFSAGNAYTYCSSRTLYGMALDGYAPKIFTRCNKYGVPIYAVGVSLLWAL 426

Query: 456 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQ 515
           ++ + ++S SA V N+ VN+++   L++++ + + Y+ F RA   Q        + +  Q
Sbjct: 427 ISLLQLNSNSAIVLNWLVNLITASQLINFVFLCVIYLFFRRAYNAQKDKLPPLPFRSWGQ 486

Query: 516 PYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFI---KKTK 572
           PY   F L     + FI+ +TVF+   ++ ++F+  Y+ + + V  Y GYKFI    K K
Sbjct: 487 PYTAIFGLVCAFSMIFIQGYTVFIHSLWNTRDFLFCYLMVFINVAIYLGYKFIWKRGKDK 546

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILD 599
            +  H+VD  T     D +EIE   LD
Sbjct: 547 FIDPHKVDFIT-----DLKEIEAHELD 568

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  261 bits (668), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 160/527 (30%), Positives = 264/527 (50%), Gaps = 21/527 (3%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           +  + LKK+++ RH  M                     AGP  + I Y+ +G  V+  + 
Sbjct: 140 QKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQ 199

Query: 154 AIGEMASYIP--MDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GE+A      + GF +Y    VDPALGF+V + +  ++L +CP +L  AS+ I+YW  
Sbjct: 200 ACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTT 259

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
             +VNP V++ IF V+IV+INV G K + E +F+ +  K                     
Sbjct: 260 --SVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGT 317

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +G +YW+ PGAF+      D  + +F   V+ FV A FA+   E   + A+E  NPR
Sbjct: 318 DGYIGSKYWRDPGAFRG-----DTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPR 372

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           K++P A K  ++RI+  +L ++ L+G  V Y   +LL            P+V+A+ + G+
Sbjct: 373 KAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKAS--PYVIAVSSHGV 430

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           RV+PH  NA +L+ V S  N   Y  SR L SLA  G AP  F      G P  ++ V  
Sbjct: 431 RVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSA 490

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           LF ++A+   S     VF + + +  +  L +WI I +++I F RA+KVQG    +  Y 
Sbjct: 491 LFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYK 550

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYK 566
           +    +G+ +++   V +A I  F V +     G     ++F   Y+ +P+++  Y  YK
Sbjct: 551 SQVGVWGSAYAVLMMV-LALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYK 609

Query: 567 FIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
             KK  +  + + +VDL + + +FD++ ++ +  D+E + RLR   +
Sbjct: 610 VWKKDWSLFIPADKVDLVSHRNIFDEELLKQE--DEEYKERLRNGPY 654

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  259 bits (663), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 158/509 (31%), Positives = 265/509 (52%), Gaps = 15/509 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK++L+ RH+ M                     AGPA + I ++  G +++  + A+GE+
Sbjct: 77  LKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAMGEL 136

Query: 159 ASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+ G FT+YA+R++D + G+A  + Y+ ++L++ P ++ AAS+ + YW        
Sbjct: 137 AVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 196

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G ++ +F VVIV IN+ GVK +GE EF  S  K                   P    +G 
Sbjct: 197 G-FVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYIGG 255

Query: 278 RYWQHPGAFKPYSDAIDGSVGK-FVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
             W +PGAF      +  + GK F    SVFV A F++ G EL G+ +AE  NPRKS+PR
Sbjct: 256 ANWHNPGAF------VGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPR 309

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K   WRI +FY++++ L+G+ V YND RL+            PFV+AI+N GI+ LP 
Sbjct: 310 AAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAAS--PFVLAIKNHGIKGLPS 367

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           + N  +LI V S  NS ++  SR+L +LA  G  P IF      G P   +G    F LL
Sbjct: 368 VVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLL 427

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           +++  S    +VF++ + +  +  L +W+ I I ++ F RA+  QG    + ++ +P   
Sbjct: 428 SFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPAGV 487

Query: 517 YGTYFSLAWCVFIAFIKNFTVF--LGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT--K 572
           +G+ +     + I   + +     +G   D K+F   Y+ LPV ++ Y G+K  K+    
Sbjct: 488 WGSIYGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHKCYKRNWKL 547

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQE 601
            +++  +D+ TG+   D + ++ ++ +++
Sbjct: 548 FIRAENIDIDTGRREVDIEALKVELAEEK 576

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  259 bits (663), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 162/522 (31%), Positives = 259/522 (49%), Gaps = 22/522 (4%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           +   L K+L  RH+                        GPAS+ I +  +G  +F  + +
Sbjct: 82  NNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASLVIDWVIIGTCLFTVINS 141

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GE+++  P+  GF  Y  R+V+P+  FAV   YL ++L+L P +L AAS+ I+YW D+ 
Sbjct: 142 LGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK- 200

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            +N   W+ IF   I + N+  VK FGE EF LS  K                   P   
Sbjct: 201 -INSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFSILGIVLSCGGGPHGG 259

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +G +YW++PGAF  ++        KF    SVFV A F+Y GIE+T + AAE+ NPR++
Sbjct: 260 YIGGKYWRNPGAFVGHNSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P+A K T W I   Y+  + L+G  V  NDPRLL            P V+AI+N  I+ 
Sbjct: 315 IPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGRIKG 373

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP + NA +LI V S  NS +Y  SR + ++A  G  P    R    G P  ++ + + F
Sbjct: 374 LPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFF 433

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LL+++  S+  A+VF +   +  +  +  W+ I +++I F +A+KVQ     +  + + 
Sbjct: 434 GLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQERSLDELPFISQ 493

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYKFIK 569
               G+++     +F+  I +F   L          ++F  GY+  P+ ++ YFG+K   
Sbjct: 494 TGVLGSWYGFV-VLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFPILIVCYFGHKIYT 552

Query: 570 K--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609
           +  T +VK  ++DL TG++  D        L +E+    REN
Sbjct: 553 RNWTLMVKIEDIDLDTGRKQVDLT------LRREEMKIEREN 588

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  259 bits (663), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 167/522 (31%), Positives = 263/522 (50%), Gaps = 24/522 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L K+L  RH+                        GPAS+ I +  V   +F  + ++GE+
Sbjct: 89  LNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVINSLGEL 148

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A+  P+  GF+ Y +R++DP++ F++   YL ++L+L P +L AAS+ I+YW D+  +N 
Sbjct: 149 AAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYWNDK--INS 206

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             W++IF  VI ++N+  VK FGE EF LS  K                   P    +G 
Sbjct: 207 DAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGGYIGG 266

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW  PGAF  ++        +F    SVFV A F+Y GIE+  + AAE+ +PRK++P A
Sbjct: 267 KYWHDPGAFVGHTAG-----SQFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPRKTIPVA 321

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K T W I   Y+  + L+G  V Y+DPRLL            P V+AI+N GI+ LP +
Sbjct: 322 AKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASS-PLVIAIENGGIKGLPSL 380

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            NA +LI V S  NS +Y  SR + S+A+ G  P    R    G P  +  V + F L++
Sbjct: 381 MNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFFGLIS 440

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S   A+VF +   +  +  +  W+ I I++I F RA+ +QG    +  Y +    Y
Sbjct: 441 FVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQVGVY 500

Query: 518 GTYFSLAWCV--FIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYKF-IKK 570
           G+++    C+  F+  I  F   L        +   F  GY+ LP+ +  Y G+KF  K 
Sbjct: 501 GSWYG---CIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYFKN 557

Query: 571 TKIVKS-HEVDLFTGKEVFD----QQEIEGKILDQEKQIRLR 607
            ++    +E+DL +GK   D    ++E + + L  +KQ+ LR
Sbjct: 558 WRLFTPYNEIDLDSGKRDIDLELLREEKKMEELALKKQLILR 599

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  259 bits (662), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 168/569 (29%), Positives = 273/569 (47%), Gaps = 32/569 (5%)

Query: 50  DNMGDYSKDYYEKSQYQQQNLDIEXXXXXXXXXXXXXXXXXXXPKHTDGLKKNLQARHVS 109
           DNM  Y  D   K    ++N++                         + L K+L  RH+ 
Sbjct: 53  DNMTTYVTDSKTKEGGSEKNIETTPSEQFSIAKEDI----------NENLNKDLSIRHLI 102

Query: 110 MXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMASYIPM-DGFT 168
                                  GPAS+ I +  +   +F  + A+GE+A+  P+  GF 
Sbjct: 103 TLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGELAAAYPVVGGFN 162

Query: 169 SYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVI 228
            Y +R+VDP++ FA+   YL ++L+L P +L AAS+ I+YW   DT+N   W+ IF  VI
Sbjct: 163 VYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYW--NDTINSDAWVAIFYSVI 220

Query: 229 VIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYWQHPGAF-- 286
            + N+  VK FGE EF LS  K                   P    LG  YW  PG+F  
Sbjct: 221 ALANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLGGHYWHDPGSFVG 280

Query: 287 -KPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRI 345
            KP +        +F    SVFV A F+Y GIELT + AAE+ +PRK++P+A K T W +
Sbjct: 281 DKPGT--------QFKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIPKATKRTFWLV 332

Query: 346 VIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIFNACVLIF 405
              Y+  + ++G  V ++DPRLL            P V++I+N+GI+ L  + NA +LI 
Sbjct: 333 TASYVTILTIIGCLVPFDDPRLLNGSSSVDAAAS-PLVISIKNAGIKGLDSLMNAIILIS 391

Query: 406 VFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGS 465
           + S  NS +Y  SR + S+A  G  P +  R    G P  ++   + F LL+++  S   
Sbjct: 392 IVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQ 451

Query: 466 AQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAW 525
           A+VF +   +  +  +  W+ I  ++I F  A+KVQ     +  Y +     G+++ +  
Sbjct: 452 AEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVI- 510

Query: 526 CVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYK-FIKKTKI-VKSHEV 579
            +F+  + +F   L      + D  +F  GY+ LP+ +  Y G+K +++  ++ VK  ++
Sbjct: 511 VLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIACYVGHKLYVRNLQVLVKLEDM 570

Query: 580 DLFTGKEVFDQQEIEGKILDQEKQIRLRE 608
           DL TG++  D  E   +IL ++  +  + 
Sbjct: 571 DLETGRKHIDAHEHRAEILAEKAALSQKS 599

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  259 bits (661), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 165/510 (32%), Positives = 260/510 (50%), Gaps = 16/510 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L+ +L+ RH+ M                     AGPA + I +   G +++  + A+GE+
Sbjct: 81  LQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMALGEL 140

Query: 159 ASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+ G FT+YA+R++D + GFA    Y+ ++L++ P ++ AAS+ + YW        
Sbjct: 141 AVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGTNPRYRD 200

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G ++ +F + I IIN+ GVK +GE EF  S  K                   P    +G 
Sbjct: 201 G-FVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPVKGYIGG 259

Query: 278 RYWQHP-GAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
           RYW HP GAF       D +  +F    SVFV A F++ G EL G+ +AE  NPRKSVP+
Sbjct: 260 RYWHHPYGAF-----VGDSAGARFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSVPK 314

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K   WRI +FYL+ + ++G+ V Y + RL+            PFV+AI   GIR LP 
Sbjct: 315 AAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAAS--PFVIAITTHGIRGLPS 372

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           + N  +LI V S  NS +Y  SR+L +LA     P  F      G P YS+ V   F L+
Sbjct: 373 VVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVTSGFGLV 432

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           A++  S    +VFN+ + +  +  L +W  I + +I F +A+  QG    + ++ +P   
Sbjct: 433 AFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSFVSPAGV 492

Query: 517 YGTYFSLAWCVFIAFIKNFTVFL---GHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT-K 572
           YG+Y+ L + + + FI  F V L   G   + K F   Y+  P+ +  Y G+K  KK  K
Sbjct: 493 YGSYWGL-FMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIACYLGHKIYKKNWK 551

Query: 573 I-VKSHEVDLFTGKEVFDQQEIEGKILDQE 601
           I +K+ ++D+ TG++  D   +  ++ ++ 
Sbjct: 552 IFIKAEDMDIDTGRKDDDLDLLRQEVAEER 581

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  259 bits (661), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 163/525 (31%), Positives = 265/525 (50%), Gaps = 16/525 (3%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           HT  LK +L++RH+ M                     AGPAS+ I +S  G +++  + A
Sbjct: 86  HTP-LKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMA 144

Query: 155 IGEMASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           + EMA   P+ G FT+YA+R++D + GFA  + Y+ ++L++ P ++ +AS+ + YW    
Sbjct: 145 VAEMAVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPT 204

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
               G ++ +F +VIVIIN+ GVK +GE EF  S+ K                   P   
Sbjct: 205 KYRDG-FVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGG 263

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVG-KFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
            +G +YW  PGAF      +  + G +F  F SVFV A F++ G EL GI  +EA NPRK
Sbjct: 264 YVGAKYWHDPGAF------VGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRK 317

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           +VP A K   WRI++FY++++  +G+ V  ND RL+            PFV+AI   GIR
Sbjct: 318 AVPPAAKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAAS--PFVIAITVHGIR 375

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
            LP + N  +LI V S  NS +Y  SR+L +LA  G  P +       G P   + +   
Sbjct: 376 GLPSVINVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSF 435

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
           F L+A++  S     VFN+ + +  +    +W  I + +I F  A+K Q     +  + +
Sbjct: 436 FGLVAFVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVS 495

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVF--LGHSFDYKNFITGYIGLPVFVIFYFGYK-FIK 569
           P   +G+Y+ L   V +   + +     +G +    NF + Y+ LPV ++ Y  +K + K
Sbjct: 496 PLGVFGSYWGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTK 555

Query: 570 KTKI-VKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSL 613
             KI +   ++DL TG++  D   +  ++ ++   +  R   F +
Sbjct: 556 NWKIFIPLGQLDLDTGRKQLDLDLLRQEVAEERATLAARPRWFRI 600

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  258 bits (658), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 162/516 (31%), Positives = 256/516 (49%), Gaps = 26/516 (5%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +KK +++RH+ M                     AGP  + I Y     +++  + A GE+
Sbjct: 64  MKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLYCIIQAAGEL 123

Query: 159 A-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
              Y  M G +T+Y+S  VDPALGF+V + Y  +++ + P QL  A++ I+YW D    N
Sbjct: 124 GICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIKYWTD---TN 180

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
           P +++ I   +IV IN+ G K + E EF  ++ K                    +   +G
Sbjct: 181 PDIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGAGNDGYIG 240

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            RYW  PGAF         S G F     VF YA FAY GIE+  + A+E  NPRKS+P 
Sbjct: 241 ARYWHTPGAF---------STG-FKGVCYVFCYAAFAYGGIEVMVLTASEQENPRKSIPS 290

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K  ++RI++ Y++T  ++   V Y+ P L             PFV+AI + GI V+PH
Sbjct: 291 ACKKVIYRILLIYMLTTLIVCFLVPYDAPEL---TSTGSASRASPFVIAIASHGISVVPH 347

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           I NA +L+ V S  NS LY   R L SL+  G AP +F      G P     V +   LL
Sbjct: 348 IINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMFVGLL 407

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           A++  S     VF++ + +  +  L  WI I ++++ F  A+K QG    +  Y +    
Sbjct: 408 AFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKSQTGY 467

Query: 517 YGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK- 570
           +G++F++   +F+  +  F V +     G     K+F   Y+  PV +  YFGYK   K 
Sbjct: 468 WGSWFAIIVSLFV-LVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYFGYKIYYKD 526

Query: 571 -TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIR 605
               + + EVDL + +++FD+ E++ + LD ++++R
Sbjct: 527 WRLCIPATEVDLNSHRKIFDEDELKQEDLDWKEKMR 562

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  258 bits (660), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 160/497 (32%), Positives = 249/497 (50%), Gaps = 15/497 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK +L+ RH+ M                     AGPA + I +   G +++  + A+GE+
Sbjct: 79  LKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAVGEL 138

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+  GFT+YA+R+VD + GFA  + Y+ ++L++ P ++ AAS+ + YW        
Sbjct: 139 AVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 198

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G ++ +F VVIVIIN+ GVK +GE EF  S  K                    DH  +G 
Sbjct: 199 G-FVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYIGA 257

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW +PGAF       D +  +F  F +VFV A F++ G EL G+  +EA  PRKSVP A
Sbjct: 258 QYWYNPGAFVG-----DTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSVPGA 312

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K   WRI +FY++ + L+GM V  + PRL+            PFV+AI N GI+ LP +
Sbjct: 313 AKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAAS--PFVIAIVNHGIKGLPSV 370

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +LI V S  NS +Y  SR+L +LA  G  P+I       G P   + +   F L+A
Sbjct: 371 VNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFGLIA 430

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S     VFN+ + +  +  L +W  I + +I +  A+  QG    +  + AP   +
Sbjct: 431 FVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAPAGVW 490

Query: 518 GTYFSLAWCVFIAFIKNFTVFL---GHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT--K 572
           G+Y+    C+ + FI  F V L   G   +  +F   Y+   +F+  Y  +K  K+    
Sbjct: 491 GSYWGFFMCILM-FIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFHKIWKRNWKL 549

Query: 573 IVKSHEVDLFTGKEVFD 589
            +   ++D+ TG+   D
Sbjct: 550 FIPLKDLDIDTGRREVD 566

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  257 bits (657), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 162/500 (32%), Positives = 255/500 (51%), Gaps = 16/500 (3%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           ++ + L K+L  RH+                        GPAS+ I +  +   +F  + 
Sbjct: 73  EYGENLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVIN 132

Query: 154 AIGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
           A+GE+A+  P+  GF  Y +R+VDP+  FAV   YL  +++  P +L AAS+ I+YW +R
Sbjct: 133 ALGELAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYW-NR 191

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
           + +N   W+TIF V I ++N+  VKFF E EF +S  K                   P  
Sbjct: 192 E-INSDAWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTG 250

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
             +G +YW  PGAF       D +  +F    SVFV A F+Y G+E+T + AAE+ NPRK
Sbjct: 251 GYIGGKYWNDPGAFHG-----DSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRK 305

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           ++P+A K T W I   Y+  + L+G+ V YND RLL            P V+AI+N+GI+
Sbjct: 306 TIPKATKRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASAS-PLVIAIENAGIK 364

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
            LP + NA +LI + S  NS +YV SR + S+A+    P +F +    G P YS+   + 
Sbjct: 365 GLPSLMNAIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLF 424

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
             LL+++  S    +VF +   +  +  +  WI I + +I F  A+K Q     + AY +
Sbjct: 425 VGLLSFIAASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYIS 484

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYK-F 567
               +G+++ +   V +  I +F V L      S D + F  GY+  P+ +  Y G+K +
Sbjct: 485 QSGIWGSWYGVIILVLV-LIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVY 543

Query: 568 IKKTK-IVKSHEVDLFTGKE 586
           IK  K ++   E+D+  GK+
Sbjct: 544 IKNWKWVIPLEEIDIDLGKK 563

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  259 bits (661), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 164/509 (32%), Positives = 261/509 (51%), Gaps = 15/509 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L+  L+ R  +M                      GPA + I +     +++  + A+GE+
Sbjct: 103 LQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGEL 162

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+  GFT+YA+R+VD + G+A  + Y  ++L++ P ++ +AS+ + YW        
Sbjct: 163 AVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRD 222

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G ++ +F +VIVIIN+ GVK FGE EF  S  K                   P    +G 
Sbjct: 223 G-FVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVGA 281

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW  PGAF  +     GS  +F    SVFV A F++ G EL GI AAEA NPRKS+P A
Sbjct: 282 KYWHDPGAFVGH-----GSGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIPGA 336

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K  VWRIV+FY+ T+ ++G+ V YND RL+            PFV+AI   GI+ LP +
Sbjct: 337 AKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAAS--PFVIAIVTHGIKGLPSV 394

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +LI V S  NS ++  SR++ +L+  G  P +F      G P   + +   F LLA
Sbjct: 395 INVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLLA 454

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S    +VFN+ + +  +  L +W  I + +I F  A+K QG D ++  + +P    
Sbjct: 455 FVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGVA 514

Query: 518 GTYFSLAWCVFIAFIKNFTVFL---GHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT--K 572
           G+Y+ L + + + FI  F V L   G   D + F   Y+  P+ V  YFG+K  K+    
Sbjct: 515 GSYWGL-FMIVLMFIAQFYVALFPPGGKPDAEVFFQSYLSFPIVVATYFGHKIYKRNWKL 573

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQE 601
            +   ++D+ TG+   D + ++ +I++++
Sbjct: 574 FIPLEDMDIDTGRRETDMELLKQEIMEEK 602

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  258 bits (659), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 160/502 (31%), Positives = 256/502 (50%), Gaps = 16/502 (3%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           +   L K+L  RH+                        GPAS+ I +  +   +F  + +
Sbjct: 82  NNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINS 141

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GE+++  P+  GF  Y+ R+V+P+  FAV   YL ++L+L P +L AAS+ I+YW D+ 
Sbjct: 142 LGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK- 200

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            +N   W+ IF   I + N+  VK FGE EF LS  K                   P   
Sbjct: 201 -INSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGG 259

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +G +YW  PGAF  +S        +F    SVFV A F+Y GIE+T + AAE+ NPR++
Sbjct: 260 YIGGKYWHDPGAFVGHSSGT-----QFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P+A K T W I   Y+  + L+G  V  NDPRLL            P V+AI+N GI+ 
Sbjct: 315 IPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGGIKG 373

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP + NA +LI V S  NS +Y  SR + ++A  G  P    R    G P  ++ + + F
Sbjct: 374 LPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFF 433

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LL+++  S   A+VF +   +  +  +  W+ I +++I F +A+KVQ     +  + + 
Sbjct: 434 GLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQ 493

Query: 514 FQPYGTYFSLAWCVFIAFIKNF--TVF-LGHS-FDYKNFITGYIGLPVFVIFYFGYKFIK 569
               G+++     +F+  I +F  ++F LG S  + ++F  GY+  P+ ++ YFG+K   
Sbjct: 494 TGVKGSWYGFI-VLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCYFGHKIYT 552

Query: 570 K--TKIVKSHEVDLFTGKEVFD 589
           +  T +VK  ++DL TG++  D
Sbjct: 553 RNWTLMVKLEDIDLDTGRKQVD 574

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  259 bits (663), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 173/614 (28%), Positives = 285/614 (46%), Gaps = 46/614 (7%)

Query: 13  TRIEIDNIAVQQKGLDSSQDGGIKFVDQTNYNIYGNLDNMGDYSKDYYE----------- 61
           TR E+ N+  ++K + + Q+  +++ + T     G  D+    + DY +           
Sbjct: 34  TRYEMKNLKPKEKEISTEQENEVEYFENTKIQEGGIDDSTITQTNDYEQNITKPTSRVRN 93

Query: 62  ----------KSQYQQQNLDI--------EXXXXXXXXXXXXXXXXXXXPKHTDGLKKNL 103
                     K+  ++    I        E                      +D LKK +
Sbjct: 94  FIDSFKPAEVKNSPEKDTASITSNEMMIDEEILSLSNLDGQRVPPPRKIENKSDELKKTI 153

Query: 104 QARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA-SYI 162
           + RHV M                     AGPA + + +  +G  ++  + A+GEMA +Y 
Sbjct: 154 KPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGEMAVAYS 213

Query: 163 PM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGVWI 221
            +  GF +Y S  VDPA GF+V + Y  ++L +CP +L  AS+ I+YW  +  V+P V++
Sbjct: 214 DLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTK--VDPDVFV 271

Query: 222 TIFLVVIVIIN-VAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYW 280
            IF V+I+ IN V G   + E EF  +S K                    +   +G +YW
Sbjct: 272 IIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDGYIGGKYW 331

Query: 281 QHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAVKL 340
             PGAF+    AID    +F   ++  V A FA+   E  G+ A+E  NPRK++P A K 
Sbjct: 332 HEPGAFRG-EHAID----RFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKK 386

Query: 341 TVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIFNA 400
            ++RIV  +L +I ++G  V Y+  +LL            P+V+A+   G++V+PH  NA
Sbjct: 387 MLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKAS--PYVLAVSTHGVKVVPHFINA 444

Query: 401 CVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMN 460
            +LI V S  NS  Y  SR L SLA  G AP IF      G P   + +  LF ++A+  
Sbjct: 445 VILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAFCA 504

Query: 461 VSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTY 520
            S    +VF + + +  +  L +WI I ++++ F RA+ VQG    +  + +    +G+ 
Sbjct: 505 TSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWGSS 564

Query: 521 FS--LAWCVFIAFIKNFTVFLGH-SFDYKNFITGYIGLPVFVIFYFGYKFIKK--TKIVK 575
           ++  +  C+ IA        +G    D KNF   Y+ +P+ +  YFGYK   K  T  ++
Sbjct: 565 YAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKNWTIFIR 624

Query: 576 SHEVDLFTGKEVFD 589
           + ++DL + + +FD
Sbjct: 625 AKDIDLVSHRNIFD 638

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  258 bits (658), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 159/527 (30%), Positives = 257/527 (48%), Gaps = 27/527 (5%)

Query: 61  EKSQYQ-QQNLDIEXXXXXXXXXXXXXXXXXXXPKHTDGLKKNLQARHVSMXXXXXXXXX 119
           EKS YQ  Q +D+E                         + + L++RH+ +         
Sbjct: 40  EKSAYQVDQIIDVEDASMELIE------------GQEHQVARKLKSRHIQLIALGGAIGT 87

Query: 120 XXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMASYIPMDGFTSY---ASRYVD 176
                        GPA + I+Y  +   V+  M  + EM   +P+ G TS       Y++
Sbjct: 88  GLFIGSGGALSVCGPAPLLISYMIMSFFVWCIMNFLTEMVCMMPISGETSMFAMTGTYLN 147

Query: 177 PALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGV 236
             L F  G    +   ++ P+++TA +++IQYW D    N  ++I+IF+VV V + +  V
Sbjct: 148 KPLSFMCGINLFYAMSMIAPSEITATAILIQYWTD---ANSAIFISIFIVVTVSLTMLPV 204

Query: 237 KFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR-LGFRYWQHPGAFKPYSDAIDG 295
            FFGE EFW+S  K                   P+ D+ LGF YW+HPGAF P+   + G
Sbjct: 205 HFFGESEFWVSIIKLFCITGLVILGIVIFFGGAPNQDKVLGFHYWKHPGAFNPH--LVPG 262

Query: 296 SVGKFVAFVSVFVYALFAYLGI-ELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIF 354
           + GKF+A  +  + + F+Y+ + E+    AAEA +PR+++PR  +  V+R+ +FY+    
Sbjct: 263 NTGKFLACWTAIIKSGFSYVLVPEVVVSCAAEAKDPRRNMPRVAQRFVYRLALFYVCGSL 322

Query: 355 LLGMCVAYNDPRLLXXXXX-XXXXXXXPFVVAIQNSGIRVLPHIFNACVLIFVFSACNSD 413
            +G+ V Y++ RLL             PFV+ IQ  GIRVLPHI NAC+L   +S   S 
Sbjct: 323 TIGIMVGYDNSRLLNAIAAGESNAAASPFVIGIQEVGIRVLPHIINACILTSAYSCGTSV 382

Query: 414 LYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFV 473
           LY  SR L+S+AV+G  P IF  T  +G P+YS     +F LLAY+N S  S+ VF +  
Sbjct: 383 LYGASRVLHSMAVNGAVPKIFATTNRFGTPYYSTAAASVFCLLAYLNCSDSSSVVFTWLS 442

Query: 474 NVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIK 533
           N+ +I G + W+ + + Y+ F + ++   +   K  +   F     Y S  +   ++   
Sbjct: 443 NIATISGFVDWMLVCVVYLRFRKVIEHANLT-DKMPFRKRFMKPLAYLSCGFFAILSLTN 501

Query: 534 NFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHEVD 580
            + VF+  +++  +F   Y  L +  + Y G     KT  +K  ++D
Sbjct: 502 GYAVFVADNWNVSDFFACYTTLGLAAVLYIGAAIYYKT--IKLRDLD 546

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  254 bits (650), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 155/452 (34%), Positives = 231/452 (51%), Gaps = 11/452 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK+ L+ RH+ M                      GP  + IAY FVGI+V     AI E+
Sbjct: 48  LKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAEV 107

Query: 159 ASYIPMDGFT-SYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           AS++P  G T  +A +++D ++GF  G+  +  Y  L P +L+A +++++YW D   V+P
Sbjct: 108 ASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMKYWTD---VSP 162

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
            V+IT+F V+ V  N+  ++F+GE E+     K                      +RLGF
Sbjct: 163 AVFITVFGVLFVATNIYTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLGGVKGQERLGF 222

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
            YW+ PG F  Y   + G +GKFV F +     +++Y GI+   I+A E  N R ++   
Sbjct: 223 HYWRDPGPFANY--LVAGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRYAIFHG 280

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K    RI++ YLVT+F+L + V YND  +             PFV+A+  +GI+VLPHI
Sbjct: 281 AKNVFLRIIVLYLVTVFVLTLIVPYNDKLI---ATGTGTAKSSPFVIAMNRAGIKVLPHI 337

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            NA +L   +SA N  +  GSR+L+ LA   +AP IF +T+  G+P+  +     F  LA
Sbjct: 338 VNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISSFLPLA 397

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           YM+ S  SA VF +F  +VS   LL WI I   +I   RA+K QG  RS    S    P+
Sbjct: 398 YMSCSESSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCSTRIAPF 457

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFI 549
             +FS    V   F   F  F+   FD ++F+
Sbjct: 458 AAWFSGIMSVIFLFTGGFYNFMHGHFDIESFL 489

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  257 bits (657), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 161/514 (31%), Positives = 263/514 (51%), Gaps = 17/514 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L+++L+ RH+ M                      GPA++ I +  +G++++  + A+GE+
Sbjct: 80  LQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGEL 139

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+  GFT+Y  R+VD + GFA+ Y Y+ ++L++ P ++ AAS+ + YW        
Sbjct: 140 AVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYRD 199

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G ++ +F VVIVIIN+ GVK +GE EF  S  K                   P    +G 
Sbjct: 200 G-FVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVGG 258

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW +PGAF       D +  +F A  SVFV A F++ G EL G+ AAE  NPRK++PRA
Sbjct: 259 KYWHNPGAFNG-----DNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALPRA 313

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K   WRI +FY++++ L+G+ V Y    L+            PFV+AI+  GI  LP +
Sbjct: 314 AKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAAS--PFVLAIKTHGISGLPSV 371

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +LI V S  NS +Y  SR+L +LA  G  P IF      G P   +     F LL 
Sbjct: 372 INVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLC 431

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S     VFN+ + +  +  L +W  I I ++ F RA+  QG    + A+++    +
Sbjct: 432 FIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVW 491

Query: 518 GTYFSLAWCVFIAFIKNFTVF---LGHSFDYKNFITGYIGLPVFVIFYFGYKFIKK--TK 572
           G+YF +   + + FI  F +    +G + +  +F   Y+ + V + FY  +K   +  T 
Sbjct: 492 GSYFGVI-LICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLYTRNWTF 550

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRL 606
             ++ ++D+ TG+   D   ++ +I   E+++RL
Sbjct: 551 AKRAKDIDIDTGRRELDLDALKQEI--AEEKLRL 582

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  257 bits (656), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 158/516 (30%), Positives = 256/516 (49%), Gaps = 16/516 (3%)

Query: 100 KKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA 159
            K+L  RH+                        GP S+ I +  +   +F  + A+GE++
Sbjct: 73  NKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGELS 132

Query: 160 SYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
           S  P+  GF  Y SR+V+P+ GFAV   YL ++ +L P +L AASL I+YW    T+N  
Sbjct: 133 STFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYW--NHTINSD 190

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
            W+ IF  +I++ N+  VK FGE EF LS  K                   P    +G +
Sbjct: 191 AWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGK 250

Query: 279 YWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAV 338
           YW +PGAF  ++        +F    SVFV A F+Y G EL  + AAE+ NPR ++P+A 
Sbjct: 251 YWSNPGAFVGHTAG-----DRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKAC 305

Query: 339 KLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIF 398
           K T W I + Y+V + L+G  V+ +DPRLL            P V+AI+N GI+ LP + 
Sbjct: 306 KRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAAS-PLVIAIENGGIKGLPSLM 364

Query: 399 NACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAY 458
           NA +LI V S  NS +Y  SR + S+A  G  P +F      G P Y++   ++F LL++
Sbjct: 365 NAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSF 424

Query: 459 MNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYG 518
           +  S    +VF +   +  +  L  W  I +++I F R +K +G    +  + +    +G
Sbjct: 425 IAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMTGVWG 484

Query: 519 TYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT--K 572
           +Y+     +FI  +  F   L    G   + ++F   Y+  P+ +  YFG+K   ++   
Sbjct: 485 SYYGCI-VIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWRL 543

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRE 608
           +  + E+DL +G+   D + ++ +   +E+ +R + 
Sbjct: 544 LTPTKEIDLDSGRRAVDLELMKDEKRIEEQAMRQKS 579

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  257 bits (657), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 161/525 (30%), Positives = 263/525 (50%), Gaps = 25/525 (4%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           K  + L+K +Q RHV M                     AGPA + I Y  +   ++  + 
Sbjct: 75  KLNNQLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQ 134

Query: 154 AIGEMA-SYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GEMA +Y+ +  GF +Y S  VD A  FAV + Y  ++L +CP +L  AS+ I+YW  
Sbjct: 135 ACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW-- 192

Query: 212 RDTVNPGVWITIFLVVIVIINV-AGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 270
            + V+P V++TIF ++I+ IN+  G + + E EF+ +  K                    
Sbjct: 193 NEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAG 252

Query: 271 DHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNP 330
               +G  YW +PGAF+ ++        +F   VS  V A F++   E   I A+E  NP
Sbjct: 253 TSGYIGVSYWNNPGAFRGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNP 307

Query: 331 RKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSG 390
           RK++P A K  ++R +  Y+ +I ++G  V YN P LL            P+V+A+ + G
Sbjct: 308 RKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKAS--PYVIAVASHG 365

Query: 391 IRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVC 450
           IR+ PH  NA +LI V S  NS  Y  SR L +LA  G AP IF      G P + +   
Sbjct: 366 IRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAA 425

Query: 451 VLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAY 510
            L A +A+   S    +VF++ + +  +  + +W  I +++I F RA+K+QG   ++  Y
Sbjct: 426 SLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGY 485

Query: 511 SAPFQPYGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYK 566
            +    +G+ ++ A  +F+  I  F V L     +  +  NF   Y+ +P+ ++FYFGYK
Sbjct: 486 KSQVGVWGSIYA-ATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYK 544

Query: 567 FIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609
             KK     +++ ++DL + + ++D+      +L QEK  + +EN
Sbjct: 545 TWKKDWNLFIRAKDIDLISHRHIYDED-----VLKQEKN-QYKEN 583

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  258 bits (658), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 156/527 (29%), Positives = 264/527 (50%), Gaps = 21/527 (3%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           +  + LKK+++ RH  M                     AGP  + I Y+ +G  V+  + 
Sbjct: 140 QKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQ 199

Query: 154 AIGEMASYIP--MDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GE+A      + GF +Y    VDPALGF+V + +  ++L +CP +L  AS+ I+YW  
Sbjct: 200 ACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTV 259

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
           +  V+P V++ IF V+I++INV G K + E +F+ +  K                     
Sbjct: 260 K--VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGT 317

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +G +YW+ PGAF+      D  + +F   V+ FV A FA+   E   + A+E  NPR
Sbjct: 318 DGYIGSKYWRDPGAFRG-----DTPIQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNPR 372

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           K++P A K  ++RI+  +L ++ L+G  V Y   +LL            P+V+A+ + G+
Sbjct: 373 KAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKAS--PYVIAVSSHGV 430

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           RV+PH  NA +L+ V S  NS  Y  SR L SLA  G AP  F      G P  ++ V  
Sbjct: 431 RVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSA 490

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           LF ++A+   S     VF + + +  +  L +WI I +++I F RA+KVQG    +  Y 
Sbjct: 491 LFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYK 550

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYK 566
           +    +G+ +++   + +A I  F V +     G     ++F   Y+ +P+ +  Y  +K
Sbjct: 551 SQVGVWGSAYAVL-MMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYIFFK 609

Query: 567 FIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
             K   +  + +++VDL + + +FD++ ++ +  D+E + RLR   +
Sbjct: 610 VWKNDWSLFIPANKVDLVSHRNIFDEELLKQE--DEEYKERLRNGPY 654

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  257 bits (656), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 156/513 (30%), Positives = 258/513 (50%), Gaps = 22/513 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L+K+++ RHV M                     AGP ++ I Y  +G  ++  + A GEM
Sbjct: 119 LQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEM 178

Query: 159 A-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A  Y  + G F +Y S  VD  + F V + Y  ++L + P +L  AS+ I YW  +  VN
Sbjct: 179 AVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTK--VN 236

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
             V++ IF V+I +IN  G K + E EF+ +S K                    +   +G
Sbjct: 237 SDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIG 296

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW +PGAF+      D S+ +F   +S F  A FA+   E   I A+E  NPR+++P 
Sbjct: 297 AKYWHNPGAFRG-----DKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPS 351

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K  ++RI+  +L +I L+G  V Y+   LL            P+V+A+ + G+RV+PH
Sbjct: 352 AAKTMIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQAS-PYVIAVASHGVRVVPH 410

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
             NA +L+ V S  NS  Y   R LYSLA  G AP  F+     G P  ++ V  +F ++
Sbjct: 411 FINAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVI 470

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           A+ + S     VF + +++  +  L +W  I +++I F RA+KVQG    +  + +    
Sbjct: 471 AFCSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGV 530

Query: 517 YGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYKFIKK-- 570
           +G+ ++ A  + +A I  F V +        D +NF   Y+ +P+ ++ YFGYK  KK  
Sbjct: 531 WGSGYA-AIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKKDW 589

Query: 571 TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQ 603
              +++ ++DL + + +FD     G+++ QE++
Sbjct: 590 KLFIRAKDIDLISHRTIFD-----GELVRQEEE 617

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  256 bits (653), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 157/509 (30%), Positives = 261/509 (51%), Gaps = 15/509 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK  L+ RH+ M                      GPAS+ I +  +G +++  + A+GE+
Sbjct: 85  LKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMALGEL 144

Query: 159 ASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+ G FT+YA+R++D + GFA  + Y+ ++L+  P ++ +AS+ + YW        
Sbjct: 145 AVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPKYRD 204

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G ++ +F +VIV IN+ GVK +GE EF  S  K                   P+   +G 
Sbjct: 205 G-FVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYIGG 263

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +Y+  PGAF     A D    KF    SVFV A F++ G EL G+ A+E+ +PRKSVP+A
Sbjct: 264 KYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVPKA 318

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K   WRI +FY++++ ++G+ V YND RL+            PFV+AI   GI+ LP +
Sbjct: 319 AKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAAS--PFVIAIVTHGIKGLPSV 376

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +LI V S  NS ++  SR+  +LA  G  P IF      G P   + +     L+A
Sbjct: 377 VNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIA 436

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S+    VFN+ + +  +  L +W  I I +I F +A+  QG    + ++ +P   +
Sbjct: 437 FVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTGVW 496

Query: 518 GTYFSLAWCVFIAFIKNFTVFL---GHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT--K 572
           G+Y+ L + + I FI  F V L     S   + F   Y+  P+ +  Y G+K  K+    
Sbjct: 497 GSYWGL-FMIVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMYIGHKIYKRNWKL 555

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQE 601
           ++ + E+D+ +G+   D + ++ +I +++
Sbjct: 556 LIPAGEMDIDSGRREVDLELLKQEIAEEK 584

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  256 bits (655), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 172/622 (27%), Positives = 292/622 (46%), Gaps = 43/622 (6%)

Query: 1   MAESIQSTDISHTRIEIDNIAVQQKGLD-SSQDGGIKFVDQTNYNIYGNL---------- 49
           M+ S  + ++ H+R E++++  + K  +  + +  +++  QT+  +  +           
Sbjct: 1   MSSSGSNENVGHSRYEMNDLKKKSKTSEFETTENEVEYFAQTDSQLPSSTLSNDFEPISQ 60

Query: 50  -DNMGDYSK---------DYYEKSQYQQQNL---DIEXXXXXXXXXXXXXXXXXXXPKHT 96
             N   +S+         D ++++  +Q +    D+                       +
Sbjct: 61  DQNTTSHSRTRAKFQNFIDSFKRADKEQPSTLEHDLTKTFEGTLEPSEDGTQPAEVAGKS 120

Query: 97  DGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIG 156
           + LK +++ RHV M                     +GPA + I Y+ +G  ++  + A G
Sbjct: 121 EELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATG 180

Query: 157 EMASYIP--MDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDT 214
           EMA      + GF SY S  ++PALGF+V + Y  ++L +CP +L  AS+ I+YW  +  
Sbjct: 181 EMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTK-- 238

Query: 215 VNPGVWITIFLVVIVIINV-AGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
           V+P V++ IF V+I++INV  G   + E EF+ +S K                    D  
Sbjct: 239 VDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDG 298

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +G RYW  PGAF+    AID    +F   VS  V A FA+   E+ G+ A+E  NPRK+
Sbjct: 299 YIGGRYWHDPGAFRG-EHAID----RFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKA 353

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P A K  ++RIV  YL ++ ++G  V +N  +LL            P+V+A+   G+RV
Sbjct: 354 IPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKAS--PYVLAVSTHGVRV 411

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           +PH  NA +L+ V S  NS  Y  SR L  LA  G AP IFK     G P   + V  L 
Sbjct: 412 VPHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALV 471

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            ++++   S    QVF + + +  +  L +W  I +++I F RA+ VQG    +  + + 
Sbjct: 472 NVISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQ 531

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYKFIK 569
              +G++++    + I  I  F V +        D + F   Y+  P+ +  YFGYK   
Sbjct: 532 CGVWGSWYAFIMMMLI-LIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYT 590

Query: 570 K--TKIVKSHEVDLFTGKEVFD 589
           K     +++ ++DL   ++VFD
Sbjct: 591 KDWRLFIRAKDIDLDINRDVFD 612

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  255 bits (651), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 156/508 (30%), Positives = 254/508 (50%), Gaps = 18/508 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK+ L++RH+ M                     AGPA + I ++  G +++  + A+GE+
Sbjct: 76  LKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+  GFT+YASR+VD + GFA    Y+ ++L++ P ++ AAS+ + YW   D    
Sbjct: 136 AVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRD 195

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G ++ +F VVIV IN  GVK +GE EF  S  K                   P    +G 
Sbjct: 196 G-FVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGG 254

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           R W +PGAF             F    SVFV A F++ G EL G+ AAE  NPRKS+P A
Sbjct: 255 RLWHNPGAF----------ANGFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSA 304

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K   WRI +FY++ + ++G+ V Y   RL+            PFV++IQN+GI+ LP +
Sbjct: 305 AKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAAS--PFVISIQNAGIKGLPSV 362

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +LI V S  NS ++  SRS+ +LA  G  P IF      G P   + V  +F LL+
Sbjct: 363 INVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLS 422

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S    +VF++ + +  +  L +W  I + +I   RA+  Q    ++ +++AP   +
Sbjct: 423 FIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVW 482

Query: 518 GTYFSLAWCVFIAFIKNFTVF--LGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT--KI 573
           G+ +     + I   + +     +G       F   Y+  P+ + FY G+K  KK     
Sbjct: 483 GSVYGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHKIWKKNWKLF 542

Query: 574 VKSHEVDLFTGKEVFDQQEIEGKILDQE 601
           +++  +D+ TG+   D + ++ +I +++
Sbjct: 543 IRAKNIDIDTGRRETDIEALKQEIAEEK 570

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  256 bits (653), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 156/516 (30%), Positives = 260/516 (50%), Gaps = 22/516 (4%)

Query: 96  TDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAI 155
            + LKK +Q RHV M                     AGPA + I Y+ +   ++  + A+
Sbjct: 96  NEKLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAV 155

Query: 156 GEMA-SYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           GEMA +Y+ +  GF +Y    VDPAL F++ + Y  ++  +CP +L  AS+ IQYW  + 
Sbjct: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTK- 214

Query: 214 TVNPGVWITIFLVVIVIINV-AGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
            VN  +++ IF ++++ IN+  G + + E EF  +S K                    + 
Sbjct: 215 -VNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGND 273

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
             +G +YW+ PGAF+      DG   +F   VS  V A F++   E   I A+E  NPRK
Sbjct: 274 GFIGGKYWRDPGAFR----GSDGP-NRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           ++P A K  ++R ++ YL +I ++G+ V Y+   LL            P+V+A+   G+R
Sbjct: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKAS--PYVLAVSTHGVR 386

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
           V+PH  NA +LI VFS  +S  Y  SR L +LA  G AP +F      G P     V  +
Sbjct: 387 VVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAV 446

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
            A++A+   SS   +VFN+ + +  +  + +W  I +++I F RA+KVQG    +  Y +
Sbjct: 447 IAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKS 506

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFT--VFLGH-SFDYKNFITGYIGLPVFVIFYFGYKFIK 569
               +G+ ++    + I   + +   V +G  S D + F   Y+ +PVF++ Y GYK  K
Sbjct: 507 QVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWK 566

Query: 570 K--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQ 603
           +     +++ ++DL + + + D +     IL QE++
Sbjct: 567 RDWRLFIRAKDIDLISHRHIHDPE-----ILRQERE 597

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  255 bits (652), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 175/619 (28%), Positives = 298/619 (48%), Gaps = 34/619 (5%)

Query: 3   ESIQSTDISHTRIEIDNIAVQQKGLDSSQDGGIKFVDQTNYNIYGNLDNMGDYSKDYYEK 62
           E     ++ H  I ID+  + Q+ +    +G    +D+T     G+     D+ KD +++
Sbjct: 8   EKNNPDNLKHNGITIDSEFLTQEPITIPSNGSAVSIDET-----GSGSKWQDF-KDSFKR 61

Query: 63  SQYQQQNLDIEXXXXXXXXXXXXXXXXXXXPKHTDGLKKNLQARHVSMXXXXXXXXXXXX 122
            +  + + ++                          LK +L+ RH+ M            
Sbjct: 62  VKPIEVDPNLSEAEKVAIITAQTP------------LKHHLKNRHLQMIAIGGAIGTGLL 109

Query: 123 XXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMASYIPMDG-FTSYASRYVDPALGF 181
                     GPAS+ I +   G +++  + A+GE+A   P+ G FT+YA+R++D + G+
Sbjct: 110 VGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGY 169

Query: 182 AVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGE 241
           A  + Y+ ++L++ P ++ +AS+ + +W        G ++ +F + IVIIN+ GVK +GE
Sbjct: 170 ANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRDG-FVALFWLAIVIINMFGVKGYGE 228

Query: 242 FEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFV 301
            EF  S  K                   P    +G +YW  PGAF     A D    KF 
Sbjct: 229 AEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGGKYWHDPGAF-----AGDTPGAKFK 283

Query: 302 AFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVA 361
              SVFV A F++ G EL G+ A+E+  PRKSVP+A K   WRI +FY++++ ++G+ V 
Sbjct: 284 GVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVP 343

Query: 362 YNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSL 421
           YND  L+            PFV+AI+  GI+ LP + N  +LI V S  NS +Y  SR++
Sbjct: 344 YNDKSLIGASSVDAAAS--PFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTM 401

Query: 422 YSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGL 481
            +LA     P IF      G P   + V   F L+A++  S    +VFN+ + +  +  L
Sbjct: 402 VALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSL 461

Query: 482 LSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVF--- 538
            +W  I I +I F +A+  QG    + ++ +P   +G+Y+ L + V I FI  F V    
Sbjct: 462 FTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVWGSYWGL-FMVIIMFIAQFYVAVFP 520

Query: 539 LGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT--KIVKSHEVDLFTGKEVFDQQEIEGK 596
           +G S   + F   Y+  P+ ++ Y G+K  K+     + + ++D+ TG+   D   ++ +
Sbjct: 521 VGDSPSAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLFIPAEKMDIDTGRREVDLDLLKQE 580

Query: 597 ILDQEKQIRLRENKFSLEW 615
           I  +EK I   + ++   W
Sbjct: 581 I-AEEKAIMATKPRWYRIW 598

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  255 bits (652), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 156/502 (31%), Positives = 250/502 (49%), Gaps = 16/502 (3%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           +   L K+L  RH+                        GPAS+ I +  +   +F  + +
Sbjct: 82  NNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINS 141

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GE+++  P+  GF  Y+ R+++P+  FAV   YL ++L+L P +L AAS+ I+YW D+ 
Sbjct: 142 LGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK- 200

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            +N   W+ IF   I + N+  VK FGE EF LS  K                   P   
Sbjct: 201 -INSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGG 259

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +G +YW  PGAF  +S        +F    SVFV A F+Y GIE+T + AAE+ NPR++
Sbjct: 260 YIGGKYWHDPGAFVGHSSGT-----QFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P+A K T W I   Y+  + L+G  V  NDPRLL            P V+AI+N GI+ 
Sbjct: 315 IPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGGIKG 373

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP + NA +LI V S  NS +Y  SR + ++A  G  P    R    G P  ++ + + F
Sbjct: 374 LPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFF 433

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LL+++  S   A+VF +   +  +  +  W+ I +++I F +A+KVQ     +  + + 
Sbjct: 434 GLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQ 493

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYKFIK 569
               G+++     +F+  I +F   L    G     ++F  GY+  P+ ++ Y G+K   
Sbjct: 494 TGVKGSWYGFI-VLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLYT 552

Query: 570 K--TKIVKSHEVDLFTGKEVFD 589
           +  T +VK  ++DL TG++  D
Sbjct: 553 RNWTLMVKLEDMDLDTGRKQVD 574

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  257 bits (656), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 157/528 (29%), Positives = 264/528 (50%), Gaps = 22/528 (4%)

Query: 93  PKHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTM 152
           PK  + LKK+++ RH  M                     AGP  + I Y+ +G  V+  +
Sbjct: 140 PKQ-ENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCII 198

Query: 153 AAIGEMASYIP--MDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWI 210
            A GE+A      + GF +Y S  VDPA+GF+V + +  ++L +CP +L  AS+ I+YW 
Sbjct: 199 QACGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWT 258

Query: 211 DRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 270
            +  VN  V++ IF V+I++IN+ G K + E +F+ +  K                    
Sbjct: 259 VK--VNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAG 316

Query: 271 DHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNP 330
               +G RYW+ PGAF+      D S+ +F   V+ FV A FA+   E   + A+E  NP
Sbjct: 317 TDGYIGSRYWRDPGAFRG-----DTSIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNP 371

Query: 331 RKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSG 390
           RK++P A K  ++RI+  +L ++ L+G  V Y   +LL            P+V+A+ + G
Sbjct: 372 RKAIPSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSATKAS--PYVIAVSSHG 429

Query: 391 IRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVC 450
           +RV+PH  NA +L+ V S  NS  Y  SR L SLA  G AP  F      G P  ++ V 
Sbjct: 430 VRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVS 489

Query: 451 VLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAY 510
            +F ++A+   S     VF + + +  +  L +WI I +++I F + +KVQG    +  Y
Sbjct: 490 AVFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGY 549

Query: 511 SAPFQPYGTYFSLAWCVFIAFIKNFTVFLG-----HSFDYKNFITGYIGLPVFVIFYFGY 565
            +    +G+ +++   V +A I  F V +           ++F   Y+ +P+ +  Y  Y
Sbjct: 550 KSQVGVWGSAYAVVLMV-LALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFY 608

Query: 566 KFIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
           K  K+  +  + + ++DL + + +FD++ ++ +  D+E + RLR   F
Sbjct: 609 KVWKRDWSLFIPADKIDLVSHRNIFDEELLKQE--DEEYKDRLRNGPF 654

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  255 bits (651), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 159/512 (31%), Positives = 251/512 (49%), Gaps = 14/512 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L K+L  RH+                        GPAS+ I +  +   +F  + ++GE+
Sbjct: 78  LNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSLGEL 137

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A+  P+  GF  Y +R+VDP+  FAV   YL ++L+L P +L AAS+ I+YW    T+N 
Sbjct: 138 AAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--NSTINS 195

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             W+ IF  VI + N+  VK FGE EF LS  K                   P    LG 
Sbjct: 196 DAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLGG 255

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW +PGAF  ++        KF    SVFV A F+Y GIE+T + AAE+ +PRK++P+A
Sbjct: 256 KYWHNPGAFVGHTSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPKA 310

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K T W I   Y+  + L+G  V Y+DPRL+            P V+AI+N GI+ L  +
Sbjct: 311 AKRTFWLITASYVTILTLVGCLVPYDDPRLM-SGTSSVDAAASPLVIAIENGGIKGLDSL 369

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            NA +LI + S  NS +Y  SR + S+A  G  P    +    G P  +  V + F LL+
Sbjct: 370 MNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLS 429

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S    +VF +   +  +  +  W+ I I++I F +A+  Q     +  Y +    +
Sbjct: 430 FIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGVW 489

Query: 518 GTYFSLAWCVFIAFIKNFTVFL---GHSFDYKNFITGYIGLPVFVIFYFGYK--FIKKTK 572
           G+ + +     +     +T      G S D ++F  GY+ LP+ ++ Y G+K  F   + 
Sbjct: 490 GSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLYFKNWSW 549

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQI 604
           +V   E+DL TG++  D      +++ +E  +
Sbjct: 550 VVTLEEMDLDTGRKALDPHLHRAEVIAEEAAV 581

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  255 bits (651), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 155/502 (30%), Positives = 250/502 (49%), Gaps = 16/502 (3%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           +   L K+L  RH+                        GPAS+ I +  V   +F  + +
Sbjct: 84  NNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINS 143

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GE+A+  P+  GF  Y +R+++P+  FA+   YL ++L+L P +L AAS+ I+YW D+ 
Sbjct: 144 LGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDK- 202

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            +N   W+ IF   I + N+  VK FGE EF LS  K                   P   
Sbjct: 203 -INSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGG 261

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +G +YW +PGAF  +S        +F    SVFV A F+Y GIE+T + AAE+ NP+++
Sbjct: 262 YIGGKYWHNPGAFVGHSAG-----SQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKET 316

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P+A K T W I + Y+  + L+G  V YNDPRLL            P V+AI+N GI+ 
Sbjct: 317 IPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAAS-PLVIAIENGGIKG 375

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP + NA +LI + S  NS +Y  SR + S+A  G  P    +    G P  ++ + + F
Sbjct: 376 LPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFF 435

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LL+++  S    +VF +   +  +  +  W+ I ++ I F  A+K QG    +  + + 
Sbjct: 436 GLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQ 495

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYKFIK 569
              +G ++ +   +F+  + +F   L      +   K+F  GY+ LP+ +  Y G+K  K
Sbjct: 496 SGTWGAWYGVI-VLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWK 554

Query: 570 K--TKIVKSHEVDLFTGKEVFD 589
           +    +V   E+DL +G+ V D
Sbjct: 555 RDWRLLVPLMEMDLDSGRRVLD 576

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  255 bits (651), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 177/599 (29%), Positives = 290/599 (48%), Gaps = 21/599 (3%)

Query: 16  EIDNIAVQQKGLDSSQDGGIKFVDQTNYNIYGNLDNMGDYSKDYYEKSQYQQQNLD-IEX 74
           E+ NI   + G+  S D  ++ V +T+    G+ D +     D +++ + +    D I  
Sbjct: 5   EMKNIKSPEDGVVESFDS-VEVVKETSPRSEGSRDGLFHRFVDSFKRPEEEYNGGDGIHS 63

Query: 75  XXXXXXXXXXXXXXXXXXPKHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGP 134
                              KH   LK+N++ RHV M                      GP
Sbjct: 64  THERVSGEDFERLAPDDSSKHKT-LKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGP 122

Query: 135 ASMFIAYSFVGILVFFTMAAIGEMAS-YIPMDG-FTSYASRYVDPALGFAVGYCYLFKYL 192
           AS+ I Y+ V  +++  + +  E+A  Y  + G F +Y +  VD A  F+V + Y  ++L
Sbjct: 123 ASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWL 182

Query: 193 ILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXX 252
            + P +L  AS+ I+YW   D++NP  ++ IF VV+++IN  G   + E EF+ ++ K  
Sbjct: 183 CILPLELVTASMTIKYW--NDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVL 240

Query: 253 XXXXXXXXXXXXXXXXXPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALF 312
                             +   LG  YW  PGAF+      +  + +F   V+V V A F
Sbjct: 241 MLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAFRG-----NNGINRFKGLVAVLVNAAF 295

Query: 313 AYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXX 372
           AY G E + + AAE  NP+KS+  A K  V+RI+  YL+T  LLG  V YN P LL    
Sbjct: 296 AYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGS 355

Query: 373 XXXXXXXXPFVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPA 432
                   PFV+AI + G++V+PHI NA +L+ V S  NS LY  SR L SL+  G AP 
Sbjct: 356 AATHAS--PFVIAIASHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPK 413

Query: 433 IFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYI 492
           +F      G P   L V  +F LL ++  S     VF + + +  +  L +W  I ++++
Sbjct: 414 LFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHV 473

Query: 493 GFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNF 548
            F R++ VQG    +  Y +    +G Y+++   + I  I  F V +     +  D  NF
Sbjct: 474 RFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLI-LIGQFWVAISPVGSNKLDANNF 532

Query: 549 ITGYIGLPVFVIFYFGYKFIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIR 605
              Y+ +P+ +  Y GYK   +    I+ ++EVDL + +++FD + ++ + L++++Q+R
Sbjct: 533 FENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLR 591

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  255 bits (652), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 171/608 (28%), Positives = 283/608 (46%), Gaps = 16/608 (2%)

Query: 2   AESIQSTDISHTRIEIDNIAVQQKGLDSSQDGGIKFVDQTNYNIYGNLDNMGDYSKDYYE 61
           A++    ++S++R  +   A Q    ++   G +          Y  L N  D+ +    
Sbjct: 14  ADTSTKQEMSNSRSYLTTTAHQSLSSEALSMGSLDARSPQKDVWYTRLLN--DFKRADEG 71

Query: 62  KSQYQQQNLDIEXXXXXXXXXXXXXXXXXXXPKHTDGLKKNLQARHVSMXXXXXXXXXXX 121
           ++     + D+E                    +++  L KNL  RH+             
Sbjct: 72  ETTRSVADSDMEVDGKRYKEMTDVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGL 131

Query: 122 XXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMASYIPM-DGFTSYASRYVDPALG 180
                      GP S+ IA++ +   +F  + ++GE+AS  P+  GF  Y +R+V+P+ G
Sbjct: 132 FVNSGASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAFPVVGGFNVYITRFVEPSFG 191

Query: 181 FAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFG 240
           FAV   YL ++ +L P +L AAS+ I+YW ++  +N   W+ IF V I + N+  VK FG
Sbjct: 192 FAVNISYLAQWAVLLPLELAAASITIKYWNNK--INSDAWVAIFYVCIALANMLDVKSFG 249

Query: 241 EFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKF 300
           E EF LS  K                   P    +G +YW  PGAF       D    +F
Sbjct: 250 ETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAFVG-----DTPGAQF 304

Query: 301 VAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCV 360
               SVFV A F+Y G EL G+ AAE+ NPR ++PRA K + W I   YL+ + + G  V
Sbjct: 305 KGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLV 364

Query: 361 AYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRS 420
             NDPRLL            P V+AI+N GIR +P + NA +LI + S  NS +Y  SR 
Sbjct: 365 PSNDPRLLNGMSSVDVAAS-PLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRC 423

Query: 421 LYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFG 480
           + S+A  G  P +F      G P  ++   ++F LL+++  S     +F +   +  +  
Sbjct: 424 MVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLST 483

Query: 481 LLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFL- 539
           L  W  I I++I F RA+  Q     +  Y +     G+++  A  +F+  +  +T    
Sbjct: 484 LFCWFAINISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFP 543

Query: 540 -GHSF-DYKNFITGYIGLPVFVIFYFGYKFIKK--TKIVKSHEVDLFTGKEVFDQQEIEG 595
            G S    ++F  GY+  P+F+I Y  +K  K+     + + ++D+ +G+   D +E++ 
Sbjct: 544 PGSSGPSAESFFEGYLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRALDIEELKE 603

Query: 596 KILDQEKQ 603
           + L ++ +
Sbjct: 604 QKLREQAE 611

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  254 bits (649), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 161/519 (31%), Positives = 257/519 (49%), Gaps = 21/519 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK++++RHV M                      GPA++ I Y  V  + +F + A GEM
Sbjct: 91  LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFVTYFMIQAAGEM 150

Query: 159 ASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A   P     F +Y+S ++    GFA  + Y F++L + P +L  AS+ IQYW D+  +N
Sbjct: 151 AVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELITASMTIQYWNDK--LN 208

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
           P V+I IF + ++ I+V GVK +GE EF  +  K                    D   +G
Sbjct: 209 PDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVVINCGGAGDDGYIG 268

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
             YW +PGAF     A D S+ +F     + V   F++ G+EL  +   E  NPRKS P 
Sbjct: 269 GAYWHNPGAF-----AGDTSIARFKNVCYILVTGYFSFGGMELFALSVQEQSNPRKSTPV 323

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K +++RIVI YL+T+ L+G  V YND +L+            P+V+A    G++++PH
Sbjct: 324 AAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHGVKIVPH 381

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           I NA +LI V S  NS LY G R + SL+  G AP         G P  +L VC +F ++
Sbjct: 382 IINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIVCCIFGVI 441

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           A++  SS    VF +   +  +  L +W  I ++++ F +A+KVQG    +  Y A    
Sbjct: 442 AFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGI 501

Query: 517 YGTYFSLAWCVFIAFIKNFTVFLG-----HSFDYKNFITGYIGLPVFVIFYFGYKFIKK- 570
           +G+ +   + + + FI  F V L           ++F   Y+  P+++ F+FGY    + 
Sbjct: 502 WGSVYGFFFNILV-FIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFGYMIYNRD 560

Query: 571 -TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRE 608
            T +    ++DL   + ++D + I  +  DQE + + + 
Sbjct: 561 FTLLNPLDKIDLDFHRRIYDPELIRQE--DQENEEKTKN 597

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  254 bits (648), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 161/519 (31%), Positives = 253/519 (48%), Gaps = 20/519 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK +++RHV M                     AGPA + IAY  V  + +F + A GEM
Sbjct: 75  LKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAAGEM 134

Query: 159 ASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A   P     F +Y S ++    GFA  + +  ++L + P +L  A++ +QYW   D++N
Sbjct: 135 AVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYW--NDSIN 192

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
             V++ IF V ++ I+  GVK +GE EF  +  K                    +   +G
Sbjct: 193 ADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSGYIG 252

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW  PGAF       D + G+F     V V A F+Y G+EL  +   E  NPR+S P 
Sbjct: 253 AKYWHDPGAFTS-----DTNAGRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRSTPT 307

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K +++RIV+ YL+T+ L+G  V  N   L+            P+V+A    G++V+PH
Sbjct: 308 AAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTHAS--PYVLAASIHGVKVVPH 365

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           I NA +LI + S  NS LY   R + +LA  G AP         G P ++L VC +F ++
Sbjct: 366 IVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGVI 425

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
            ++  SS   QVFN+   +  +  L +W  I I++I F +A+K+Q     +  Y +PF  
Sbjct: 426 GFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFGV 485

Query: 517 YGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYKFIKK-- 570
           YG+YF + + + + F+  F V L            F   Y+  P+F  FYFGY   K+  
Sbjct: 486 YGSYFGVFFNLLV-FVAQFWVALAPPMYTEMSADTFFESYLAFPIFFAFYFGYMIWKRDF 544

Query: 571 TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609
           T       VDL   + ++D + ++ +  D+EK+  L+ +
Sbjct: 545 TLFSDLESVDLDYHRRIYDPELVKQE--DEEKKEMLKNS 581

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  254 bits (648), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 155/525 (29%), Positives = 261/525 (49%), Gaps = 21/525 (4%)

Query: 93  PKHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTM 152
           P+    LK++++ RHV M                      GPA + I Y+ +G  ++  +
Sbjct: 96  PEKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSII 155

Query: 153 AAIGEMASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWI 210
            A GE+A   P     F +Y S  VDPA+ FA    Y  ++L + P ++ +A++ I+YW 
Sbjct: 156 QAAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYW- 214

Query: 211 DRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 270
              ++NP VW  IF V+I+ IN+ G   + E +F+ ++ K                    
Sbjct: 215 -NTSINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAG 273

Query: 271 DHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNP 330
           D   +G +YW  PGAF       D  + +F A VS  V A FA+   E   + A+E  NP
Sbjct: 274 DSVYIGGKYWNDPGAFNG-----DTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANP 328

Query: 331 RKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSG 390
           RK++P A K  ++RI+  YL +I L+G  V YN P L+            P+V+A+ + G
Sbjct: 329 RKAIPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSS--PYVIAVASHG 386

Query: 391 IRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVC 450
           ++V+P   NA +LI V S  N   Y  SR L  L+  G AP  F+     G P Y++ V 
Sbjct: 387 VKVVPSFINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVG 446

Query: 451 VLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAY 510
            L   + +++ SS    VF + + V  +  L +W  I I+++ F +A++VQ     +  +
Sbjct: 447 ALVGCICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGF 506

Query: 511 SAPFQPYGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGY 565
            +    +G+Y+ + + + + FI  F V L         D +NF   Y+ +PVF+  YFG+
Sbjct: 507 RSQVGVWGSYYGI-FMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGF 565

Query: 566 KFIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRE 608
           K  KK     + + E+DL + +++FD++ ++ +  D+E +I+++ 
Sbjct: 566 KIWKKDWRLYIPASEIDLISHRKIFDEEILKQE--DEEYKIKMKH 608

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  252 bits (643), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 157/476 (32%), Positives = 246/476 (51%), Gaps = 13/476 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK +L+ RH+ M                      GPAS+ I +   G +++  + A+GE+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGEL 145

Query: 159 ASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+ G FT+YA+R++D + G+A  + Y+ ++L++ P ++ +AS+ + +W        
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G ++ +F VVIVIIN+ GVK +GE EF  S  K                   P+   +G 
Sbjct: 206 G-FVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGG 264

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW  PGAF     A D    KF    SVFV + F++ G EL G+ A+E+  PRKSVP+A
Sbjct: 265 KYWHDPGAF-----AGDTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVPKA 319

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K   WRI +FY++++ ++G+ V YND  L+            PFV+AI+  GI+ LP +
Sbjct: 320 AKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAAS--PFVIAIKTHGIKGLPSV 377

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +LI V S  NS +Y  SR++ +LA     P IF      G P   +GV   F L+A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIA 437

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S     VFN+ + +  +  L +W  I I +I F +A+  QG D  + ++ +P   +
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 518 GTYFSLAWCVFIAFIKNFTVFL---GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK 570
           G+Y+ L + V I FI  F V L   G S   + F   Y+  P+ +  Y G+K  K+
Sbjct: 498 GSYWGL-FMVVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGHKIYKR 552

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  253 bits (647), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 160/519 (30%), Positives = 257/519 (49%), Gaps = 19/519 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK++++RHV M                     +GPA + +AY  V  + +F + A GEM
Sbjct: 101 LKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQAAGEM 160

Query: 159 ASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A   P     F SY S +V    GFA  + +L ++L + P +L  +SL I+YW D+  +N
Sbjct: 161 AVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYWNDK--IN 218

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
             V++ IF V ++ I+  GV+ +GE EF  +S K                        +G
Sbjct: 219 SDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDGYIG 278

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW  PGAF  +++     +G+F     + V A F+Y G EL  +   E  NPRKS P+
Sbjct: 279 GKYWHDPGAFTSHTN-----IGRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKSTPQ 333

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K +++RIV+ YL+T+ L+G  V +++ +L+            P+V+A    G+R++PH
Sbjct: 334 AAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHAS--PYVLAASIHGVRIVPH 391

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
             NA +LI V S  NS LY   R L SLA  G AP         G P  +L  C LF ++
Sbjct: 392 FINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGVI 451

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
            +   S+   QVF +   +  +  L +W  I ++++ F +A+KVQG D ++  Y A    
Sbjct: 452 GFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSGV 511

Query: 517 YGTYFSLAWCVFIAFIKNFTVFL---GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK--T 571
           +G+ + + + + + F   F V L   G      +F   Y+  P+F  FYFGY    K  T
Sbjct: 512 WGSVYGVFFNILV-FFAQFWVALAPPGSKPTALSFFESYLAFPIFFTFYFGYMLWNKDFT 570

Query: 572 KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENK 610
            ++    +DL   + V+D + I  +   +EK+I+L+ + 
Sbjct: 571 FLIPLESIDLDFHRRVYDPEFIRQE--REEKKIKLKNSS 607

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  252 bits (644), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 166/532 (31%), Positives = 254/532 (47%), Gaps = 23/532 (4%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           +     K+++++RHV M                      GPA + I YS V ++ +  M 
Sbjct: 77  RSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAYIMMQ 136

Query: 154 AIGEMASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GEMA   P     F  Y+S ++  + GFA  + Y  ++L + P +L  ASL I+YW  
Sbjct: 137 AAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITASLTIKYW-- 194

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
             ++NP  +I IF  VIV I+  G   +GE EF  S+ K                     
Sbjct: 195 NSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVINCGGAGT 254

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +G  YW++PGAF     A    +G F     V V A F+Y G+EL  +   E  NPR
Sbjct: 255 GGYIGGEYWRNPGAF-----AGGSPIGHFKGIAYVLVTAYFSYGGMELFALTVNEQANPR 309

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           K+VP A K  ++RI+I Y++T+ L+G  V YN   L+            P+V+A+ + G+
Sbjct: 310 KAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHAS-PYVIAVASHGV 368

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           +V+PHI NA +LI V S  NS +Y   R L SLA  G AP IF      G P  +L  C 
Sbjct: 369 KVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVALVGCS 428

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           +F LL+++  S    QVF +   +  +  L +W  I ++++ F  A+K QG   S+  Y 
Sbjct: 429 IFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSELGYK 488

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYK 566
           +    +G+ +++ + + I F+  F V L     G   D + F   Y+  P+++  Y GYK
Sbjct: 489 SKTGYWGSIYAIFFNI-IVFVAQFWVALAPIGNGGKADAEAFFQSYLAFPIWISCYVGYK 547

Query: 567 FIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWI 616
              K    +V   E+DL + + +FD+      IL QE      + K S  W+
Sbjct: 548 IYSKEWKLLVPLDEIDLNSHRHIFDKH-----ILQQEDDEHKEKLKNSGWWV 594

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  251 bits (642), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 157/513 (30%), Positives = 255/513 (49%), Gaps = 21/513 (4%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           K +  + + L++RHV                        GPA + I+YS +   V+  M 
Sbjct: 59  KPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLLISYSVMSFFVWAIMN 118

Query: 154 AIGEMASYIPMDGFTSYAS---RYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWI 210
            + EM   IP+ G +S AS    Y++    F  G+   +   ++ P ++TA +L+I+YW 
Sbjct: 119 QMTEMVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMSMVVPTEITACALLIEYWT 178

Query: 211 DRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 270
           D    N  +++TIF+++  ++++  VK FGE EF +S  K                   P
Sbjct: 179 D---ANAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILGLILVGVVIFFGGGP 235

Query: 271 -DHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGI-ELTGIVAAEAY 328
             H  LGF YW  PGAF  Y   + GS G F+A     + + FA++ I E+T   +AEA 
Sbjct: 236 AQHKVLGFHYWNTPGAFNSY--LVKGSTGAFLAVWKAIIKSGFAFVMIPEITSSCSAEAA 293

Query: 329 NPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRL-LXXXXXXXXXXXXPFVVAIQ 387
            PRK++PRA +  V+R+ +FY++   ++G+ V Y++  L              PFV+ IQ
Sbjct: 294 FPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSGKANAAASPFVIGIQ 353

Query: 388 NSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSL 447
            +GIR+LPHI NAC+L   +S   S+LY  SR L+SLA+ G AP  F +   +G+P+YS+
Sbjct: 354 EAGIRILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYGVPYYSV 413

Query: 448 GVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSK 507
               LF +LAY+N S  S  VFN+  N+ +I G ++W+ + ITY+ F +      ++  +
Sbjct: 414 AATSLFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYLKIN-DR 472

Query: 508 FAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKF 567
             Y    Q    Y S  +   +A    F VF+  +++  +F T Y+ +    + + G   
Sbjct: 473 VPYRRRGQRALAYASAIFFALLAITNGFYVFIAGNWNVSDFFTCYVTIGFVGVLFIGSSI 532

Query: 568 IKKTKIVKSHEVDLFTGKEVF------DQQEIE 594
             K    +  +V    G+E+       DQ+E E
Sbjct: 533 YYKEWTFRDMDV---VGREIMPKIDQADQEEKE 562

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  252 bits (644), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 156/516 (30%), Positives = 258/516 (50%), Gaps = 19/516 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK++++RHV M                      GPA++ I Y  V  + +F + A GEM
Sbjct: 91  LKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQAAGEM 150

Query: 159 ASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A   P     F +Y+S ++    GFA  + Y F++L + P +L  A++ I++W   DT+N
Sbjct: 151 AVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFW--NDTIN 208

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
           P ++I IF V ++ I+  GVK +GE EF  +  K                    +   +G
Sbjct: 209 PDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGNDGYIG 268

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW++PGAF     A D S G+F     + V A F++ G+EL  +   E  NPRK+ P 
Sbjct: 269 GKYWRNPGAF-----AGDTSAGRFKNVCYILVTAYFSFGGMELFALSVQEQANPRKTTPV 323

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K +++RI++ YL+T+ L+G  V YND +L+            P+V+A    G++V+PH
Sbjct: 324 AAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHGVKVVPH 381

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           I NA +LI V S  NS LY G R + SLA  G  P         G P  +L VC +F ++
Sbjct: 382 IINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSVFGVI 441

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
            ++  SS    VF +   +  +  L +W  I ++++ F +A+KVQG    +  Y A    
Sbjct: 442 GFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGI 501

Query: 517 YGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK- 570
           +G+ + + + + + FI  F V L     G     ++F   Y+  P+++ FY GY    + 
Sbjct: 502 WGSAYGVFFNILV-FIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGYMIYNRD 560

Query: 571 -TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIR 605
            T +    ++DL   + ++D + +  + L+ E++ R
Sbjct: 561 FTFLNPLDKIDLDFHRHIYDPELMRQEDLENEERKR 596

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  251 bits (642), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 161/518 (31%), Positives = 262/518 (50%), Gaps = 23/518 (4%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           +   L K L  RH+                        GPAS+ I +  +   +F  + +
Sbjct: 82  NNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTCLFTVINS 141

Query: 155 IGEMASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GE+++  P+  GF  Y+ R+V+P+  FAV   YL ++L+L P +L AAS+ I+YW D+ 
Sbjct: 142 LGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK- 200

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            +N   W+ IF   I + N+  VK FGE EF LS  K                   P   
Sbjct: 201 -INSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLSCGGGPHGG 259

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +G +YW  PGAF  +         KF    SVFV A F+Y GIE+T + AAE+ NPR++
Sbjct: 260 YIGGKYWNDPGAFVGHDSGT-----KFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P+A K T W I I Y+  + L+G  V  NDPRLL            P V+AI+N  I+ 
Sbjct: 315 IPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGRIKG 373

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP + NA +LI V S  NS +Y  SR + ++A  G  P   +R    G P  ++ + + F
Sbjct: 374 LPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFF 433

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LL+++  S   A+VF +   +  +  +  W+ I +++I F +A+K Q     +  + + 
Sbjct: 434 GLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDELPFISQ 493

Query: 514 FQPYGTYFSLAWCVFIAFIKNF--TVF-LGHS-FDYKNFITGYIGLPVFVIFYFGYKFIK 569
              +G+ +     +F+  I +F  ++F +G S  + ++F  GY+  P+ ++ YFG+K   
Sbjct: 494 TGVWGSIYGFV-VLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILIVCYFGHKIYT 552

Query: 570 K--TKIVKSHEVDLFTGKEVFD----QQEIEGKILDQE 601
           +    +VK  ++DL TG++  D    +QE++   ++QE
Sbjct: 553 RDWRLLVKLEDMDLDTGRKQVDLNLRRQEMK---IEQE 587

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  252 bits (643), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 156/521 (29%), Positives = 260/521 (49%), Gaps = 20/521 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK+ ++ RHV +                     AGPA + I YS +G  ++  + A GE+
Sbjct: 106 LKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGEL 165

Query: 159 A-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A SY  + G F  Y S  VDPA GF+V + Y  ++L +CP +L  AS+ I+YW    TVN
Sbjct: 166 AVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTT--TVN 223

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
             +++ IF V+I++IN  G + + E EF+ +  K                    +   +G
Sbjct: 224 ADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIG 283

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            RYW  PGAF     A D  +  F   ++  V A FA+   E   + AAE  NPRK++P 
Sbjct: 284 DRYWHTPGAF-----AGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAIPS 338

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K  ++RI+  +L +I L+G  V Y+  +L+            P+V+A+   G++V+PH
Sbjct: 339 AAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKAS--PYVLAVSTHGVKVVPH 396

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
             NA +L+ V S  NS  Y  SR LYSLA  G AP  F      G P  ++    +FA++
Sbjct: 397 FINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAII 456

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           ++   S    QVF + + +  +  + +W  I +++I F +A+ VQ     +  + A    
Sbjct: 457 SFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGV 516

Query: 517 YGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYKFIKK-- 570
           +G+Y+     V I  I  F V +        D + F   Y+ +P+ ++FY GYK  KK  
Sbjct: 517 WGSYYVCFMLVMI-LIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYKIWKKDW 575

Query: 571 TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
           +  ++++ +DL   +++FD++ ++ +  D+E + +L+   +
Sbjct: 576 SLFIRANNIDLDKHRQIFDEELLKQE--DEEYREKLKNGGY 614

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  250 bits (638), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 163/522 (31%), Positives = 254/522 (48%), Gaps = 21/522 (4%)

Query: 97  DGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIG 156
           D +KK +++RHV M                     AGPA + + Y  V  + +F + A G
Sbjct: 76  DHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQAAG 135

Query: 157 EMASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDT 214
           EMA   P     F +YAS +V    GFA  + +  ++L + P +L  AS+ I+YW   DT
Sbjct: 136 EMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYW--NDT 193

Query: 215 VNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 274
           +NP V+I IF V ++ I+  GVK +GE EF  +S K                        
Sbjct: 194 INPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGY 253

Query: 275 LGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSV 334
           +G +YW +PGAF   S A      +F     + V   F+Y G EL  +   E  NPRKS 
Sbjct: 254 IGNKYWINPGAFASESPA-----ARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKST 308

Query: 335 PRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVL 394
           P A K +++RI+I YL+T+ L+G  V ++  +L+            P+V+A    G++V+
Sbjct: 309 PAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHAS--PYVLAASLHGVKVV 366

Query: 395 PHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFA 454
           PH  NA +LI V S  NS LY   R + SLA  G AP  F      G P  +L +C LF 
Sbjct: 367 PHFINAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLFG 426

Query: 455 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPF 514
           ++ ++  S    Q F +   +  +  L +W  IFI++I F  A+KVQG    +  Y A  
Sbjct: 427 VIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRATT 486

Query: 515 QPYGTYFSLAWCVFIAFIKNFTVFLGH-----SFDYKNFITGYIGLPVFVIFYFGYKFIK 569
             +G+ +S+ + + + FI  F V L        +D + F   Y+  P++++FYFGY    
Sbjct: 487 GIWGSVYSVFFNMLV-FIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGYMIYS 545

Query: 570 K--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609
           +  T +    ++DL   + ++D + +  +  D E + RLR +
Sbjct: 546 RDFTFLTPLDKIDLDFHRRIYDPELLRQE--DAETKERLRNS 585

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  251 bits (640), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 159/519 (30%), Positives = 263/519 (50%), Gaps = 19/519 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK ++ RHV M                     +GPA + I Y+ +G  ++  + A GE+
Sbjct: 109 LKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGEL 168

Query: 159 AS-YIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A  Y  + G F +Y S  +DPA GFAV + Y  ++L +CP +L  AS+ I+YW  +  V+
Sbjct: 169 AVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTIKYWTTK--VD 226

Query: 217 PGVWITIFLVVIVIINV-AGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRL 275
           P V++ IF  +I+ INV  G   + E EF+ +SFK                    +   +
Sbjct: 227 PDVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVICGGAGNDGYI 286

Query: 276 GFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVP 335
           G R W +PG+F+      D  V +F   VS  V A FA+   E  G+ A+E  NPRK++P
Sbjct: 287 GTRLWHNPGSFRG-----DKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQSNPRKAIP 341

Query: 336 RAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLP 395
            A K  ++RI+  YL ++ ++G  V Y+  +LL            P+V+AI   G+RV+P
Sbjct: 342 SAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKAS--PYVLAISLHGVRVVP 399

Query: 396 HIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFAL 455
           H  NA +L+ V S  NS  Y  SR L SL+  G AP+        G P  +  V  L  +
Sbjct: 400 HFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYCVSALVGV 459

Query: 456 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQ 515
           +A+   S    QVF + + +  +  L +W  I ++++ F RA++VQG    +  + +   
Sbjct: 460 IAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVG 519

Query: 516 PYGTYFSLAWCVFIAFIKNFTVFL---GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK-- 570
            YG+ +S    V I   + +T  +       D + F   Y+ +P+F++ YFG+K  KK  
Sbjct: 520 IYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIVLYFGFKIWKKDW 579

Query: 571 TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609
              +++ ++DL + +E+FD++ ++ +  D+E + +LR+ 
Sbjct: 580 RLFIRAEDIDLVSHREIFDEELLKQE--DEEYRRKLRDG 616

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  250 bits (639), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 165/572 (28%), Positives = 274/572 (47%), Gaps = 31/572 (5%)

Query: 58  DYYEKSQYQQQN---LDIEXXXXXXXXXXXXXXXXXXXPKHTDG----------LKKNLQ 104
           DY EK+  Q  +   L+ E                   P   DG          LKK ++
Sbjct: 42  DYLEKTSVQNSDFEYLENEGNLFRRFANSFKRAPGSNNPDKEDGSDAGDKGDNKLKKTIK 101

Query: 105 ARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA-SYIP 163
           +RHV M                      GPA + I Y+ +G  ++  + A GE+A  Y  
Sbjct: 102 SRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGELAVCYTS 161

Query: 164 MDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGVWIT 222
           + G F +Y S  +DPALGF+V + Y  ++L + P +L  AS+ I+YW    +VNP +++ 
Sbjct: 162 LSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTT--SVNPDIFVA 219

Query: 223 IFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRYWQH 282
           IF V+ + INV G + + E EF+ ++ K                    +   +G +YW  
Sbjct: 220 IFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYIGGKYWND 279

Query: 283 PGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTV 342
           PG+F       D  +  F   VS  V A FA+   E   + AAE  NPRKS+P A K  +
Sbjct: 280 PGSFSG-----DKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIPSAAKKVL 334

Query: 343 WRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIFNACV 402
           +RI++ +L +I L+G  V +N   L+            P+V+AI + G++V+PH  NA +
Sbjct: 335 YRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHAS--PYVIAIASHGVKVVPHFINAVI 392

Query: 403 LIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVS 462
           L+ V S  NS  Y  SR L SLA  G AP+  K     G P  ++ +  +F L++++  S
Sbjct: 393 LLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMIISAVFGLISFVAAS 452

Query: 463 SGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFS 522
                VF + + +  +  L +W  I +++I F RA+KVQG    +  + +    +G+Y++
Sbjct: 453 PKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYA 512

Query: 523 LAWCVFIAFIKNFTVF--LGHS-FDYKNFITGYIGLPVFVIFYFGYKFIKK--TKIVKSH 577
               + I   + +T    +G    D + F   Y+ +P+ +  YFGYK  K+  T  + + 
Sbjct: 513 TGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIPAS 572

Query: 578 EVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609
           ++DL + + +FD+  ++ +  D E + +LR +
Sbjct: 573 KIDLISNRRIFDEDVLKQE--DAEFREKLRNS 602

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  250 bits (638), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 163/514 (31%), Positives = 262/514 (50%), Gaps = 13/514 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L+  L++RH+ M                     AGPA + I +   G ++F  + A+GE+
Sbjct: 88  LQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMVMALGEL 147

Query: 159 ASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+ G F +YA+R++D + GFA  + Y+F++L+  P ++ AAS+ + YW        
Sbjct: 148 AVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWETPVRYTD 207

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G ++ +F +V+VIIN+ GV+ +GE EF  S  K                   P    +G 
Sbjct: 208 G-FVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVGGYVGG 266

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           RYW  PGAF  +S        +F  F SVFV A F++ G EL GI +AE+ NPRKSVP+A
Sbjct: 267 RYWHDPGAFAGHSPG-----RRFKGFCSVFVTAAFSFAGSELVGIASAESKNPRKSVPQA 321

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K   WRI++FY++ + L+G+ V Y DPRLL            PFV+AI   GI  LP +
Sbjct: 322 AKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASAS--PFVIAIVTHGISGLPSV 379

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +LI V S  NS +Y  SR+L +L+  G  P         G P   + +C  F L+A
Sbjct: 380 VNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFGLIA 439

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S+   Q+FN+ + +  I   L+W  I   +I F  A+KV G    +  + +P    
Sbjct: 440 FVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPVGII 499

Query: 518 GTYFS--LAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT--KI 573
           G+Y+   LA  + +A   N    +G S +  +F + Y+  P+ + FY  +K  K+    +
Sbjct: 500 GSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFYIAHKLWKRNWKLL 559

Query: 574 VKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607
           +   ++D+ TG+   D   ++ +I +++  + +R
Sbjct: 560 IPLKDIDIDTGRRETDINLLKQEIAEEKAALAMR 593

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  251 bits (640), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 165/521 (31%), Positives = 271/521 (52%), Gaps = 20/521 (3%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
            +D L+K ++ RHV M                     AGPA + I YS +G  ++  + A
Sbjct: 118 ESDDLQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLYCIIQA 177

Query: 155 IGEMAS-YIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
            GEMA  Y  ++G F +Y S  +DPALGF+V + Y  ++L +CP +L  ASL I+YW  +
Sbjct: 178 AGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIKYWTTK 237

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
             V+P V++ IF V+I+ INV G + + E EF+ +  K                    + 
Sbjct: 238 --VDPDVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGGAGND 295

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
             LG +YW  PGAF+      + +V +F   +  FV A FA+   E   + AAE  NPRK
Sbjct: 296 GYLGAKYWHEPGAFRG-----EHAVDRFKGVMDTFVAAAFAFGATEFIALTAAEQSNPRK 350

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           ++P A K  ++RIV+ +LV+I +LG  V Y+  +LL            P+V+A+   G+R
Sbjct: 351 AIPSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLLGSSGSGVKAS--PYVLAVSLHGVR 408

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
           V+PH  NA +L+ V S  NS  Y  SR L SL+  G AP  F      G P  ++ +  L
Sbjct: 409 VVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAMLMSAL 468

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
           F ++A+   S     VFN+ + +  +  L +W  I ++++ F  A+KVQG    +  + +
Sbjct: 469 FGVIAFCATSPKETDVFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEVGFHS 528

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYK-F 567
               YG+ ++ A  + +A +  F V +        D +NF   Y+ +P+ +  YFGYK +
Sbjct: 529 QTGVYGSLYA-ATMMILALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFGYKLY 587

Query: 568 IKKTKI-VKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607
            +  K+ +K+ ++DL + +++FD+  ++ +  D+E + +LR
Sbjct: 588 YRDWKLYIKADKIDLISHRQIFDENILKQE--DEEYKEKLR 626

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  250 bits (638), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 162/526 (30%), Positives = 259/526 (49%), Gaps = 29/526 (5%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK++++RHV M                      GPA++ I Y  V  + +F + A GEM
Sbjct: 91  LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAAGEM 150

Query: 159 ASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A   P     F +Y+S ++    GFA  + Y F++  + P +L  AS+ IQ+W D+  +N
Sbjct: 151 AVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFWNDK--IN 208

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
           P ++I IF V ++ ++  GVK +GE EF  +  K                    +   +G
Sbjct: 209 PDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYIG 268

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
             YW  PGAF     A D S+ +F     + V A F++ G+EL  +   E  NPRKS P 
Sbjct: 269 GAYWHKPGAF-----AGDTSIARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRKSTPV 323

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K +++RIV+ YL+T+ L+G  V YND +LL            P+V+A    G+R++PH
Sbjct: 324 AAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHAS--PYVLAASIHGVRIVPH 381

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           I NA +LI V S  NS LY G R + SLA  G AP         G P  +L VC +  ++
Sbjct: 382 IINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVIGVI 441

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPF-- 514
           A++  SS    VF +   +  +  L +W  I ++++ F +A+KVQG   ++  Y A    
Sbjct: 442 AFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKATTGI 501

Query: 515 --QPYGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYKF 567
               YG++F++     + FI  F V L     G   + + F   Y+  P+++IFY GY  
Sbjct: 502 WGSIYGSFFNI-----LVFIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGYMI 556

Query: 568 IKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
             +  T +    ++DL   + V+D + +  +  D+E + +++   F
Sbjct: 557 YNRDFTLLNPLDKIDLDFHRRVYDPELMRQE--DEENKEKIKNMSF 600

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  249 bits (637), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 169/520 (32%), Positives = 260/520 (50%), Gaps = 19/520 (3%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           KH   LK+N++ RHV M                      GPAS+ I Y+ V  +++  + 
Sbjct: 77  KHKT-LKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQ 135

Query: 154 AIGEMAS-YIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           +  E+A  Y  +  GF +Y S  VD A GF+V + Y  ++L + P +L  AS+ I+YW  
Sbjct: 136 SASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW-- 193

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
             T+NP  ++TIF VV+V IN  G   + E EF+ +  K                    +
Sbjct: 194 NQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGGAGN 253

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              LG RYW  PGAF+  SD+I+    +F   V+V V A FAY G E + + AAE  NP+
Sbjct: 254 DGYLGARYWHDPGAFRG-SDSIN----RFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQ 308

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           KS+  A K  V+RI+  Y++T  LLG  V +N   LL            PFV+A+ + G+
Sbjct: 309 KSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHAS--PFVIAVASHGV 366

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           RV+PH  NA +L+ V S  NS LY  SR L SL+  G AP         G P   L V  
Sbjct: 367 RVVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSC 426

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           +F LL+++  S     VF + + +  +  L +W  I ++++   RA+ VQG    +  Y 
Sbjct: 427 VFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYV 486

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYKF 567
           A    +G Y+++A  V I  +  F V +     +  D  NF   Y+ +P+ +  Y GYK 
Sbjct: 487 AWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKI 545

Query: 568 IKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIR 605
             +    ++ S EVDL   +++FD + +  + L++++Q+R
Sbjct: 546 WTRDWRLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLR 585

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  250 bits (638), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 154/503 (30%), Positives = 250/503 (49%), Gaps = 19/503 (3%)

Query: 97  DGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIG 156
           D LKK +Q RHV +                     AGPA + I Y  +G L++  + A G
Sbjct: 114 DKLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGPAGLVIGYGIMGSLIYCIIQACG 173

Query: 157 EMA-SYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDT 214
           EMA +Y+ +  GF +Y +  +DP   FA  + Y  ++L +CP +L  AS+ I+YW  +  
Sbjct: 174 EMAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWLCVCPLELVTASMTIKYWTTK-- 231

Query: 215 VNPGVWITIFLVVIVIINV-AGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
           V+P V++ IF V I+ IN+  G + + E EF  +S K                       
Sbjct: 232 VDPDVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGTDG 291

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +G RYW  PGAF+      + +V +F   V+  V A F++   E   + A+E  NPR++
Sbjct: 292 YIGGRYWHDPGAFRG-----ERAVDRFKGVVATLVTAAFSFGQSEFIAVTASEQSNPRRA 346

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P A K  ++R +  YL +I LLG  V YN  +LL            P+V+A+ N G+RV
Sbjct: 347 IPSAAKKIIYRALCIYLASIILLGFLVPYNSSQLLGAQSNGIKAS--PYVLAVANHGVRV 404

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           +PH  NA ++I V S  NS  Y   R L +L+  G AP IF      G P   + V  LF
Sbjct: 405 VPHFINAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFSYVDRAGRPTMGIIVASLF 464

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
           A++A+   S    QVF + + V  +  + +W+ I ++++ F RA+ VQG    +  + + 
Sbjct: 465 AVIAFCATSPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFRRAMTVQGRSLGECGFLSQ 524

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYK-FI 568
              YG+ +S  + + +  +  F V L        D  +F   Y+  P+++  Y GYK + 
Sbjct: 525 VGIYGSAYSF-FVLALILVGQFWVALKPVGSKKVDANSFFENYLAAPIWIALYIGYKCYT 583

Query: 569 KKTKI-VKSHEVDLFTGKEVFDQ 590
           K  ++ +KS ++DL   ++++D+
Sbjct: 584 KDWRLYIKSQDIDLVAHRQIYDE 606

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  247 bits (630), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 159/522 (30%), Positives = 256/522 (49%), Gaps = 29/522 (5%)

Query: 96  TDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAI 155
           T  +KK ++ RH+ M                     AGPA + + Y     +++  + A 
Sbjct: 62  TAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAA 121

Query: 156 GEMA-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           GE+   Y  M G +T+Y+S  VDPA+GF+V + Y  +++ + P QL  A+++IQYW D  
Sbjct: 122 GELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTD-- 179

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            +NP +++ I   VIV IN+ G K + E EF+ +  K                       
Sbjct: 180 -INPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSG 238

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +G +YW  P   +P+ +   G          VF YA FAY GIE+  + A+E  NPRKS
Sbjct: 239 YIGDKYWHEP---RPFMNGFKG-------LCFVFCYAAFAYGGIEVMVLSASEQENPRKS 288

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +  A K  ++RIV+ YL+T  ++   V  + P L             P V+A+   G+++
Sbjct: 289 ISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSL-----ASEGSRASPLVIAVSFHGVKI 343

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           +PHI NA +LI V S  NS LY   R L SLA  G AP IF      G P  +  V ++F
Sbjct: 344 VPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVF 403

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LLA++  S     VF + + +  +  +  W+ I I++I F  A+K QG    +  Y A 
Sbjct: 404 GLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKAR 463

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYKFIK 569
              +G++ ++    F+  I  F V +        D ++F   Y+  P+ ++ YFGYK   
Sbjct: 464 TGYWGSWIAVV-TAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYH 522

Query: 570 K--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609
           K     + + EVDL + ++VFD+ E++ +  D E +++L+ +
Sbjct: 523 KDWRICIPASEVDLISHRQVFDEDELKQE--DLEWKLKLKSS 562

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  248 bits (634), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 154/503 (30%), Positives = 257/503 (51%), Gaps = 18/503 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L+K++Q RHV M                     AGPA + I Y+ +G  ++  + A GEM
Sbjct: 127 LRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEM 186

Query: 159 A-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A SY  + G F +Y +  VD   GFAV + Y  ++L + P +L  AS+ I YW  +  VN
Sbjct: 187 AVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK--VN 244

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
             +++ IF V+I++INV G K + E +F+ ++ K                        +G
Sbjct: 245 NDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAGGAGTSGYIG 304

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW  PGAF+      D S+ +F   ++ F  A FA+   E   I A+E  NPR+++P 
Sbjct: 305 AKYWHDPGAFRG-----DRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRAIPS 359

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K+ ++RI+  +L +I L+G  V Y+   L+            P+V+AI + G+RV+PH
Sbjct: 360 AAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKAS--PYVLAISSHGVRVVPH 417

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
             NA +L+ V S  NS  Y   R L+SL+  G AP  F      G P  ++ + +LF ++
Sbjct: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           A+   SS   +VF + + +  +  + +W+ I +++I F RA+ VQG   S+  + +    
Sbjct: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537

Query: 517 YGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYKFIKK-- 570
           +G+ ++ A  +F+A I  F V +        D K+F   Y+ +P+ ++FYFGYK   +  
Sbjct: 538 WGSVYA-ATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDW 596

Query: 571 TKIVKSHEVDLFTGKEVFDQQEI 593
              +++  +DL T + +FD + I
Sbjct: 597 KLFIRAKNIDLITHRNIFDAEII 619

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  247 bits (630), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 158/526 (30%), Positives = 256/526 (48%), Gaps = 17/526 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK ++ RHV M                      GPA++ I Y  V ++ +  + A GEM
Sbjct: 91  LKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMIQAAGEM 150

Query: 159 ASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A   P     F +YAS +V    GFA  + +  ++L + P +L  ASL+I+YW ++  VN
Sbjct: 151 AVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASLIIKYWTEK--VN 208

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
             V++ IF V ++ I+  GVK +GE EF  +  K                        +G
Sbjct: 209 ADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGHDGYIG 268

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW  PGAF     A   +  +F     V V   F+Y G EL  +   E  NPRKS P 
Sbjct: 269 GKYWHSPGAF-----AGTNAAERFKGVCYVLVSGYFSYGGTELYVLSVNEQENPRKSTPI 323

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K +++RI++ YL+T+ L+G  V +ND +L+            P+V+A    G+RV+PH
Sbjct: 324 AAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHAS--PYVLAASIHGVRVVPH 381

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           I NA +LI V S  NS LY   R L SLA  G AP         G P Y+L  C +F ++
Sbjct: 382 IINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPLYALLACAVFGVI 441

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           A+   S    QVF +   +  +  L +W  I ++++ F +A+K+QG D ++  Y A    
Sbjct: 442 AFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYIANTGY 501

Query: 517 YGTYFSLAWCVFIAFIKNFTVFLG---HSFDYKNFITGYIGLPVFVIFYFGYKFIKK--T 571
           +G+ + + + + + FI  F V L         ++F   Y+  P+++ FYFGY    K  T
Sbjct: 502 WGSVYGVVFNILV-FIAQFWVALAPPKSPITAQSFFESYLAFPIWIAFYFGYMIWNKDYT 560

Query: 572 KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIY 617
            +    ++DL   + ++D + ++ + ++ ++++R       L+W +
Sbjct: 561 FLNPLDKIDLDHHRRIYDPEVLKQEDMENKERVRNGNIWTKLKWFW 606

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  247 bits (630), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 164/513 (31%), Positives = 247/513 (48%), Gaps = 18/513 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK ++ RHV M                     AGPA + I Y  V  + +F + A GE+
Sbjct: 95  LKKQMKTRHVVMMSLGTGIGTGLLIANAKGLHFAGPAPLVIGYGMVSFVTYFMIQAAGEL 154

Query: 159 ASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A   P     F SY    +    GFA  +    ++L + P +  AASL I+YW DR  ++
Sbjct: 155 AVAYPTLPGNFNSYFGILISKPFGFATVWLAAVQWLTVLPLEFIAASLTIKYWNDR--IS 212

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
             V++ IF V ++ I+  GV+ +GE EF  +  K                    +   +G
Sbjct: 213 GDVFVVIFYVFLLFIHFVGVRAYGETEFIFNLCKVLMIIGFIILSIVINAGGAGNDGYIG 272

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW  PGAF     A + +  +F     + V   F+Y G EL  +   E  NPRKS P+
Sbjct: 273 GKYWNDPGAF-----AGETAGSRFKGVCYILVTGYFSYGGTELFVLSVNEQENPRKSTPQ 327

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K +++RIVI YL+T+ L+G  V YNDPRL+            P+V+A    G++++PH
Sbjct: 328 AAKHSIYRIVIIYLLTMILIGFNVPYNDPRLMGADDASGSHAS-PYVLAASIHGVKIVPH 386

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
             NA VLI + S  NS LY   R + SLA  G AP I       G P  SLG+C LF L+
Sbjct: 387 FINAVVLIALISVGNSALYAAPRMMVSLAEQGFAPKIMAYVDREGRPLVSLGICALFGLI 446

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
            +   SS   QVF +   +  +  L +W   FI++I F  A+K+QG D  +  + A    
Sbjct: 447 GFAASSSKEEQVFTWLAAIAGLSELFTWSAFFISHIRFRWAMKLQGKDIKEVGFLASTGL 506

Query: 517 YGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK-- 570
           YG+++ L + + + F   F V L          ++F   Y+  P+++ FYFGY    K  
Sbjct: 507 YGSFYGLFFNILV-FAAQFWVALSPIGSKKVGAESFFESYLAFPIWLFFYFGYMVWAKDF 565

Query: 571 TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQ 603
           T +     +DL   + ++D +E+  +I  QEK+
Sbjct: 566 TFLNPLESIDLDFHRRIYDPEEM-AEINRQEKE 597

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  246 bits (628), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 153/517 (29%), Positives = 258/517 (49%), Gaps = 22/517 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK+ +  RHV M                      GPA + I Y+ +G  ++  + A GE+
Sbjct: 90  LKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAAGEL 149

Query: 159 A-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A SY  + G F +Y S  ++ A GF+V + Y  ++L + P +L  AS+ I+YW    +VN
Sbjct: 150 AVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTT--SVN 207

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
           P +++ IF V+I+++N+ G + + E EF+ +  K                    +   +G
Sbjct: 208 PDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYIG 267

Query: 277 FRYWQHPGAF---KPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            RYW +PGAF   KP        +  F   +S  V A FA+   E   + AAE  NPR++
Sbjct: 268 GRYWNNPGAFYGTKP--------IHHFKGIISTMVTAAFAFGATEFIALTAAEQANPRRA 319

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P A K  V+RI++ +L  I L+G  V +N P L+            P+V+A+ + G+RV
Sbjct: 320 IPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHAS--PYVIAVASHGVRV 377

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           +PH  NA +L+ V S  NS  Y  SR L +LA    APA  K     G P  ++ V  +F
Sbjct: 378 VPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVF 437

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            L++++  S     VF + + +  +  L +WI I +++I F +A+ VQG    +  Y + 
Sbjct: 438 GLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQ 497

Query: 514 FQPYGTYFS--LAWCVFIAFIKNFTVFLGHS-FDYKNFITGYIGLPVFVIFYFGYKFIKK 570
               G+Y++  +  C+ I         +G +  D  +F   Y+ LP+FV+ YFG+K  K+
Sbjct: 498 TGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFGFKIWKR 557

Query: 571 --TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIR 605
                +   ++DL + ++ FD++ ++ +  + E+ IR
Sbjct: 558 DWRLYIPLEQIDLDSHRKTFDEELLKQEDAEYEENIR 594

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  245 bits (625), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 156/513 (30%), Positives = 252/513 (49%), Gaps = 16/513 (3%)

Query: 100 KKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA 159
            K+L  RH+                        GP S+ I +  +   +F  + A+GE++
Sbjct: 71  NKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNALGELS 130

Query: 160 SYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
           S  P+  GF  Y SR+V+P+ GFAV   YL ++ +L P +L AASL I+YW    T+N  
Sbjct: 131 STFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYW--NSTINSD 188

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
            W+ IF  +I + N+  VK FGE EF LS  K                   P+   +G +
Sbjct: 189 AWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGGYIGGK 248

Query: 279 YWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAV 338
           YW +PGAF       + S  +F    SVFV A F+Y G EL  + AAE+ NPR ++P+A 
Sbjct: 249 YWSNPGAFVG-----NTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKAC 303

Query: 339 KLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHIF 398
           K T W I + Y+V + L+G  V  +DPRLL            P V+AI+N GI+ LP + 
Sbjct: 304 KRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAAS-PLVIAIENGGIKGLPSLM 362

Query: 399 NACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAY 458
           NA +LI V S  NS +Y  SR + S+A  G  P  F      G P Y++   ++F LL++
Sbjct: 363 NAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLSF 422

Query: 459 MNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYG 518
           +  S+    VF +   +  +  L  W  I +++I F   +K +G    +  + +    +G
Sbjct: 423 IAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSMTGVWG 482

Query: 519 TYFSLAWCVFIAFIKNFTVFLGHSFD----YKNFITGYIGLPVFVIFYFGYKFIKKT--K 572
           +Y+     +F+  +  F   L  S +     ++F   Y+  P+ ++ Y G+K   K+   
Sbjct: 483 SYYGCV-IIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTKSWRL 541

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIR 605
           +  + E+D+ +G+   D + ++ +   +E+ +R
Sbjct: 542 LTPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMR 574

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  247 bits (631), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 172/582 (29%), Positives = 276/582 (47%), Gaps = 42/582 (7%)

Query: 38  VDQTNYNIYGNLDNMGDYSKDYYEKSQYQQQNLDIEXXXXXXXXXXXXXXXXXXXPKHTD 97
           V+    N   +L+NM  Y++D   K      +  I                       +D
Sbjct: 115 VNNNGANSESDLENMILYNEDGTPKPLPHHHDAQINDN------------------SKSD 156

Query: 98  GLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGE 157
            LKK ++ RHV M                     AGPA + I +  +G  ++  + A+GE
Sbjct: 157 ELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGE 216

Query: 158 MA-SYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTV 215
           +A +Y  +  GF +Y S  VD A  FAV + Y  ++L +CP +L  AS+ I+YW  +  V
Sbjct: 217 LAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTK--V 274

Query: 216 NPGVWITIFLVVIVIINV-AGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 274
           +P +++ IF ++I+ IN+  G   + E EF  +S K                        
Sbjct: 275 DPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGY 334

Query: 275 LGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSV 334
           +G +YW  PGA +      D S+ +F   ++  V A FA+   E  G+ A+E  NPRK++
Sbjct: 335 IGAKYWHDPGALRG-----DTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAI 389

Query: 335 PRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVL 394
           P A K  ++RI+  +L +I ++G  V YN  +LL            P+V+AI   G+RV+
Sbjct: 390 PSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKAS--PYVLAISTHGVRVV 447

Query: 395 PHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFA 454
           PH  NA +LI V S  NS  Y  SR L SLA  G AP I+      G P   +    +F 
Sbjct: 448 PHFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFG 507

Query: 455 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPF 514
           ++A+   S    +VF + + +  +  L +W+ I I++I F RA+ VQG    +  + +  
Sbjct: 508 VIAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQV 567

Query: 515 QPYGTYFSLAWCVFIAFIKNFTVF-------LGHSFDYKNFITGYIGLPVFVIFYFGYKF 567
             YG+ ++ A  +F+  I  F V        L    D KNF   Y+ +P+ + FYFGYK 
Sbjct: 568 GWYGSAYA-AIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKI 626

Query: 568 IKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607
            KK     +++  +DL + + +FD++ I+ +  + E + RLR
Sbjct: 627 WKKDWKLFIRAKNIDLISHRNIFDEELIKQE--EDEYRERLR 666

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  245 bits (625), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 161/515 (31%), Positives = 258/515 (50%), Gaps = 15/515 (2%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK +L+ RH+ M                     AGPA + I +   G +++  + A+GE+
Sbjct: 81  LKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYCMVMAMGEL 140

Query: 159 ASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           +   P+ G FT+YA+R++D + GFA  + Y+ ++L + P ++ AAS+ + YW        
Sbjct: 141 SVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAASITVNYWGTDPKYRD 200

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
           G ++ +F VVIVIIN+ GVK +GE EF  S  K                   P+   +G 
Sbjct: 201 G-FVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGG 259

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +Y+  PGAF       D +  +F    SVFV A F++ G EL GI AAE+  PRKSVP+A
Sbjct: 260 KYFHDPGAF-----VGDTAGARFQGVCSVFVTAAFSFAGSELIGIAAAESAEPRKSVPKA 314

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K   WRI +FY++++ ++G+ V Y D RL+            PFV+AI + GIR LP +
Sbjct: 315 AKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAAS--PFVIAITSHGIRGLPSV 372

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +LI V S  NS +Y  SR+L +LA     P IF      G P + +     F L+A
Sbjct: 373 VNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGIAFTSAFGLVA 432

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S    +VF + + +  +  L +W  I   +I F  A+  QG    +  + AP   Y
Sbjct: 433 FVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDELPFKAPAGIY 492

Query: 518 GTYFSLAWCVFIAFIKNFTVFL---GHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT--K 572
           G+ + L + + + F+  F V L   G     + F   Y+  PV + FYFG+K   +    
Sbjct: 493 GSMWGL-FMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSFPVVLAFYFGHKLYARNWKL 551

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607
           ++   ++D+ TG+   D   +  +I ++++ +  R
Sbjct: 552 LIPLSKLDIDTGRREMDLDVLRQEIAEEKQMMSTR 586

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  244 bits (623), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 158/527 (29%), Positives = 255/527 (48%), Gaps = 21/527 (3%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           K    LK N++ RH++M                      GPA + I Y     +++  + 
Sbjct: 63  KTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQ 122

Query: 154 AIGEMA-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A  E+  +Y  + G + +Y +  VD   GFAV   Y  ++  + P +L  AS+ ++YW  
Sbjct: 123 ACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTS 182

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
             +VNP V++ IF V ++ I+  G + + E EF  +S K                    +
Sbjct: 183 --SVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGAS-E 239

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +G +YW  PGAF       D ++ +F    SV+V A FAY G E   + AAE  NPR
Sbjct: 240 QGYIGGQYWHDPGAFGG-----DRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPR 294

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           +SVP+A K  ++R+V+ +L+ + L+G  V +N  +LL            PFV+A    G+
Sbjct: 295 ESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRAS-PFVIAAALHGV 353

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           RV+PHI N  +L  V S  NS +Y   R L SLA  G  P IF      G P  +L    
Sbjct: 354 RVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVS 413

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           LF L+A++  S+    VF +   +  +  L +W  I ++++ F RA++VQG    +  Y 
Sbjct: 414 LFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYR 473

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLG-----HSFDYKNFITGYIGLPVFVIFYFGYK 566
           A     G+Y+++ + V I  I  F + +         D + F   Y+  PV V+FY GYK
Sbjct: 474 ANTGALGSYYAIFFNV-IVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYK 532

Query: 567 FIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
             K+    ++ S EVDL + +++FD++ +  +  + E++ RLR +  
Sbjct: 533 LWKRDFRLVIPSSEVDLLSHRQIFDEEVLLQE--EAERKERLRNSTL 577

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  243 bits (620), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 157/512 (30%), Positives = 256/512 (50%), Gaps = 26/512 (5%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK+ L++RH+ M                     AGPA + I ++  G +++  + A+GE+
Sbjct: 76  LKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID----RD 213
           A   P+  G+T+YASR+VD + GFA    Y   +LI  P ++ AAS+ + YW      RD
Sbjct: 136 AVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRD 195

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
                 ++ +F VVIV IN+ GVK +GE EF  S  K                   P   
Sbjct: 196 A-----FVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGG 250

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +G R W +PGAF             F    SVFV A F++ G EL G+ AAE  NPRKS
Sbjct: 251 YIGGRLWHNPGAF----------ANGFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKS 300

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P A K   WRI +FY++ + ++G+ V Y   RL+            PFV++IQN+GI+ 
Sbjct: 301 IPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAAS--PFVISIQNAGIKG 358

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP + N  +LI V S  N  ++  SRS+ +LA  G  P IF      G P   + V  +F
Sbjct: 359 LPSVINVVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVF 418

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LL+++  S    +VF++ + +  +  L +W  I + +I   RA+  Q    ++ +++AP
Sbjct: 419 GLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAP 478

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVF--LGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT 571
              +G+ +SL   + I   + +     +G       F   Y+  P++++FY G+K  KK 
Sbjct: 479 TDVWGSVYSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKN 538

Query: 572 --KIVKSHEVDLFTGKEVFDQQEIEGKILDQE 601
               +K+ ++D+ +G+   D + ++ +I +++
Sbjct: 539 WKLFIKASDIDIDSGRRETDIEALKQEIAEEK 570

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  244 bits (623), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 160/517 (30%), Positives = 266/517 (51%), Gaps = 20/517 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK+++ RHV M                     AGPA + I Y+ +G  ++  + A GEM
Sbjct: 125 LKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYCIIQAAGEM 184

Query: 159 A-SYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A +Y  +  GF +Y S  V P LGFAV + Y  ++  +CP +L  AS+ I+YW  +  VN
Sbjct: 185 AVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKYWTTK--VN 242

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
           P V++ IF  +I++INV G + + E EF+ +  K                    +   +G
Sbjct: 243 PDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGGAGNDGYIG 302

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW  PGAF+      D ++ +F    +  V A FA+ G E   + A+E  NPRK++P 
Sbjct: 303 GKYWHDPGAFRG-----DKAIDRFKGVAATLVTAAFAFGGSEFIALTASEQSNPRKAIPA 357

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K  ++RI+I +L +I ++G  V +N  +L+            P+V+AI + G+RV+PH
Sbjct: 358 AAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKAS--PYVIAISSHGVRVVPH 415

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
             NA +L+ V S  NS  Y  SR L SL+  G AP  F      G P  ++ +  LFA++
Sbjct: 416 FVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGALFAVI 475

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           A+   SS    VF + + +  +  + +W  I +++I F RA+ VQG    +  + +    
Sbjct: 476 AFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKSELGV 535

Query: 517 YGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYKFIKK-- 570
           +G+Y++ A  +F+  I  F V L     +  D ++F   Y+ + + + FY GY F KK  
Sbjct: 536 WGSYYA-AGMMFLVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFWKKDW 594

Query: 571 TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607
           T  +++ ++DL   +++FD+  +  +  D+E + +LR
Sbjct: 595 TLFIRAKDIDLDHHRQIFDEDVLRQE--DEETKEKLR 629

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  244 bits (624), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 150/517 (29%), Positives = 254/517 (49%), Gaps = 20/517 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK+ ++ RHV M                     AGPA + I Y  +G  ++  + A GE+
Sbjct: 150 LKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGEL 209

Query: 159 A-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A +Y  ++G F ++ S  VDP   FAV + Y  ++L +CP +L  +S+ I+YW  +  V+
Sbjct: 210 AVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK--VD 267

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
           P V++ IF V+I++IN  G K + E EF+ +  K                        +G
Sbjct: 268 PDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIG 327

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW  PGAF+  +      + +F   +  FV A FA+   E   + AAE  NPRK++P 
Sbjct: 328 AKYWNDPGAFRGQT-----KIERFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPS 382

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K   +RI++ +L +I L+G  V YN  +L+            P+V+A    G+ V+ H
Sbjct: 383 AAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSAS--PYVLAASLHGVHVVQH 440

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
             NA +L+ V S  NS  Y  SR L  LA  G AP  F      G P  S+    + A++
Sbjct: 441 FINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAIIAVI 500

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           A+   S     VF + + +  +  + +W  I +++I F R ++VQG    +  + A    
Sbjct: 501 AFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGV 560

Query: 517 YGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK-- 570
            G+Y++ A  +F+A +  F V L     H+ D +NF   Y+ +P+ +  Y G+K  ++  
Sbjct: 561 LGSYYA-AIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDF 619

Query: 571 TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607
              +++  +DL + + +FD++ +  +  D+E + +LR
Sbjct: 620 RLFIRAKNIDLISHRIIFDEELLRQE--DEEYKEKLR 654

>ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} similar
           to uniprot|Q03770 Saccharomyces cerevisiae YDR160W SSY1
           Component of the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p) which senses external amino
           acid concentration and transmits intracellular signals
           that result in regulation of expression of amino acid
           permease genes
          Length = 836

 Score =  248 bits (632), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 158/552 (28%), Positives = 265/552 (48%), Gaps = 62/552 (11%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +++ L+ RH+ M                     AGP    + +S  G +V  T+ +  E+
Sbjct: 262 IQRKLRVRHIQMIGIGACLGVGIFLTSGKAFSIAGPFGTLLGFSLSGSIVLATLLSFTEL 321

Query: 159 ASYIPMD-GFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           ++ IP+  GF+  ASR+V+ A GFA+G+ Y F  +I  P Q+ A +  ++Y+ D   +N 
Sbjct: 322 STLIPLSSGFSGLASRFVEDAFGFALGWTYWFSCMITMPTQVVACTFYLKYF-DSLNLNK 380

Query: 218 GV---WITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 274
           G    + T+F++  V++N+  V+  GE  +     K                     +DR
Sbjct: 381 GAIAGFATLFMLYAVLVNLLDVRLMGEIVYITGLIKIIISIIMILAMVILNSGTGTKYDR 440

Query: 275 LGFRYWQHP--------GAFKPYSD----------AIDGSVGKFVAFVSVFVYALFAYLG 316
           +GFR+W           G F+P  D           I+GS G+F+A  S  + + FAY G
Sbjct: 441 VGFRFWDSSKSSSNLTYGLFRPTFDLNDIGDGSTKGIEGSGGRFLALASTMLISTFAYTG 500

Query: 317 IELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLL-------- 368
           +E+  + + EA NPRK++P A K T   +++ Y+ TIF + + +   DPRL         
Sbjct: 501 VEMAFVASGEAINPRKTIPSATKRTFCIVLVIYVFTIFSVSINIYCGDPRLQPYFTGSYS 560

Query: 369 -------------------------XXXXXXXXXXXXPFVVAIQNSGIRVLPHIFNACVL 403
                                                P+V+A+QN G+     +FN  ++
Sbjct: 561 ARYQAVQRGVGSQWQLSHKCHTNIPYSTKDPVDHNSSPWVLALQNFGLCTFAAVFNGILI 620

Query: 404 IFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSS 463
            F   A  S L+  SR+LYS+AV  KAP IF+R    G+P+ S+    +F ++ Y+ V S
Sbjct: 621 FFTSGAEISSLFSSSRTLYSMAVQRKAPTIFQRCNKRGVPYVSVIFSGMFGVVGYLAVDS 680

Query: 464 GSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQ----GVDRSKFAYSAPFQPYGT 519
           G+ + FN   N+ S    + W+ + ++++ F  A+K +      D   + Y +PFQPY  
Sbjct: 681 GAVENFNVLSNMSSASTSIIWMGLNVSFLRFYYALKTRRDIISRDEKSYPYRSPFQPYLA 740

Query: 520 YFSL-AWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHE 578
           ++ L   C+FI F+  FT F+ H ++ K+F + Y GL +FV+ Y GYK I  +KI +  +
Sbjct: 741 FYGLFGCCLFIIFM-GFTNFIHHFWNVKSFFSAYGGLILFVVCYLGYKMIGTSKIQRLDQ 799

Query: 579 VDLFTGKEVFDQ 590
           +D+ TG+   D+
Sbjct: 800 LDMDTGRREMDR 811

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  243 bits (619), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 161/530 (30%), Positives = 255/530 (48%), Gaps = 25/530 (4%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           +  D LKK +++RHV M                     AGPAS+ I Y  V  + +F + 
Sbjct: 72  QSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQ 131

Query: 154 AIGEMASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GEMA   P    GF +YAS +V    GFA  + +  ++L + P +L  AS+ I+YW D
Sbjct: 132 AAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWND 191

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
           +  +N  V++ I  V ++ I+  GV+ +GE EF  +S K                     
Sbjct: 192 K--INADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGV 249

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +G +YW+ PGAF     A D +  +F     V V A F+Y G+EL  +   E  NPR
Sbjct: 250 DGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPR 304

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           +S P A K +++RI+I YL+T+ L+G  V +N  +L+            P+V+A+   G+
Sbjct: 305 RSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHAS--PYVLAVSIHGV 362

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           +V+PHI NA +LI V S  NS LY   R L SLA  G AP  F      G P  +L +C 
Sbjct: 363 KVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCS 422

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           +F ++A+   S     +F +   +  +  L +W  I ++++ F  A+K QG   ++  Y 
Sbjct: 423 IFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGY- 481

Query: 512 APFQPYGTYFSLAWCVF--IAFIKNFTVFLGHS-----FDYKNFITGYIGLPVFVIFYFG 564
                 G + SL  C F  + FI  F V L        +  + F   Y+  PV++ FY G
Sbjct: 482 --ISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLG 539

Query: 565 YKFIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFS 612
           Y    +  T +    ++DL   + ++D + +  +  D+E + R+R   ++
Sbjct: 540 YMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQE--DEETKERIRNGGWT 587

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  243 bits (619), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 163/528 (30%), Positives = 252/528 (47%), Gaps = 21/528 (3%)

Query: 100 KKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA 159
           KK +++RHV M                     AGPAS+ IAY  V  + +F + A GEMA
Sbjct: 94  KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMA 153

Query: 160 SYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
              P     F +Y S ++    GFA  + +  ++L + P +L  A++ I+YW    +++P
Sbjct: 154 VTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYW--NTSIDP 211

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
            V++ IF V ++ I+  GV+ +GE EF  ++ K                        +G 
Sbjct: 212 DVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGG 271

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW  PGAF     A      +F       V A F+Y G EL  +   +  NPRKS P A
Sbjct: 272 KYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAA 326

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K  V+RIV+ YL+T+ L+G  V +N   LL            P+V+A    GI+V+PHI
Sbjct: 327 AKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHAS-PYVLAASIHGIKVVPHI 385

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            NA +LI + S  NS LY G R L SLA  G AP         G P  +L +  L  ++ 
Sbjct: 386 INAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIG 445

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           +   S    +VF +   +  +  L +W  I  ++I F RA+K+Q        Y A    +
Sbjct: 446 FAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLW 505

Query: 518 GTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK-- 570
           G+YF + + + + F   F V L     G   D  +F   Y+ +P++++FYFGY    K  
Sbjct: 506 GSYFGVGFNILV-FAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDF 564

Query: 571 TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYE 618
           T +   ++VDL   ++V+D + +  +  D E + RLR + F ++ IYE
Sbjct: 565 TVLTDLNQVDLDNHRKVYDPEFLRQE--DLENKERLRNSSFLVK-IYE 609

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  243 bits (619), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 156/517 (30%), Positives = 260/517 (50%), Gaps = 16/517 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           + K+L  RH+                        GPAS+ I +  +   +F  + ++GE+
Sbjct: 96  MNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIISTCLFTVVNSLGEL 155

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A+  P+  GF  Y +R++DP+ GFAV   YL ++L+L P +L AAS+ I+YW D+  +N 
Sbjct: 156 AAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITIRYWNDK--INS 213

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             W+ IF   I   N+  VK FGE EF LS  K                   P    +G 
Sbjct: 214 DAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCGGGPKGGYIGG 273

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW  PGAF   +        KF    SVFV A F+Y G+ELT + AAE+ NPR+++P+A
Sbjct: 274 KYWHDPGAFVGETSGT-----KFKGLCSVFVTAAFSYSGMELTAVSAAESLNPRETIPKA 328

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K T W I + Y+  + L+G  V YN+P+LL            P V+AI+N GIR LP +
Sbjct: 329 AKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASS-PLVIAIENGGIRGLPSL 387

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            NA +LI + S  NS +Y  SR + S+A     P    R    G P  +  + + F LL+
Sbjct: 388 MNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATLLTLFFGLLS 447

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S    +VF +   +  +  + +W+ I +++I F +A+  QG+   +  Y +     
Sbjct: 448 FIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDELPYISMTGVS 507

Query: 518 GTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYK-FIKKTK 572
           G+++ +   +F+  + +F   L    G   D  +F  GY+  P+ ++ Y G+K +I+K +
Sbjct: 508 GSWYGVI-VLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGHKLYIRKKR 566

Query: 573 -IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRE 608
            ++   ++DL + ++V D +    ++  +++Q+  R 
Sbjct: 567 LLIDVADMDLVSDRKVVDVEVCREEMRIEKEQLAKRS 603

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  242 bits (617), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 155/521 (29%), Positives = 255/521 (48%), Gaps = 21/521 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK +++RHV M                      GP S+ I Y  V  + +F + A GEM
Sbjct: 75  LKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAGEM 134

Query: 159 ASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A   P     F SY S ++    GFA  + +  ++L + P +L  ASL I+YW   D +N
Sbjct: 135 AVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYW--NDKIN 192

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
             V+I IF V ++ I+  GVK +GE EF  +S K                        +G
Sbjct: 193 ADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIG 252

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW+ PG+F     A   SV KF     + V A F+Y G EL  +   E  NPRKS P+
Sbjct: 253 AKYWRDPGSF-----AEGDSVEKFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQ 307

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K +++RI+I YL+T+ L+G  V +N+ +L+            P+V+A    G++V+PH
Sbjct: 308 AAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHAS--PYVLAASIHGVKVVPH 365

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
             NA +LI V S  NS LY   R + SLA  G AP         G P  +L +C +F ++
Sbjct: 366 FINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVI 425

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
            +++ SS   +VF +   +  +  L +W  I ++++ F + +K+ G    +  + A    
Sbjct: 426 GFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGI 485

Query: 517 YGTYFSLAWCVFIAFIKNFTVFLG-----HSFDYKNFITGYIGLPVFVIFYFGYKFIKK- 570
           +G+ + +++ + + FI  F V L         D ++F   Y+  P+++ FYFGY   K+ 
Sbjct: 486 WGSMYGISFNMLV-FIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYMLYKRD 544

Query: 571 -TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENK 610
            T +V   ++DL   + ++D + I  +  D+E + +++ + 
Sbjct: 545 FTFLVPLDKIDLNFHRRIYDPELIRQE--DEENKEKIKNSS 583

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  241 bits (614), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 152/508 (29%), Positives = 260/508 (51%), Gaps = 19/508 (3%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           K  + + + L++RH+ +                      GPA + I+Y  +   V+  + 
Sbjct: 46  KPQNEMVRGLKSRHIQLIALGDAIGTGLFIGSGGALSTCGPAPILISYIVMSFFVWTIVN 105

Query: 154 AIGEMASYIPMDG---FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWI 210
            + EM + IP+ G     S A  YV   L F  G+   +   ++ P+++TA +++IQYW 
Sbjct: 106 QLTEMVALIPLPGEASMYSLARMYVGRPLAFMCGWNLFYAMAMIAPSEITACAMLIQYWT 165

Query: 211 DRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 270
           D    N  ++I+IF+V  V I +  V+ FGE EF +SS K                   P
Sbjct: 166 D---ANSAIFISIFIVFSVAITMLPVRVFGESEFCVSSIKLLTIVGLIIVGIVIFFGGGP 222

Query: 271 DHDR-LGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGI-ELTGIVAAEAY 328
             D  LGF YW+ PGAFK +   + GS GKF+A  +  + + F+++ + E     +AE+ 
Sbjct: 223 SQDHILGFHYWKKPGAFKEH--LVPGSTGKFLAVWTAIIKSGFSFVLVPETVASCSAESA 280

Query: 329 NPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXX-XXXXXXXPFVVAIQ 387
           +PR+++PRA +  V+R+ +FY+  + ++ + V  +D  LL             P+V+ I+
Sbjct: 281 SPRRNMPRACQRFVYRLALFYVAGVLVVTVVVGSDDANLLNAIHSGASNAAASPYVIGIK 340

Query: 388 NSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSL 447
            +GI+VLPHI NAC+L   +S   ++LY  SR L+S+A+ G AP IF +   +G+P+YS 
Sbjct: 341 EAGIKVLPHIINACILTSAYSCGTAELYGCSRILHSMAMKGDAPQIFAKVNRFGVPYYST 400

Query: 448 GVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAV-KVQGVDRS 506
            V  LF LLAY+N S  S+ VFN+  N+ +I G +SW+ + +TY  F   + K+   DR 
Sbjct: 401 AVACLFTLLAYLNCSKSSSLVFNWLSNIATISGFISWVFVSVTYTRFRTVIDKLDLNDRI 460

Query: 507 KFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYK 566
            F     FQ    Y  +A+ V ++    + VF+  +++  +F   Y+ +    + + G  
Sbjct: 461 PFRRR--FQKGFAYACIAFFVLLSLTNGYAVFIKGNWNTSDFFASYVTIGFVAVLFIGST 518

Query: 567 -FIKKTKIVKSHEVDLFTGKEVFDQQEI 593
            + K+ +     E+    G+E+  + +I
Sbjct: 519 IYYKELRFRDVSEI----GREIIPKIDI 542

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  241 bits (615), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 154/525 (29%), Positives = 259/525 (49%), Gaps = 19/525 (3%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           KH + LK+ +++RH+ M                      GPA   I +  +G+ V+  + 
Sbjct: 86  KH-ENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQ 144

Query: 154 AIGEMA-SYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GE+A  Y  +  GF +Y S  +DPALGFA  + Y  ++L + P +L  AS+ I++W  
Sbjct: 145 AAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPG 204

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
             +VNP +++ IF V+I++IN  G + + E EF+ +S K                     
Sbjct: 205 SRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGT 264

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +G +YW+ PG+    +         F   V+  V A F+    E   + AAE  NPR
Sbjct: 265 SGYIGGKYWRDPGSLGGRTH-----FDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPR 319

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           KS+P A K  +++I + +L ++ L+G  V  +   L+            P+V+A++  G+
Sbjct: 320 KSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVS--PYVIAVRMHGV 377

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
            V+P   NA +L+ V S  NS  Y  SR L+SLA    AP IFK     G P  ++ + +
Sbjct: 378 NVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISI 437

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           LF  + ++  S    +VF + + +  +  L +W  I +++I F RA+ VQG    +  + 
Sbjct: 438 LFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFK 497

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYKF 567
           A     G+Y S A  + +A I  F V L        D ++F TGY+ +P+F++FYFGYK 
Sbjct: 498 AQTGIIGSYVS-AIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKI 556

Query: 568 IKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENK 610
             K     +++ ++DL + + +FD   ++ +  D E + +LR + 
Sbjct: 557 WNKDWRLFIRADQIDLVSHRRIFDADVLKQE--DIEYRAKLRNSS 599

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  240 bits (613), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 160/516 (31%), Positives = 253/516 (49%), Gaps = 19/516 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +K+ +++RH++M                      GP  + I Y     +++  + A  E+
Sbjct: 76  MKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQACCEL 135

Query: 159 A-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
             SY  + G + SY S  VD    FAV + Y  ++ I+ P +L  +S+ I+YW   D++N
Sbjct: 136 GVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYW--NDSIN 193

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
           P V++ IF   IV I+  G + + E EF  +S K                        +G
Sbjct: 194 PDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGASKS-GYIG 252

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW  PGAF     AID     F    SV+V + FAY G E   + AAE  NPRKSVP+
Sbjct: 253 GKYWHTPGAFVG-EKAID----HFKGICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVPK 307

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K  ++R++I +L  I L+G  V Y+ P LL            PFV+A  + G++V+PH
Sbjct: 308 ATKRWLYRVLIVFLTPIILVGFLVPYDSP-LLLGSPGQAASHASPFVIAAASHGVKVVPH 366

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           I NA +LI V S  NS  Y   R L SLA  G  P +F      G P  ++    +F L+
Sbjct: 367 IINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGLI 426

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           +++  S     VF +   +VS+  L +W  I +++I F  A+K QG    +  Y A    
Sbjct: 427 SFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKANTGY 486

Query: 517 YGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYK-FIKK 570
           +G+++++A+ + I     F V +     G   D  NF   Y+  PV V FYFGYK + + 
Sbjct: 487 WGSWYAIAFNI-IVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWYRD 545

Query: 571 TKI-VKSHEVDLFTGKEVFDQQEIEGKILDQEKQIR 605
            K+ + + +VDL + +++FD   I+ +  + +++IR
Sbjct: 546 WKLFIPADKVDLESHRKIFDADLIKQEDFEHKERIR 581

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  239 bits (611), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 158/522 (30%), Positives = 249/522 (47%), Gaps = 23/522 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK +++RHV M                     +GPAS+ I Y  V  + +F + A GEM
Sbjct: 53  LKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGEM 112

Query: 159 ASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A   P     F SY S ++    GFA  + +  ++L + P +L  ASL ++YW   D +N
Sbjct: 113 AVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYW--NDKIN 170

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
             V+I IF   ++ I+  GVK +GE EF  +S K                        +G
Sbjct: 171 ADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYIG 230

Query: 277 FRYWQHPGAFKPYSDAIDGS-VGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVP 335
            +YW  PG+F       DG  + +F     + V A F+Y G EL  +   E  NPRKS P
Sbjct: 231 AKYWHDPGSFA------DGPPITRFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTP 284

Query: 336 RAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLP 395
            A K +++RI+I YL T+ L+G  V +N   L+            P+V+A     ++V+P
Sbjct: 285 AAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAGSAATHAS--PYVLAASLHSVKVVP 342

Query: 396 HIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFAL 455
           H  NA +LI V S  NS LY   R + SLA  G AP         G P   L +C LF +
Sbjct: 343 HFINAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGV 402

Query: 456 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQ 515
           + +++ SS   +VF +   +  +  L +W  I +++I F +A+K  G    +  + A   
Sbjct: 403 IGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTG 462

Query: 516 PYGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK 570
            +G+Y+  A+ + + FI  F V L     G   D + F   Y+  P++++FYFGY   K+
Sbjct: 463 IWGSYYGCAFNILV-FIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIYKR 521

Query: 571 --TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENK 610
             T +    ++DL   + ++D   I+ +  D+E + RL+ + 
Sbjct: 522 DFTILNPLEKIDLDFHRRIYDPDFIKQE--DEENKERLKNSS 561

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  240 bits (612), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 158/526 (30%), Positives = 257/526 (48%), Gaps = 21/526 (3%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           K  + LKK++++RHV M                     AGP S+ I Y  V  + +F + 
Sbjct: 81  KSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQ 140

Query: 154 AIGEMA-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GEM  +Y  + G F +Y S ++  + GFA  + +  ++L + P +L  +S+ I+YW  
Sbjct: 141 AAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTIKYW-- 198

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
            D++N  V+I IF V ++ I+  GVK +GE EF  +S K                     
Sbjct: 199 NDSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGV 258

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +G +YW+ PG+F   S+A      +F     + V A F++ GIEL  +   E  N R
Sbjct: 259 DGYIGGKYWRDPGSFADGSNAT-----RFKGICFILVTAYFSFGGIELFVLSINEQSNAR 313

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           KS P A K +V+RI+I YL+T+ L+G  V +N+ +L+            P+V+A     +
Sbjct: 314 KSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHAS--PYVLAASIHKV 371

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           RV+PHI NA +LI V S  NS LY   R + SLA  G AP         G P  +L VC 
Sbjct: 372 RVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAVCA 431

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           L  ++ ++  S    Q F +   +  +  + +W  I +++I F +A+KVQG    +  Y 
Sbjct: 432 LVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELGYK 491

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYK 566
           A    +G+Y+ + + + + F+  F V L     G   D + F  GY+  P+++  Y GY 
Sbjct: 492 ANTGIWGSYYGVFFNILV-FMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFMYLGYM 550

Query: 567 FIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENK 610
              K  T +    ++DL   + V+D + +  +  D+E + +LR + 
Sbjct: 551 LYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQE--DEENKEKLRNSS 594

>SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]
           {ON} similar to uniprot|Q03770 Saccharomyces cerevisiae
           YDR160W SSY1 Component of the SPS plasma membrane amino
           acid sensor system (Ssy1p-Ptr3p-Ssy5p) which senses
           external amino acid concentration and transmits
           intracellular signals that result in regulation of
           expression of amino acid permease genes
          Length = 850

 Score =  245 bits (625), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 164/582 (28%), Positives = 274/582 (47%), Gaps = 63/582 (10%)

Query: 93  PKHTD--GLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFF 150
           P H D   +++ L  RH+ M                     AGP    + +     +V  
Sbjct: 270 PGHNDVYHVQRKLHVRHLQMIAIGASLGVGLFLTSGKAFTVAGPFGTLLGFLLCASIVLA 329

Query: 151 TMAAIGEMASYIPMD-GFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYW 209
           TM +  E+++ IP+  GF+  ASR+V+ A GFA+G+ Y F ++I  PNQ+ A++ ++ Y+
Sbjct: 330 TMLSFTEISTLIPISSGFSGLASRFVEDAFGFALGWSYWFSFVIALPNQIVASTFMLSYY 389

Query: 210 --IDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXX 267
             ++  + +   ++T+FL+  + IN+  V+  GE  +  + FK                 
Sbjct: 390 EHLNVPSGSTAGFVTLFLLFAIFINLLDVRILGEILYGSTFFKILITVMMMIAMIALNAG 449

Query: 268 XXPD-HDRLGFRYWQHP--------GAFKPY----------SDAIDGSVGKFVAFVSVFV 308
                H R+GFRYW           G F+P            D I GS G+F+A + V +
Sbjct: 450 AGAHRHSRVGFRYWDSSKSPEGLTYGLFRPTFDLGDKGSGSLDGIGGSKGRFLAVLVVML 509

Query: 309 YALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLL 368
            + FA+ G+EL  + + EA NPRK++P A K T   I+I YL +IFL+G+ +   DPRLL
Sbjct: 510 ISSFAFSGVELAFVASGEAVNPRKTLPSATKRTFIIIIILYLFSIFLVGLNIYSGDPRLL 569

Query: 369 XXXXX------------------------------XXXXXXXPFVVAIQNSGIRVLPHIF 398
                                                     P+V+A+Q+ G+     + 
Sbjct: 570 RYYASPGKDVTIDDYGTKWQIETSCNKNLVVNLDGAINGSQSPWVLALQSFGLCTFSSVL 629

Query: 399 NACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAY 458
           N  ++ F  SA  S LY  SR+LYS+++ GKAP +F+R +  G+P+ S+  C  F + +Y
Sbjct: 630 NGILIFFGPSAGCSSLYASSRTLYSMSIQGKAPELFRRCSKKGIPYVSVLFCGAFGVTSY 689

Query: 459 MNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQ----GVDRSKFAYSAPF 514
           ++VS  S + F    N+ S    + W+ + I+++ F  A+K +      D   F Y +PF
Sbjct: 690 LSVSKESVENFQALANISSASICIIWMGLNISFLRFYYALKKRPDIISRDDPSFPYRSPF 749

Query: 515 QPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV 574
           QPY  ++ L     +     FT FL   ++ K F + Y GL  F + Y GYK    +KI 
Sbjct: 750 QPYLAFYGLLGSTILVLFMGFTTFLPGLWNTKVFFSAYGGLMFFTVCYLGYKTFGTSKIQ 809

Query: 575 KSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWI 616
           +  ++D+ +G+     +EI+  I D+  +      + ++ WI
Sbjct: 810 RLDQLDMDSGR-----REIDRMIWDEHHEYSDTFKERAIRWI 846

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  239 bits (609), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 156/523 (29%), Positives = 257/523 (49%), Gaps = 23/523 (4%)

Query: 93  PKHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTM 152
           P+ T  LK+ + +RH+ M                      GPA + I Y+ +G  ++  +
Sbjct: 74  PRETK-LKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCII 132

Query: 153 AAIGEMA-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWI 210
            A GEMA SY  + G F +Y S  +DPALGF+V + Y  ++L + P +L  A++ I+YW 
Sbjct: 133 QAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYWT 192

Query: 211 DRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXP 270
               VNP V++ IF V+ V++N+ G + + E EF+ ++ K                    
Sbjct: 193 T--AVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAG 250

Query: 271 DHDRLGFRYWQHPGAF---KPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEA 327
           +   LG +YW  PGA    KP        +  F   ++  V A FA+   E   + AAE 
Sbjct: 251 NDGYLGGKYWHDPGALYGTKP--------IHHFKGIIATMVTAAFAFGATEFIALTAAEQ 302

Query: 328 YNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQ 387
            NPR+++P A K  V+R+++ +L  I LLG  V YN   L+            P+V+AI 
Sbjct: 303 ANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHAS--PYVIAIA 360

Query: 388 NSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSL 447
           + G++V+PH  NA +L+ V S  NS  Y  SR L SL+    AP+        G P  ++
Sbjct: 361 SHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAM 420

Query: 448 GVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSK 507
            V  +F L+A++  S     VF + + +  +  L +WICI +++I F +A+ VQG    +
Sbjct: 421 LVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGE 480

Query: 508 FAYSAPFQPYGTYFS--LAWCVFIA-FIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFG 564
             Y +     G+Y++  +  CV    F            D  NF   Y+ +P+ +  YFG
Sbjct: 481 LGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFG 540

Query: 565 YKFIKKT-KI-VKSHEVDLFTGKEVFDQQEIEGKILDQEKQIR 605
           Y+  K+  K+ +   ++DL + ++VFD+  ++ +  + E+ IR
Sbjct: 541 YRVWKRDWKLYIPLEQIDLVSHRKVFDEDLLKQEDAEYEESIR 583

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  238 bits (607), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 156/526 (29%), Positives = 254/526 (48%), Gaps = 21/526 (3%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           +  + LKK++++RHV M                     AGP S+ I Y  V  + +F + 
Sbjct: 81  RSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFVTYFMVQ 140

Query: 154 AIGEMASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GEM    P     F +Y S +V  + GFA  + +  ++L + P +L  +S+ I+YW  
Sbjct: 141 AAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTVLPLELITSSMTIKYW-- 198

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
            DT+N  V+I IF V ++ I+  GVK +GE EF  +S K                     
Sbjct: 199 NDTINADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSVIINCGGAGV 258

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +G  YW++PG+F   S A      +F     + V A F++ GIEL  +   E  NPR
Sbjct: 259 DGYIGGEYWRNPGSFADGSSAT-----RFKGICFILVTAYFSFGGIELFVLSINEQANPR 313

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           KS P A K +++RI+I YL+T+ L+G  V +++ +L+            P+V+A    G+
Sbjct: 314 KSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSGSSATHAS--PYVLAASIHGV 371

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           +V+PHI NA +LI V S  NS LY   R + SLA  G AP         G P  +L VC 
Sbjct: 372 KVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCS 431

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
              L+ ++  SS   Q F +   +  +  + +W  I +++I F +A+KVQG    +  Y 
Sbjct: 432 FVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLDEVGYK 491

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLG-----HSFDYKNFITGYIGLPVFVIFYFGYK 566
           +    +G+Y+ + + + + F+  F V L         D ++F   Y+  P+++  Y GY 
Sbjct: 492 SNTGIWGSYYGVIFNILV-FMAQFWVALSPPGSDGKCDVESFFQSYLAAPLWIFMYLGYM 550

Query: 567 FIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENK 610
              K  T +    ++DL   + V+D + +  +  D+E + RLR + 
Sbjct: 551 IYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQE--DEENKERLRNSS 594

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  236 bits (602), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 157/514 (30%), Positives = 241/514 (46%), Gaps = 21/514 (4%)

Query: 97  DGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIG 156
            G+K+ L+ RH+S+                      GP ++ + +  +G++ F  M +IG
Sbjct: 40  SGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIMESIG 99

Query: 157 EMASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTV 215
           E+ +  P  G F + A R+    L    GY Y+  +  +  N+    S ++Q+W  +  +
Sbjct: 100 ELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIVVFFAVLANEYNTISSILQFWGPQVPI 159

Query: 216 NPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRL 275
               +  IF    ++  + GV  FGE E+WL+ FK                   P    +
Sbjct: 160 YG--YTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFYIFSIVYMSGGIPGKPPI 217

Query: 276 GFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVP 335
           GF+YW++PGA              F     VFV+    Y G E   + A E+ NPRK+VP
Sbjct: 218 GFQYWKNPGALSH----------GFRGIAVVFVFCSTFYSGTESVALAATESRNPRKAVP 267

Query: 336 RAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLP 395
            AV+ T WRI+I YL   F  G+ V YNDP L             P  +A+  +G     
Sbjct: 268 LAVRQTFWRILIVYLGISFFYGVTVPYNDPTL----GAQTKSLKSPISIALSRAGWAGGV 323

Query: 396 HIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFAL 455
           H+ NA +L+   SA NS LY+GSR+L  LA +G AP I   T   G+P  +L V     L
Sbjct: 324 HLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPVPALIVFNALGL 383

Query: 456 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQ 515
           ++ MNVS G++  +NY VN+  +   + W  I IT++ F +A   QG   S+  Y A F 
Sbjct: 384 ISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRSLSELPYRALFY 443

Query: 516 PYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT--KI 573
           P+ T FSLA  +F+A I+ +T  +   F  K+F+  YI LP   + Y G  F K    K 
Sbjct: 444 PWTTIFSLAANIFLALIQGWTSLV--PFVAKDFVDAYILLPAAGLLYVGINFWKNRNFKT 501

Query: 574 VKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607
           V  H ++L  G+     ++ + +     K  R++
Sbjct: 502 VNIHGINLEEGQRRDLDEDSDDETGTAPKSTRMK 535

>AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL274W
           (SAM3)
          Length = 497

 Score =  234 bits (598), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 146/487 (29%), Positives = 240/487 (49%), Gaps = 39/487 (8%)

Query: 132 AGPASMFIAYSFVGILVFFTMAAIGEMASYIPMDG-FTSYASRYVDPALGFAVGYCYLFK 190
           +GP ++ I +  VG+ +F  + +  E++   P+ G F+S+ SR+++P+LGF V   Y   
Sbjct: 22  SGPGTLLIGFLIVGVSIFCVIQSAAELSCQYPVSGSFSSHVSRFIEPSLGFTVSCAYALS 81

Query: 191 YLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFK 250
           +LI  PN+L   ++ I YW   + + P VW+ I  ++++ +N+  V+ F E EFWLS  K
Sbjct: 82  WLISFPNELVGLAMTIGYW--NEDIPPAVWVLIGYLLVIGLNLFAVRGFAESEFWLSIIK 139

Query: 251 XXXXXXXXXXXXXXXXXXXPDHDR--LGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFV 308
                              P++    LG +YW  PGAF+P           F +    FV
Sbjct: 140 VLAIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAFRP---------PFFSSLCQTFV 190

Query: 309 YALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLL 368
            A F + G EL  + A E+    +S+ RA K T WRI IFY+ T+ ++G  V Y  P L 
Sbjct: 191 SAAFTFGGAELVLLTANES-RKIESISRAAKGTFWRIAIFYISTVIVIGCLVPYTSPAL- 248

Query: 369 XXXXXXXXXXXXPFVVAIQNSGI--RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAV 426
                       PFV+A+ N+G     + H  NA ++  V S CNS +Y  SR + SL  
Sbjct: 249 ----DGESIRASPFVIALSNTGSFGTNVSHFMNAVIVAAVLSVCNSCVYAASRVIQSLGA 304

Query: 427 DGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWIC 486
            G+ P IF      G P   +GVC +F LLA++  ++    VFN+   + SI     W C
Sbjct: 305 CGQLPEIFGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWLFALCSIAAFFVWFC 364

Query: 487 IFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLGHSF--- 543
           I ++ + + RA+KVQG    + AY +            W   I  + NF +  G  +   
Sbjct: 365 ICVSQLRYRRALKVQGFPTEEIAYQSMLG--------KWSGVIGTLLNFLLICGEIYVSV 416

Query: 544 ---DYKNFITGYIGLPVFVIFYFGYKFIK---KTKIVKSHEVDLFTGKEVFDQQEIEGKI 597
              D + F    + +P+ +IFYF ++  +   KT ++ + ++DL TG++  D + ++ ++
Sbjct: 417 KDGDVETFFQNCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGRKPEDLEMMKHEL 476

Query: 598 LDQEKQI 604
           +    +I
Sbjct: 477 IVSRARI 483

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  237 bits (605), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 158/525 (30%), Positives = 254/525 (48%), Gaps = 21/525 (4%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           K  + LKK++++RHV M                     AGP S+ I Y  V  + +F + 
Sbjct: 81  KSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQ 140

Query: 154 AIGEMASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GEM    P     F +Y S ++  + GFA  + +  ++L + P +L  +S+ ++YW  
Sbjct: 141 AAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYW-- 198

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
            DT+N  V+I IF V ++ I+  GVK +GE EF  +S K                     
Sbjct: 199 NDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGV 258

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +G +YW+ PG+F   S A      +F     + V A F++ GIEL  +   E  NPR
Sbjct: 259 DGYIGGKYWRDPGSFAEGSGAT-----RFKGICYILVSAYFSFGGIELFVLSINEQSNPR 313

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           KS P A K +V+RI+I YL+T+ L+G  V +N+ +L+            P+V+A     +
Sbjct: 314 KSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHAS--PYVLAASIHKV 371

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           RV+PHI NA +LI V S  NS LY   R + SLA  G AP         G P  +L VC 
Sbjct: 372 RVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCS 431

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           L  ++ ++  S    Q F +   +  +  L +W  I +++I F +A+KVQG    +  Y 
Sbjct: 432 LVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYK 491

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYK 566
           A    +G+Y+ + + + + F+  F V L     G   D + F   Y+  P+++  Y GY 
Sbjct: 492 ANTGIWGSYYGVFFNMLV-FMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYM 550

Query: 567 FIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609
             K+  T +    ++DL   + V+D + +  +  D+E + RL+ +
Sbjct: 551 VYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQE--DEENKERLKNS 593

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  236 bits (603), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 146/512 (28%), Positives = 247/512 (48%), Gaps = 29/512 (5%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +KK++++RH+ M                     AGPA + I Y+   I+++  + A GE+
Sbjct: 70  MKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLYCIIQAAGEL 129

Query: 159 A-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
              Y  M G +T+Y+S  VDPALGF+V + Y  +++ + P QL  A++ ++YW +    N
Sbjct: 130 GICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVRYWTN---AN 186

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
           P +++ +F VVI++IN+ G K + E EF  +  K                        +G
Sbjct: 187 PDIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAINCGGAGTSGYIG 246

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW  PG+F             F     VF YA F+Y GIE+  + A+E  NPRKS+P 
Sbjct: 247 AKYWHSPGSF----------AAGFKGVCYVFCYAAFSYGGIEVMVLTASEQENPRKSIPN 296

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K  ++RI++ Y++T  ++   V YN   L+            P V+A+ + G++++PH
Sbjct: 297 ACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHAS-PLVIAVASHGVKIVPH 355

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           I NA +LI V S  NS +Y   R L SL+  G AP         G P     + +L AL+
Sbjct: 356 IINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAITLLVALI 415

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           A++  S     +F + + +  +  +  W  I ++++ F  A+  QG+   +  Y +    
Sbjct: 416 AFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGYKSQTGY 475

Query: 517 YGTYFSLAWCVFIAFIKNFTVFLG-----HSFDYKNFITGYIGLPVFVIFYFGYKFIKK- 570
           +G++F++   V +  I  F V +         + + F   Y+  P+ +  YFGYK   K 
Sbjct: 476 WGSWFAIVISVLV-LIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLGAYFGYKVYHKD 534

Query: 571 -TKIVKSHEVDLFTGKEVFDQQEIEGKILDQE 601
               + + EVDL + + + D++     IL QE
Sbjct: 535 WRLCIPASEVDLSSHRNISDEE-----ILRQE 561

>YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}
           AGP2High affinity polyamine permease, preferentially
           uses spermidine over putrescine; expression is
           down-regulated by osmotic stress; plasma membrane
           carnitine transporter, also functions as a low-affinity
           amino acid permease
          Length = 596

 Score =  236 bits (603), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 142/502 (28%), Positives = 245/502 (48%), Gaps = 9/502 (1%)

Query: 100 KKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA 159
           ++ L+ RHV +                      GPAS+ +A++   + +     +  EM 
Sbjct: 85  RRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMV 144

Query: 160 SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
            + P+   F   A++ VD +L     + + F   +  P ++ + + +I YW  RD  + G
Sbjct: 145 CFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAG 202

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
           + + + +V+ ++I++  VK++GE EFWL+SFK                   P+HDR GFR
Sbjct: 203 IPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFTFTFITMLGGNPEHDRYGFR 262

Query: 279 -YWQHP-GAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            Y + P   + P  + +  S G F  F++  + A F   G E   ++A E   PRK +P+
Sbjct: 263 NYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPK 322

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGIRVLP 395
           A K    R+   +L +   +G+  + NDP L              P+V+A+ N  IR+LP
Sbjct: 323 AFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILP 382

Query: 396 HIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFAL 455
            I N  ++   FSA N+  Y  SR+ Y +A+DG AP IF R    G+P YS+ + +++AL
Sbjct: 383 DIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTRCNRHGVPIYSVAISLVWAL 442

Query: 456 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQ 515
           ++ + ++S SA V N+ +N+++   L++++ + I Y+ F RA  VQ     K  + +  Q
Sbjct: 443 VSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYLFFRRAYHVQQDSLPKLPFRSWGQ 502

Query: 516 PYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFI---KKTK 572
           PY     L  C  +  I+ +TVF    ++ ++F+  Y+ + + +  Y GYKFI    K  
Sbjct: 503 PYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLFSYLMVFINIGIYVGYKFIWKRGKDH 562

Query: 573 IVKSHEVDLFTGKEVFDQQEIE 594
               HE+D        +  EIE
Sbjct: 563 FKNPHEIDFSKELTEIENHEIE 584

>KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 599

 Score =  236 bits (603), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 151/519 (29%), Positives = 251/519 (48%), Gaps = 31/519 (5%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L+K L  RH+ M                     +GP S+ I +  VG+++F  + +  E+
Sbjct: 85  LQKTLSQRHL-MMIAIGGTLGTGLFIGIGYSLSSGPGSLLIGFLIVGLMMFCVVQSAAEL 143

Query: 159 ASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+ G +  + SR+++P++GF V   Y   +LI  P++L   ++ +QYW    +VNP
Sbjct: 144 ACQYPVSGSYAVHVSRFMEPSIGFTVATNYALAWLISFPSELIGCAMTLQYW--NKSVNP 201

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR-LG 276
            VW+ IF V I+ +N+ GV+ +GE EFW+S FK                   P+    +G
Sbjct: 202 AVWVAIFYVFIMSLNMFGVRSYGEAEFWMSLFKVVAIVIFIIIGIVLICGGGPNSTGYIG 261

Query: 277 FRYWQHPGAF-KPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVP 335
            +YW  PG+F KP           F    + FV A F++ G EL  + A+E+    +SV 
Sbjct: 262 TKYWHDPGSFAKPV----------FKGLCNTFVSAAFSFGGAELVVLTASES-RKVESVS 310

Query: 336 RAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI--RV 393
           RA K T WRI IFY+ T+ ++G  V Y + +LL            PFV+A+   G     
Sbjct: 311 RAAKGTFWRIAIFYITTVIVIGCLVPYTNEQLLGGDNDEDITAS-PFVIALSGQGSMGTK 369

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
             H  N  +LI V S CNS +Y  SR + +L V G+ P I       G P   + +C +F
Sbjct: 370 ASHFMNTVILIAVLSVCNSAVYASSRIIQALGVCGQLPKICGYVDQKGRPLVGIAICGVF 429

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LL ++  S     VF +   + SI    +W CI  + + F  A++ QG    + A+ + 
Sbjct: 430 GLLGFLVASDNEGDVFTWLFALCSISSFFTWFCICASQVRFRFALRAQGRSSDEIAHKSM 489

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVF-----LGHSFDYKNFITGYIGLPVFVIFYFGYK-F 567
              YG +     C+  A +    ++     LG     K F    + +P+ +  Y G+K F
Sbjct: 490 LGIYGGFLG---CLLNALLIAGEIYVSIFPLGGDPSAKQFFQYCLSIPIMIAVYIGHKLF 546

Query: 568 IKKTK--IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQI 604
             K+K  ++ + E+DL TG+++ D ++ + ++L+ ++++
Sbjct: 547 ANKSKRVLIPAQEIDLETGRKIKDLEQFKHEVLEDKEKL 585

>Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON}
           YBR132C (REAL)
          Length = 597

 Score =  235 bits (600), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 141/507 (27%), Positives = 247/507 (48%), Gaps = 9/507 (1%)

Query: 100 KKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA 159
           ++ L+ RHV +                      GPAS+ +A++   + +     +  EM 
Sbjct: 86  RRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMV 145

Query: 160 SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
            + P+   F   A++ VD +L     + + F   +  P ++ + + +I YW  RD  + G
Sbjct: 146 CFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAG 203

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
           + + + +V+ ++I++  VK++GE EFWL+SFK                   P HDR GFR
Sbjct: 204 IPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFITMLGGNPRHDRYGFR 263

Query: 279 -YWQHP-GAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            Y + P   + P  + +  S G F  F++  + A F   G E   ++A E   PRK +P+
Sbjct: 264 NYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPK 323

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGIRVLP 395
           A K    R+   +L +   +G+  + NDP L              P+V+A+ N  IR+LP
Sbjct: 324 AFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILP 383

Query: 396 HIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFAL 455
            I N  ++   FSA N+  Y  SR+ Y +A+DG AP +F R    G+P YS+G+ +++AL
Sbjct: 384 DIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVGISLIWAL 443

Query: 456 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQ 515
           ++ + ++S SA V N+ +N+++   L++++ + I Y+ F RA +VQ     +  + +  Q
Sbjct: 444 VSLLQLNSNSAVVLNWLINLITASQLINFVVLCIIYLFFRRAYRVQQDSLPRLPFRSWGQ 503

Query: 516 PYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFI---KKTK 572
           PY     L  C  +  I+ +TVF    +  ++F+  Y+ + + +  Y GYKFI    K  
Sbjct: 504 PYTAIIGLVSCSAMILIQGYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIWKRGKDS 563

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILD 599
           +   H++D        +  EIE    D
Sbjct: 564 LKNPHDIDFSKELTEIENHEIECSFGD 590

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  236 bits (601), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 156/522 (29%), Positives = 248/522 (47%), Gaps = 22/522 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           +KK+L+ARHV M                      GPAS+ I Y  V  +V+F + A GEM
Sbjct: 90  MKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSFIVYFMIQAAGEM 149

Query: 159 ASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A   P     F +Y S ++  + GFA  + +  +++ + P +L  +SL IQYW D   +N
Sbjct: 150 AVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSLTIQYWTD---LN 206

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
             +++ IF V +++I+  GVK +GE EF  +  K                    +   +G
Sbjct: 207 GDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNCGGAGNDGYIG 266

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW  PG+F     A  G   +F     V V   F+Y G EL  +   E   PRK+ P 
Sbjct: 267 GKYWHTPGSF-----AEGGPTSRFKGICYVLVAGYFSYGGTELYVLSVNEQAEPRKATPA 321

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K +++RI++ YL+T+ L+G  V +N  +L+            P+V+A    G++V+PH
Sbjct: 322 AAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHAS--PYVLAASIHGVKVVPH 379

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           I NA +LI V S  NS LY   R L SLA  G AP         G P  +L +C +F  +
Sbjct: 380 IINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLCAVFGCI 439

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           A++  S    QVF +   +  +  + +W  I  +++ F  A+KVQ  D  +  Y A    
Sbjct: 440 AFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYKATAGI 499

Query: 517 YGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK- 570
           YG++F   + V +  I  F V L     G +   ++F   Y+ +P++V FY  Y    K 
Sbjct: 500 YGSWFGSIFGVLV-LIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVYSVYNKE 558

Query: 571 -TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
            T +    ++DL   + ++D   I  +  D E + +L+ + F
Sbjct: 559 WTILTDLSKIDLDAHRRIYDPDLIRQE--DAENKEKLKNSPF 598

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  234 bits (596), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 162/522 (31%), Positives = 242/522 (46%), Gaps = 31/522 (5%)

Query: 98  GLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGE 157
           G+K+ L+ RH+S+                      GP S+ + +  +GI+ F  M +IGE
Sbjct: 43  GVKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESIGE 102

Query: 158 MASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           M +  P   GF++ + R+   AL    GY Y+  +  +  N+    S ++Q+W       
Sbjct: 103 MITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFW------G 156

Query: 217 PGV----WITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
           P V    +I IF V   +  + GV  FGEFE+WL+ FK                    + 
Sbjct: 157 PQVPLYGYILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNR 216

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
              GF YW +PGA        DG    F     VFV+    Y G E   + A E+ NP K
Sbjct: 217 PAFGFHYWNNPGALA------DG----FKGIAVVFVFCSSFYSGTESVALAATESRNPGK 266

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           +VP A+K T WRI+I YL      G  V YND  L             P  +AI  +G  
Sbjct: 267 AVPIAIKQTFWRIIIVYLGIAVFYGATVPYNDTSL----GAHTKALKSPIAIAITRAGWE 322

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
              H+ NA +LI   SA N  LY+GSR+L  LA +G AP   K T   G+P  ++ +   
Sbjct: 323 GGVHLVNAFILITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNA 382

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
             L++ MNVS G++  ++Y VN+  +   + W  I +T++ F +A  +QG   S+  Y +
Sbjct: 383 LGLVSLMNVSVGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASELPYKS 442

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT- 571
              P+G  FSLA  +F+  I+ +T F+   F  K+F+  YI LP  VI Y     +K   
Sbjct: 443 LLFPWGPIFSLAANIFLGLIQGWTTFV--PFSAKDFVDAYILLPAAVILYIVISLVKIGG 500

Query: 572 -KIVKSHEVDLFTG-KEVFDQQEIEGKILDQEKQIR-LRENK 610
            K+V    VDL  G +E  D    +     +++ +R  + NK
Sbjct: 501 FKLVDLRTVDLEEGRREDLDSDGTDEDSEGKDRSVRSAKRNK 542

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  235 bits (599), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 157/527 (29%), Positives = 255/527 (48%), Gaps = 21/527 (3%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           K  + LKK++++RHV M                     AGP S+ I Y  V  + +F + 
Sbjct: 81  KSNNRLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQ 140

Query: 154 AIGEMASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GEM    P     F +Y S ++  + GFA  + +  ++L + P +L  +S+ I+YW D
Sbjct: 141 AAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWND 200

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
           +  +N  V+I IF V ++ I+  GVK +GE EF  SS K                     
Sbjct: 201 K--INSDVFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGV 258

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +G +YW+ PG+F   + A      +F     + V A F++ GIEL  +   E  NPR
Sbjct: 259 DGYIGGKYWRDPGSFAEGNGAT-----RFKGICFILVTAYFSFGGIELFVLSINEQSNPR 313

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           KS P A K +V+RI+I YL+T+ L+G  V +N+ +L+            P+V+A     +
Sbjct: 314 KSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHAS--PYVLAASIHKV 371

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           RV+PHI NA +LI V S  NS LY   R + SLA  G AP         G P  +L VC 
Sbjct: 372 RVVPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCC 431

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           L  ++ ++  S    Q F +   +  +  L +W  I +++I F +A+KVQG    +  Y 
Sbjct: 432 LVGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYK 491

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYK 566
           A    +G+Y+ + + + + F+  F V L     G   + + F   Y+  P+++  Y GY 
Sbjct: 492 ANTGIWGSYYGVFFNILV-FMAQFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGYM 550

Query: 567 FIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
             ++  T +    ++DL   + V+D + I  +  ++E + RL+ + F
Sbjct: 551 LYERDFTFLNPLDKIDLDYHRRVYDPEIIRQE--NEENKERLKNSSF 595

>Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON}
           YBR132C (REAL)
          Length = 598

 Score =  234 bits (598), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 142/502 (28%), Positives = 243/502 (48%), Gaps = 9/502 (1%)

Query: 100 KKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA 159
           ++ L+ RHV +                      GPAS+ +A++   + +     +  EM 
Sbjct: 87  RRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMV 146

Query: 160 SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
            + P+   F   A++ VD +      + + F   +  P ++ + + +I YW  RD  + G
Sbjct: 147 CFFPVSSPFLRLATKCVDDSFAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAG 204

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
           + + + +V+ ++I++  VK++GE EFWL+SFK                   P HDR GFR
Sbjct: 205 IPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFITMLGGNPKHDRYGFR 264

Query: 279 -YWQHP-GAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            Y + P   + P    +  S G F  F++  + A F   G E   ++A E   PRK +P+
Sbjct: 265 NYGESPFKKYFPDGKDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPK 324

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGIRVLP 395
           A K    R+   +L +   +G+  + NDP L              P+V+A+ N  IR+LP
Sbjct: 325 AFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILP 384

Query: 396 HIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFAL 455
            I N  ++   FSA N+  Y  SR+ Y +A+DG AP +F R    G+P YS+ + +++AL
Sbjct: 385 DIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVAISLVWAL 444

Query: 456 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQ 515
           ++ + ++S SA V N+ +N+++   L++++ + ITY+ F RA  VQ     K  + +  Q
Sbjct: 445 VSLLQLNSNSAVVLNWLINLITASQLINFVVLCITYLFFRRAYHVQQDSLPKLPFRSWGQ 504

Query: 516 PYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFI---KKTK 572
           PY     L  C  +  I+ +TVF    +  ++F+  Y+ + + +  Y GYKFI    K K
Sbjct: 505 PYTAIIGLVSCSAMILIQGYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIWKRGKDK 564

Query: 573 IVKSHEVDLFTGKEVFDQQEIE 594
               HE+D        +  EIE
Sbjct: 565 FKNPHEIDFSKELVEIENHEIE 586

>TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {ON}
           Anc_3.284 YDR046C
          Length = 664

 Score =  235 bits (600), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 157/523 (30%), Positives = 244/523 (46%), Gaps = 20/523 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK +++RHV M                     +GPA + I Y  V I+ +  + A GEM
Sbjct: 143 LKKTMKSRHVVMMSLGTGIGTGLLVSNASCLSLSGPAPLVIGYGLVSIITYLLIQAAGEM 202

Query: 159 ASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
               P     F +Y S ++   +GFA  +    ++L + P +L AAS+ I+YW    +++
Sbjct: 203 GVAYPTLPGNFNTYISTFLSRPIGFATIWLSSIQWLTVVPLELIAASMTIKYWTT--SIS 260

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
           P V++ IF V +  I+  G   +GE EF  +  K                        +G
Sbjct: 261 PDVFVVIFYVFLNFIHFFGTAAYGETEFIFNLCKILMIIGFIILSIVINCGGAGHDGYIG 320

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW  PGAF         S  +F     + V A F+Y G EL  +   E  NPRKS P 
Sbjct: 321 GKYWHTPGAF-----VGKNSASRFKDVCYILVTAFFSYGGTELFVLTINEQPNPRKSTPT 375

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXX-XXXXXXPFVVAIQNSGIRVLP 395
           A K T++RI+I YL+T+ LLG  V Y++  L              P+V+A    G++V+P
Sbjct: 376 AAKTTIYRILIVYLLTMILLGFNVPYDNKNLFSATSSNGDSISISPYVLAASIHGVKVVP 435

Query: 396 HIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFAL 455
           H  NA VLI + S  NS  Y   R + SLA  G AP         G P Y L +C L  +
Sbjct: 436 HFINAVVLIALISVANSATYAAPRMMASLAQQGMAPKFLAYIDREGRPIYGLLICSLLGV 495

Query: 456 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQ 515
           + +   S    +VF +   +  +  L  W C F+++I F  A+KVQG D ++  Y A   
Sbjct: 496 IGFAAASDKEQEVFVWLAAIAGLATLFLWECFFLSHIRFRWAMKVQGKDINEVGYKAACG 555

Query: 516 PYGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK 570
            +G+     + V +  I NF V L     G +   KNF    + LP+++ F  GY  IKK
Sbjct: 556 IWGSIIGACFNVLV-LIANFWVSLTPPGQGSNVSAKNFFEQMLALPIWIFFAVGYMVIKK 614

Query: 571 TKIVKS--HEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKF 611
             ++ +    +DL   ++++D ++++ +  D+E + R+R   F
Sbjct: 615 DWVIWNPIESIDLDYCRKIYDPEQLKRE--DEENRERIRNAGF 655

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  233 bits (595), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 151/518 (29%), Positives = 250/518 (48%), Gaps = 20/518 (3%)

Query: 100 KKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA 159
           KK+L +RHV M                      GP S+ I Y  V  + +F + A GEMA
Sbjct: 78  KKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLIIGYVLVSFVTYFMIQAAGEMA 137

Query: 160 SYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
              P     F +Y S ++  + GFA  + +  ++L + P +L  +SL I+YW   D +N 
Sbjct: 138 VAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLPLELITSSLTIKYW--NDKINA 195

Query: 218 GVWITIFLVVIVIIN-VAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
            +++ IF V +V I+ V G++ +GE EF  +S K                    +   +G
Sbjct: 196 DIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGFIILSIVINAGGAGNDGYIG 255

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW  PG+F     A   +  +F     V V   F+Y G EL  +   E   PRK+ P 
Sbjct: 256 GKYWHEPGSF-----AEGDATSRFKGICLVLVSGYFSYGGTELYVLSVNEQAEPRKATPA 310

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K +++RI+I YL+T+ L+G  V +N+ +L+            P+V+A    G++++PH
Sbjct: 311 AAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHAS--PYVLAATIHGVKIVPH 368

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
             NA +LI V S  NS L+ G R L SLA  G AP I       G P  +LG+  L  L+
Sbjct: 369 FINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDREGRPLVALGISFLIGLI 428

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           A+++ +S   +VF +   +  +  + +W  I  +++ F  A+KVQG D ++  Y A    
Sbjct: 429 AFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQGKDINELGYKANTGV 488

Query: 517 YGTYFSLAWCVFIAFIKNFTVFL-----GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK- 570
           +G+ +   + V +  I  F V L     G   D + F   Y+  P++V  YFGY    K 
Sbjct: 489 WGSAYGAFFGVLV-LIAQFWVALAPIGNGGKCDAEAFFESYLAFPIWVACYFGYMIYNKD 547

Query: 571 -TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607
            T +    ++DL + + ++D + I+ +  + ++ ++ R
Sbjct: 548 FTLLSPLDKIDLDSYRRIYDPELIKQEDEENKENLKSR 585

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  233 bits (594), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 148/515 (28%), Positives = 255/515 (49%), Gaps = 19/515 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK++L+ RH+ M                      GPA++ +A+   G +V+  + AIGE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 159 ASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
              +P+ G + SY SR++DP+ GFA+ Y YL   L+  P ++ AAS+ + YW + D    
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYW-NVDHKYA 202

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR-LG 276
             ++ +F V +++IN  GVK +GE EF  S  K                    ++   +G
Sbjct: 203 DGFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIG 262

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW +PG F             F  F ++FV + F++ G E+  + AAE+ NPR+ +P+
Sbjct: 263 TKYWHNPGGFAH----------GFKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPK 312

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A K   WRI +FYL+++ L+G  V Y +  L             PFV+AI+ +GI  LP 
Sbjct: 313 AAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASAS--PFVIAIKEAGISGLPS 370

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           + N  +L+ V S  N+ ++  SR+  SLA  G  P  F      G P   L + ++F LL
Sbjct: 371 VINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLL 430

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           ++++ S     VF + + V  +    +W  I + ++ F + ++ QG    + A+ A    
Sbjct: 431 SFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGI 490

Query: 517 YGTYFSLAW-CVFIAFIKNFTVF-LGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT--K 572
           +G+ + +    V + F     +F L  S    +F   Y+ LPV ++FY G+K   +    
Sbjct: 491 WGSIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRNWRL 550

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607
           ++ + E+DL TG+   D + ++ +I ++ + IR R
Sbjct: 551 VIPAKELDLDTGRREVDLELLKQEIKEENESIRSR 585

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  234 bits (596), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 150/494 (30%), Positives = 239/494 (48%), Gaps = 23/494 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L K ++ RH+ M                     +GPA + I Y    I+++  + A GE+
Sbjct: 106 LNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMIYCVVQAAGEL 165

Query: 159 A-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
              Y  + G +T+Y +  +DPA+GFAV   Y  ++L + P QL  A++ I+YW     VN
Sbjct: 166 GLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTIRYW--TTNVN 223

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
           P +++   LV+++ IN+ G K + E EF+ +  K                    D + +G
Sbjct: 224 PDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIVINCGGAGDKEYIG 283

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YWQ PGAF             F    +VF YA F+Y GIE+  + A E  NPRK++P 
Sbjct: 284 VKYWQTPGAFA----------NGFKGVAAVFCYAAFSYGGIEVLVLTANEQANPRKAIPD 333

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
           A +  V+R++  Y++T  ++   V YN P LL            PFV+A+ + G++V+PH
Sbjct: 334 ACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSDASPFVIAVASHGVQVVPH 393

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           I NA +LI V S  NS LY G R L SL+  G AP  F      G P   + V V   L+
Sbjct: 394 IINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRRGRPIICVLVSVAMGLI 453

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQ-GVDRSK--FAYSAP 513
           A++       +VF + + V  +  +  W+ I I+++ F  A++ Q G  R++    Y+A 
Sbjct: 454 AFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAIRSQLGGLRARDVVEYTAQ 513

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVF--LGHS--FDYKNFITGYIGLPVFVIFYFGYKFIK 569
               G+  +LA  +FI   + +     LGH+   D + F   Y+  PV +  Y  YK   
Sbjct: 514 TGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLDVQIFFENYLAAPVLLGGYLAYKIWH 573

Query: 570 K--TKIVKSHEVDL 581
           +     + ++E+DL
Sbjct: 574 RDWRLCIPANEIDL 587

>TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.342
           YDR160W
          Length = 840

 Score =  237 bits (604), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 152/557 (27%), Positives = 263/557 (47%), Gaps = 59/557 (10%)

Query: 93  PKHTD-GLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFT 151
           P H    +++ L+ RH+ M                     AGP    + ++  G +VF +
Sbjct: 259 PGHAKYHVQRKLRVRHIQMIGIGACISVGICLTSGKAFSIAGPFGTLLGFAISGSVVFAS 318

Query: 152 MAAIGEMASYIPMD-GFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYW- 209
           + +  E+AS IP+  GF+  ASR+V+ A GFA+G+ Y F  +I  P Q+ A++  + Y+ 
Sbjct: 319 LLSFTELASLIPVSSGFSGLASRFVEDAFGFALGWTYWFSSMIALPAQVVASTFFLSYYS 378

Query: 210 -IDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLS-SFKXXXXXXXXXXXXXXXXX 267
            + R   +   ++T+FL+  + IN+  V+  GE  +                        
Sbjct: 379 SMKRSRGSTAGFVTLFLLYPIFINLLDVRIMGEVVYVTGLIKIIISVVVIISMLIFNAGH 438

Query: 268 XXPDHDRLGFRYWQHP--------GAFKPYSD----------AIDGSVGKFVAFVSVFVY 309
               HD++GFRYW           G F+P  D           I+G+ G+F+A +SV + 
Sbjct: 439 GGASHDQVGFRYWDSSKSFSQFTFGLFRPTFDLNDAGEGSTHGIEGATGRFLAVISVILI 498

Query: 310 ALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLX 369
           + FAY G+E+T + + EA NPRK++P A+K T+  ++I Y++++  +G+ +   DPRLL 
Sbjct: 499 STFAYSGVEMTFVASGEAVNPRKTIPSAIKRTLNIVIIIYMLSLISVGVNIYCGDPRLLS 558

Query: 370 XXXXXXXXX--------------------------------XXPFVVAIQNSGIRVLPHI 397
                                                      P+V+A+QN G+     +
Sbjct: 559 YFSGSAERRFITAMNDDSIRWQVSERCRSGLHYETGYQRNGSSPWVLALQNFGMCTYASV 618

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  ++     A  S L+ GSR+LY++AV  KAPAI +R T  G+P+ S+     F  ++
Sbjct: 619 LNGIMIFITVGAEISSLFSGSRTLYAMAVQRKAPAILQRCTKAGVPYVSVLFTSAFGAIS 678

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQ----GVDRSKFAYSAP 513
           Y+ V + + + F    N+ S    + W+ + ++++ F  A+K++      D   + Y +P
Sbjct: 679 YLAVDTTAIENFGVLSNISSASTSIIWMGLNVSFLRFYYALKLRQDIISRDDRSYPYRSP 738

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKI 573
           FQPY + + L  C        +T FL   ++ K+F + Y GL +F   Y GYK I  +KI
Sbjct: 739 FQPYLSMYGLFGCCMFVIFMGYTNFLHKYWNTKSFFSAYGGLMLFSACYLGYKIIGTSKI 798

Query: 574 VKSHEVDLFTGKEVFDQ 590
            +  ++D+ TG+   D+
Sbjct: 799 QRLDQLDMDTGRREMDR 815

>AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR132C (AGP2)
          Length = 566

 Score =  231 bits (589), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 142/500 (28%), Positives = 250/500 (50%), Gaps = 11/500 (2%)

Query: 101 KNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMAS 160
           + L+ RHV +                      G  S+ + ++   + +     +  EM  
Sbjct: 55  RKLENRHVQLIGISGVIGTALFVSIGKALYRGGSVSLLLGFALWCVPILCITVSTAEMVC 114

Query: 161 YIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPGV 219
           Y+P++  F   ASR V+ +L    G+ + F   +  P ++ A + +I YW  RD  +  +
Sbjct: 115 YLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQIPFEIVAVNSIIHYW--RDDYSAAI 172

Query: 220 WITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFRY 279
            + + +++ ++I++  V+++GE EFWL+SFK                   P  DR GFRY
Sbjct: 173 TLVVQVMLYLLISLFAVRYYGEIEFWLASFKVLLAVGLFCFTFVTMVGGNPKRDRYGFRY 232

Query: 280 WQHPGAFKPYS---DAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
                 FK YS   + I  S G F  F++  + A F   G +   ++A E   PRK +P 
Sbjct: 233 IGE-APFKQYSPTMEPISSSAGYFQGFLACLIQASFTIAGPDYVSMIAGETKLPRKVLPV 291

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGIRVLP 395
           A K    R+ + +L     +G+  + NDP L              P+V+A+ + GI++LP
Sbjct: 292 AFKQVFIRLTVLFLGGCLCVGIVCSANDPDLTAAINASRPGAGSSPYVIAMNHLGIKILP 351

Query: 396 HIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFAL 455
            I NA ++   FSA N+  Y  SRSLY LA+DG APAIFKR   +G+P Y++ V V++++
Sbjct: 352 DIVNAALVTAAFSAGNAYTYCSSRSLYGLALDGYAPAIFKRCNRFGVPIYAVSVSVMWSV 411

Query: 456 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQ 515
           L+ + ++S SA V N+ +++++   L+++  + + Y+ F RA   Q  +  + ++ + +Q
Sbjct: 412 LSLLQLNSNSAVVLNWLISLITASQLINFGVLCVVYLYFRRAYLAQQDNLPELSFKSWWQ 471

Query: 516 PYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFI---KKTK 572
           PY  Y  L   + I  ++ +TVF    ++ K+F+  Y+ + + +  Y GY++I    K  
Sbjct: 472 PYTAYVGLTCVLLIVVVQGYTVFYSALWNVKDFLFCYLMVFIDIAIYLGYRYIWRRGKDA 531

Query: 573 IVKSHEVDLFTGKEVFDQQE 592
           ++   EVDL TG    +  E
Sbjct: 532 VIPPTEVDLTTGLLEIELHE 551

>Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)
          Length = 583

 Score =  231 bits (589), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 155/518 (29%), Positives = 241/518 (46%), Gaps = 32/518 (6%)

Query: 100 KKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA 159
           KK L  RH++M                     +GPAS+ I +  VG  +   +    E++
Sbjct: 70  KKVLSQRHLTMIAIGGTLGTGLFIGLGESLA-SGPASLLIGFLLVGASMLCVVQCGAELS 128

Query: 160 SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
              P+ G +  +ASR++DP++GF++G  YL  +LI  P++L   SL I YW    +VNP 
Sbjct: 129 CQYPVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYWAP--SVNPA 186

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR-LGF 277
            W+ I  V+ +++N+ G + F E EF++S FK                   PD    +G 
Sbjct: 187 AWVAIAFVLSMLLNMFGARGFAESEFYMSIFKIVALFIFIIIGIILIAGGGPDSTGYIGT 246

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW  PG+F P           F    + FV A +++ G E+  + + EA N   SV RA
Sbjct: 247 KYWHDPGSFAP---------PVFKNLCNTFVSAAYSFSGTEMVVLTSTEARNV-SSVSRA 296

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI--RVLP 395
            K T WRIVIFY+VT+ ++G  V YND RL+            PFV+A+ N+G   + + 
Sbjct: 297 AKGTFWRIVIFYIVTVIIIGCLVPYNDSRLINGSSSEDITAS-PFVIALSNTGTMGKRVS 355

Query: 396 HIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFAL 455
           H  NA +LI VFS CNS +Y  SR +  LA  G+ P I       G P   + +C  F L
Sbjct: 356 HFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPRICAYMDRNGRPLVGMAICGAFGL 415

Query: 456 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQ 515
           L ++ VS     VF +   + SI    +W CI    + F  A+K QG  +    Y +   
Sbjct: 416 LGFLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSSL- 474

Query: 516 PYGTYFSLAWCVF-----IAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKK 570
             G Y  +  C+      I  I      +G      NF    + +P+ +  Y G++  +K
Sbjct: 475 --GIYGGIVGCILNVLLVIGEIYVSAAPVGSPSSAANFFEYCMSIPIMIAVYIGHRIYRK 532

Query: 571 T---KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIR 605
                 +K  ++DL +G  +   ++ E   L+++   R
Sbjct: 533 DWRHWYIKRRDIDLDSGHSL---EDFEATKLERDHDKR 567

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  233 bits (594), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 152/530 (28%), Positives = 258/530 (48%), Gaps = 23/530 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           + K+L  RH+                        GPAS+ I +  V   +F  + ++GE+
Sbjct: 141 MNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLGEL 200

Query: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A+  P+  GF+ Y  ++VDP+  FAV   YL ++L+L P +L AAS+ I+YW    ++N 
Sbjct: 201 AAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYW--NSSINS 258

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             W++IF V I + N+  VK FGE EF LS  K                   P H+ +G 
Sbjct: 259 DAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGG 318

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW  PGAF   +     S  KF    SVFV A F++ GIE+T + AAE+ NPR+++P+A
Sbjct: 319 KYWHDPGAFVGTT-----SGSKFKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPKA 373

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K T W I   Y+  + L+G  V YNDPRL+            P V+AI+N  I  LP +
Sbjct: 374 AKRTFWLITGSYVSILTLVGCLVPYNDPRLM-NGSSSVDAASSPLVIAIENGHIHGLPSL 432

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            NA +LI + S  NS +Y  SR + S++     P +F +    G P  ++   + F LL+
Sbjct: 433 MNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLS 492

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  S   A+VF +   +  +  +  W+ I + +I F + + VQ +   +  + +    +
Sbjct: 493 FVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIW 552

Query: 518 GTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYK--FIKKT 571
           G+ + +   +F+  + +F   L        +  +F  GY+  P+ +  Y  +K  F    
Sbjct: 553 GSIYGIV-ILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKNWR 611

Query: 572 KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFL 621
             + + ++DL +G++  D + +        +++RL +   +    + +FL
Sbjct: 612 WYIPASKMDLHSGRKQVDLEVV-------REELRLEKEHLAQRSFFYRFL 654

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  232 bits (591), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 145/516 (28%), Positives = 249/516 (48%), Gaps = 19/516 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           L + L+ RH+ M                     AGPA + I +     ++     ++GE+
Sbjct: 83  LSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGEL 142

Query: 159 ASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217
           A   P+ G + +YA+R++D + GFA  + Y+ + +++ P ++ AAS+ + YW D D    
Sbjct: 143 AVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYW-DTDPKYK 201

Query: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGF 277
             ++ +F VVIV IN+ GV+ FGE E   S  K                   PDH+ +G 
Sbjct: 202 LAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGG 261

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW  PG F       +    KF    SVFV A F++ G EL G+ AAE   PRKS+P+A
Sbjct: 262 KYWNDPGPF-----VGNAPSDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPKA 316

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPHI 397
            K   WRI +FY++++ ++G+ V  N+  LL            PFV+A+    IRVLP I
Sbjct: 317 AKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHS--PFVIAMDMHRIRVLPSI 374

Query: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457
            N  +L  V S  NS +Y  SR++ +LA  G  P IF      G P +++    LF LL 
Sbjct: 375 INVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLC 434

Query: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517
           ++  +    ++F++ + +  +    +W+ I + ++ F  A+K QG   ++ ++++P    
Sbjct: 435 FVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFI 494

Query: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKN-------FITGYIGLPVFVIFYFGYKFIKK 570
           G+ +++     +   + +      S D  +       F   Y+   V ++ Y  +K   +
Sbjct: 495 GSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWSR 554

Query: 571 TK--IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQI 604
                +K+ E+D+ TG+   D  E+  + L QE+ +
Sbjct: 555 NWKFFIKAKEMDIDTGRRELD-LELFKEELAQERAL 589

>Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON}
           YBR132C (REAL)
          Length = 590

 Score =  231 bits (590), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 138/503 (27%), Positives = 248/503 (49%), Gaps = 13/503 (2%)

Query: 100 KKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA 159
           ++ L+ RHV +                      GPAS+ +A++   + +     +  EM 
Sbjct: 79  RRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMV 138

Query: 160 SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
            + P+   F   A++ VD +L     + + F   +  P ++ + + +I YW  RD  + G
Sbjct: 139 CFFPVSSPFLRLATKCVDESLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAG 196

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
           + + + +V+ ++I++  VK++GE EFWL+SFK                   P HDR GFR
Sbjct: 197 IPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFVTMLGGNPKHDRYGFR 256

Query: 279 YWQHPGAFK---PYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVP 335
           Y+     FK   P    +  S G F  F++  + A F   G E   ++A E   PRK +P
Sbjct: 257 YYGE-SPFKQYFPDGKDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLP 315

Query: 336 RAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGIRVL 394
           +A K    R+   +L +   +G+  + NDP L              P+V+A+ N  IR+L
Sbjct: 316 KAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNMKIRIL 375

Query: 395 PHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFA 454
           P + N  ++   FSA N+  Y  SR+ Y +A+DG AP IF +    G+P Y++G+ +++A
Sbjct: 376 PDVVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTKCNKHGVPIYAVGISLIWA 435

Query: 455 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPF 514
           L++ + ++S SA V N+ +N+++   L++++ + I Y+ F R   +Q     K  + +  
Sbjct: 436 LVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIIYLFFRRTYSIQQDSLPKLPFRSWG 495

Query: 515 QPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFI---KKT 571
           QPY     L  C+ +  I+ +TVF    ++ ++F+  Y+ + + +  Y GYKFI    K 
Sbjct: 496 QPYTAIIGLVSCLAMIMIQGYTVFFPKLWNSQDFLFSYLMVFIDIGIYVGYKFIWKRGKD 555

Query: 572 KIVKSHEVDLFTGKEVFDQQEIE 594
           K+   +++D    KE+ + +  E
Sbjct: 556 KVKDPYKIDF--SKELIEIENHE 576

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score =  231 bits (588), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 158/514 (30%), Positives = 241/514 (46%), Gaps = 26/514 (5%)

Query: 100 KKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA 159
           KK L  RH++M                     +GPAS+ I +  VG  +   +    E++
Sbjct: 70  KKVLDQRHLTMIAIGGTLGTGLFIGLGESLA-SGPASLLIGFLLVGASMLCVVQCGAELS 128

Query: 160 SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
              P+ G +  +ASR++DP+ GF+VG  YL  +LI  P++L   SL + YW    +VNP 
Sbjct: 129 CQYPVSGSYALHASRFIDPSAGFSVGINYLLMWLISFPSELVGCSLTMTYW--APSVNPA 186

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR-LGF 277
           VW+ I   + +++N+ G + F E EF++S FK                   P+    +G 
Sbjct: 187 VWVAIAFTLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIILIAGGGPESTGYIGT 246

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW  PG+F P +         F  F + FV A +++ G E+  + +AEA +   SV RA
Sbjct: 247 KYWYDPGSFAPPA---------FKNFCNTFVSAAYSFSGTEMVVLTSAEARD-VSSVSRA 296

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSG---IRVL 394
            K T WRI +FY+VT+ ++G  V YNDPRL+            PFV+A+ N+G    RV 
Sbjct: 297 AKGTFWRIAVFYIVTVIIIGCLVPYNDPRLINGSSSEDITAS-PFVIALSNTGAMGTRV- 354

Query: 395 PHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFA 454
               NA +LI VFS CNS +Y  SR +  LA  G+ P I       G P   + +C  F 
Sbjct: 355 SQFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICGYMDRNGRPLVGMAICGAFG 414

Query: 455 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPF 514
           LL ++ VS     VF +   + SI    +W CI    I F  A+K QG       Y +P 
Sbjct: 415 LLGFLVVSKDQGTVFTWLFALCSISFFTTWFCICFCQIRFRMAMKAQGKPDDDIIYKSPL 474

Query: 515 QPYGTYFSLAWCVF--IAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT- 571
             YG        V   I  I      +G      NF    + +P+ +  Y G++  ++  
Sbjct: 475 GIYGGVVGCTLNVLLVIGEIYVSAAPVGMPSSAANFFEYCMSIPIMIAVYIGHRIYRRDW 534

Query: 572 --KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQ 603
               +K  ++DL +G  + D +  + +  DQEK+
Sbjct: 535 RHWYIKREDIDLDSGHSLEDLEATKLR-RDQEKE 567

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  231 bits (588), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 165/529 (31%), Positives = 256/529 (48%), Gaps = 42/529 (7%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           H+D LK+ L++RH+ M                      GP +M I +S  G  +  T+  
Sbjct: 66  HSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHG 125

Query: 155 IGEMASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GE+    P+ G F +Y++R +DP++ F V   Y+ ++  + P +L A+++ +Q+W  + 
Sbjct: 126 LGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWTTK- 184

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            V+P VW+ IF V++V +N+ GVK FGE EF  S  K                   PDH 
Sbjct: 185 -VDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHR 243

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +G  YW HPGA              F    SVFV A ++  G E+  + +AE  +P K 
Sbjct: 244 FIGTEYWHHPGAL----------ANGFKGVASVFVTASYSLGGSEMVCLCSAET-DP-KE 291

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P A+K   WRIV F+LV++ L+G  V Y +  LL            PFV+AI+ SGIRV
Sbjct: 292 LPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSSVNNS----PFVIAIKLSGIRV 347

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP I NA +LI + S  NS ++  SR+L S+A  G  P +F      G P   + V  LF
Sbjct: 348 LPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLF 407

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LLA++  S+    VF++ + +  +   + W+ I I++I F  A+K Q     +  + + 
Sbjct: 408 GLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSS 467

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFL------------GHSFDYKNFITGYIGLPVFVI- 560
              YG+ +S    + I  I  F + L              SF +KN++   + + VFV  
Sbjct: 468 VGVYGSIYSATVNILI-LIAQFYISLWPVGGWTSSQQRTESF-FKNYLCALVLVFVFVTH 525

Query: 561 -FYFGYKFIKKTKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRE 608
             YF     K        E+DL T     D++ I+ +I+ QE  +R RE
Sbjct: 526 KIYFKCSTGKWFDFKPLAEIDLET-----DRKNIDIEIVKQE--VRERE 567

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  230 bits (587), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 158/516 (30%), Positives = 245/516 (47%), Gaps = 30/516 (5%)

Query: 100 KKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA 159
           KK L  RH++M                     +GPAS+ I +  VG  +   +    E++
Sbjct: 70  KKVLDQRHLTMIAIGGTLGTGLFIGLGESLA-SGPASLLIGFLLVGASMLCVVQCGAELS 128

Query: 160 SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
              P+ G +  +ASR++DP++GF++G  YL  +LI  P++L   SL I YW    +VNP 
Sbjct: 129 CQYPVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISYW--APSVNPA 186

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR-LGF 277
            W+ I  V+ +++N+ G + F E EF++S FK                   PD    +G 
Sbjct: 187 AWVAIAFVLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGGPDSTGYIGT 246

Query: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337
           +YW  PG+F         +V  F    + FV A +++ G E+  + + EA +   SV RA
Sbjct: 247 KYWHDPGSF---------AVPVFKNLCNTFVSAAYSFSGTEMVVLTSTEARS-VSSVSRA 296

Query: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSG---IRVL 394
            K T WRI+IFY+VT+ ++G  V YNDPRL+            PFV+A+ N+G    RV 
Sbjct: 297 AKGTFWRIIIFYIVTVIIIGCLVPYNDPRLISGSSSEDITAS-PFVIALSNTGAMGTRV- 354

Query: 395 PHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFA 454
            H  NA +LI VFS CNS +Y  SR +  LA  G+ P I       G P   + +C  F 
Sbjct: 355 SHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICGAFG 414

Query: 455 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPF 514
           LL ++ VS     VF +   + SI    +W CI    + F  A+K QG  +    Y +  
Sbjct: 415 LLGFLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSTL 474

Query: 515 QPYGTYFS--LAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT- 571
             YG  F   L   + I  I      +G      NF    + +P+ +  Y G++  ++  
Sbjct: 475 GIYGGIFGCILNVLLVIGEIYVSAAPVGSPSSAANFFEYCMSIPIMIAVYIGHRIYRRDW 534

Query: 572 --KIVKSHEVDLFTGK--EVFDQQEIEGKILDQEKQ 603
               +K  ++DL +G   E F+  ++E    D++K+
Sbjct: 535 RHWYIKRMDIDLDSGHSLEDFEATKLE---RDEDKK 567

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  230 bits (587), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 153/517 (29%), Positives = 259/517 (50%), Gaps = 19/517 (3%)

Query: 97  DGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIG 156
           + LK+++  RH+                       AGPA + I Y+ +G  V+  + A G
Sbjct: 115 EELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQAAG 174

Query: 157 EMA-SYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDT 214
           E+  +Y  +  GF +Y +  V P+  F+VG+ Y  ++L + P +L  ASL I+YW  +  
Sbjct: 175 ELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTTK-- 232

Query: 215 VNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR 274
           V+P V++ IF ++I++IN  G K + E +F+ +  K                        
Sbjct: 233 VDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDGY 292

Query: 275 LGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSV 334
           LG +YW +PGAF+    AID     F    SVFV + FA+ G E   + A+E  NPRKS+
Sbjct: 293 LGGKYWHNPGAFRG-EKAID----HFKGVSSVFVTSAFAFGGSEFVALSASEQANPRKSI 347

Query: 335 PRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVL 394
           P A KL ++RI+  YL +I +LG  V ++ P+L             P+VVAI   G++V+
Sbjct: 348 PSAAKLILYRIIWVYLTSITILGFLVPWDSPQL---QPSSDGKKTSPYVVAIAMHGVKVV 404

Query: 395 PHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFA 454
           PH+ NA +L+ V S  NS  +  SR L SL+  G AP  F      G P  ++ +  LF 
Sbjct: 405 PHLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFG 464

Query: 455 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPF 514
           ++ +   S     VF++ + +  +  + ++  I +++I    A+KVQG    +  + +  
Sbjct: 465 VICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQV 524

Query: 515 QPYGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIGLPVFVIFYFGYKFIKK 570
             YG++++    V ++ +  F V L        D ++F   Y+  P+ ++FYFGY   KK
Sbjct: 525 GTYGSFYACLLLV-LSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKK 583

Query: 571 --TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIR 605
                ++S ++DL   ++VFD+  I+ +  +  +Q+R
Sbjct: 584 DFRIFIRSKDIDLDFKRQVFDEDLIKQEDEEYAEQMR 620

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  230 bits (586), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 150/525 (28%), Positives = 254/525 (48%), Gaps = 20/525 (3%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LKK +++RHV M                      GPA++ I Y  V  + +F + A GEM
Sbjct: 115 LKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGYVLVSFVTYFMIQAAGEM 174

Query: 159 ASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A   P     F +Y+S +V  A GFA  + +  ++L + P +L  ASL I+YW D+  +N
Sbjct: 175 AVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLELITASLTIKYWNDK--IN 232

Query: 217 PGVWITIFLVVIVIINV-AGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRL 275
             V+I IF V ++ I++  GV  +GE EF  +  K                    + + +
Sbjct: 233 ADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFIIMSIVINAGGAGNREYI 292

Query: 276 GFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVP 335
           G ++W  PGAF   +    GS  +F     V V   F+Y G EL  +   E  NPR+S P
Sbjct: 293 GGKFWHDPGAF---AGKTAGS--RFKGICYVLVSGYFSYGGTELFALSVNEQSNPRRSTP 347

Query: 336 RAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLP 395
           +A K +++RI+I YL+T+ L+G  V Y+   L+            P+V+A   +G+++ P
Sbjct: 348 QASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATHAS--PYVLAASLNGVKIAP 405

Query: 396 HIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFAL 455
           H  NA +LI V S  NS LY   R + SLA  G AP         G P  +L  C+L  +
Sbjct: 406 HFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQGRPLLALIACLLVGV 465

Query: 456 LAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQ 515
           + ++  S    +VF +   +  +  L +W  I ++++ F  A+K+Q     +  Y A   
Sbjct: 466 IGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMKLQNRSLEELGYKATTG 525

Query: 516 PYGTYFSLAWCVFIAFIKNFTVFLGHSFDYK----NFITGYIGLPVFVIFYFGYK-FIKK 570
            YG+ + + + + +   + +T       D K    +F   Y+ +P++++FYFGY  + + 
Sbjct: 526 IYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANYLAMPIWLVFYFGYMLWTRD 585

Query: 571 TKIVKS-HEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLE 614
            +++K   ++DL   + ++D + +  +  D+E + RLR   F + 
Sbjct: 586 FQLLKPLDKIDLDFHRRIYDPELMRQE--DEESKERLRNGSFMMR 628

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  228 bits (581), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 160/536 (29%), Positives = 243/536 (45%), Gaps = 34/536 (6%)

Query: 98  GLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGE 157
           G+K+ L+ RH+S+                      GP ++ + +S +GI+ F  M +IGE
Sbjct: 48  GVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVMESIGE 107

Query: 158 MASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           M +  P  G FT+ A R+   AL    GY Y+  +  +  N+    S ++Q+W       
Sbjct: 108 MITLYPSGGGFTTLARRFHSDALPAVCGYAYVVVFFAVLANEYNTLSSILQFW------G 161

Query: 217 PGV----WITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
           P V    +I IF     I  + GV  FGE E+WL+  K                    + 
Sbjct: 162 PQVPLYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNR 221

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
              GF YW  PGA              F     VFV+    Y G E   + A E+ NP K
Sbjct: 222 PAFGFHYWNSPGALSH----------GFKGIAIVFVFCSTFYSGTESVALAATESKNPGK 271

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           +VP AV+ T+WRI++ Y+      G  V ++DP L             P  +AI  +G  
Sbjct: 272 AVPLAVRQTLWRILVVYIGIAVFYGATVPFDDPNL----SASTKVLKSPIAIAISRAGWA 327

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
              H+ NA +LI   SA N  LY+GSR+L  LA +G AP I   T   G+P  ++ V   
Sbjct: 328 GGAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAITVFNA 387

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
             L++ MNVS G+A  ++Y VN+  +   + W  I  T++   +A   QG    +  Y A
Sbjct: 388 LGLISLMNVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEELPYEA 447

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT- 571
            F P+    SLA  +F+A I+ ++ F+   FD  NF+  YI LPV ++ Y G    K   
Sbjct: 448 LFYPWTPVLSLAANIFLALIQGWSYFV--PFDAGNFVDAYILLPVGILLYIGICVFKSNH 505

Query: 572 -KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN-KFSLEWIYEKFLGNIF 625
            + V    ++L  G+    ++++E  + DQE  +   E  K      + ++L NIF
Sbjct: 506 FRTVDLRSINLDEGR----RKDMEADLSDQESSLASSETMKDYKSATFFRYLSNIF 557

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  229 bits (585), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 155/533 (29%), Positives = 257/533 (48%), Gaps = 50/533 (9%)

Query: 97  DGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIG 156
           D LK+ ++ RHV M                     AGPA +   Y+ +G  V+  + + G
Sbjct: 108 DNLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSAG 167

Query: 157 EMAS-YIPMDG-FTSYASRYVDPA----------------LGFAVGYCYLFKYLILCPNQ 198
           EMA  Y  ++G F +Y +  V+P                 L F +GYC+   Y       
Sbjct: 168 EMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCLSFGIGYCF-DDY------- 219

Query: 199 LTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXX 258
                   +YW  R  V+P V++ IF V+I++INV G + + E EF+ +  K        
Sbjct: 220 --------KYWTTR--VDPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFF 269

Query: 259 XXXXXXXXXXXPDHDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIE 318
                       +   LG  YW++PGAF+      D  +  F   V+  V A FA+ G E
Sbjct: 270 ILGIIINVGGAGNDGYLGNIYWRNPGAFRG-----DKGIDHFKGVVATLVTAAFAFGGTE 324

Query: 319 LTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXX 378
              + AAE  NPRK++P A K  ++RIV+ YL +I L+G  V +  P LL          
Sbjct: 325 FIALTAAEQSNPRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATAAS 384

Query: 379 XXPFVVAIQNSGIRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTT 438
             P+V+A+ + G+RV+PH  NA +L+ V S  NS  Y  SR L SL+  G AP  F    
Sbjct: 385 --PYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVD 442

Query: 439 SWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAV 498
             G P  ++ V  LF ++A+   S    +VF + + +  +  + +WI I +++I F  A+
Sbjct: 443 REGRPSRAMIVSALFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAM 502

Query: 499 KVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVFLG----HSFDYKNFITGYIG 554
           K QG    +  + A    +G+Y+S+ + + +  I  F V +          +NF   Y+ 
Sbjct: 503 KAQGRSMGEVGFKAQTGIWGSYYSI-FLMILTLIGQFWVAIAPIGTAELSARNFFENYLA 561

Query: 555 LPVFVIFYFGYKFIKK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIR 605
           +P+ + FYFGYK  KK  T  +K+ ++DL + +++FD++ ++ +  + +++++
Sbjct: 562 MPILIGFYFGYKIWKKDWTLYIKAEDIDLISHRQIFDEELLKQEDYELKEKLK 614

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  229 bits (583), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 156/524 (29%), Positives = 257/524 (49%), Gaps = 21/524 (4%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           KH + LK+ ++ RHV M                      GP  + + +  +G  V+  + 
Sbjct: 85  KH-EKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMGTCVYCVIQ 143

Query: 154 AIGEMASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GEMA   P    GF +Y S  VDP  GFA  + Y  ++L + P +L  AS+ I+YW  
Sbjct: 144 AAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTASITIKYWTT 203

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
              +NP +++ +F ++I++IN  G + + E EF+ ++ K                    +
Sbjct: 204 --AINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVNTGAAGN 261

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +G +YW+ PG+F  ++ AID     F   VS  V A F+    E   + AAE  NPR
Sbjct: 262 DGYIGAKYWREPGSFGGHT-AID----HFKGVVSTLVNAAFSLGCSEFVALTAAEQANPR 316

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           KSVP A K  ++++ + +L ++ L+G  V  N   L+            P+V+A+ + G+
Sbjct: 317 KSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVS--PYVIAVASHGV 374

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           RV+PH  NA +L+ V S  NS  Y  SR L SLA  G AP +FK     G P  ++ V +
Sbjct: 375 RVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAMMVSI 434

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
               L ++  S     VF + + +  +  L +W  I I++I F +A+ VQG       + 
Sbjct: 435 TMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDGLGFK 494

Query: 512 APFQPYGTYFSLAWCVFIAFIKNF---TVFLGHSF-DYKNFITGYIGLPVFVIFYFGYKF 567
           A    +G+Y+S A  + + FI  F    + +G S  + ++F  GY+  P+FV  YFGYK 
Sbjct: 495 AQTGVWGSYYS-AVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVALYFGYKI 553

Query: 568 IKKT--KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLREN 609
             K     + + ++DL   +++FD   ++ +  D E + +LR++
Sbjct: 554 YNKNWQLFIPAEKIDLDLHRKIFDADVLKQE--DAEYRAKLRDS 595

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  228 bits (580), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 156/518 (30%), Positives = 235/518 (45%), Gaps = 33/518 (6%)

Query: 98  GLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGE 157
           G+K+ L+ RH+S+                      GP ++ + +S +G++ F  M +IGE
Sbjct: 48  GVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVMESIGE 107

Query: 158 MASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           + +  P  G FT+ A R+   AL    GY Y+  +  +  N+    S ++Q+W       
Sbjct: 108 IITLYPSGGGFTTLARRFHGDALSAVCGYAYVVVFFAVLANEYNTLSSILQFW------G 161

Query: 217 PGV----WITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
           P V    +I IF     I  + GV  FGE E+WLS FK                    D 
Sbjct: 162 PQVPLYGYILIFWFAFEIFQLIGVSLFGETEYWLSWFKIVGLVAYYIFSIIYISGGIKDR 221

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
              GF YW  PG+              F     VFV+    Y G E   + A E+ NP K
Sbjct: 222 PAFGFHYWNSPGSLSH----------GFKGIAVVFVFCSTFYSGTECVALAATESKNPGK 271

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           +VP AV+ T+WR++I Y+      G  V ++DP L             P  +AI  +G  
Sbjct: 272 AVPLAVRQTLWRVLIVYIGIAVFYGATVPFDDPNL----SATTKVLKSPISIAISRAGWA 327

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
              H+ NA +L+   SA N  LY+GSR+L +LA +G AP I   T   G+P  ++ V   
Sbjct: 328 GGAHLVNAFILVTCISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRRGVPIPAITVFNA 387

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
             L++ MNVS G++  ++Y VN+  +   + W  I  T++   +A   QG    +  Y A
Sbjct: 388 LGLISLMNVSVGASDAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVTQGRSLEELPYKA 447

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT- 571
              P+   FSL   VF+A I+ +T F+   FD  NF+  YI LPV ++ Y      K   
Sbjct: 448 LLYPWTPIFSLIANVFLALIQGWTSFV--PFDAGNFVDAYILLPVAIVLYVAICVFKNHH 505

Query: 572 -KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRE 608
            +IV    VDL  G+    +++I+    DQE  +   E
Sbjct: 506 FRIVDLKSVDLDEGR----RKDIDADFSDQESSLASSE 539

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  228 bits (581), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 151/527 (28%), Positives = 250/527 (47%), Gaps = 23/527 (4%)

Query: 99  LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEM 158
           LK++++ RHV+M                      GPA + I Y+ V ++ +  M A GEM
Sbjct: 83  LKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEM 142

Query: 159 A-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216
           A +Y  + G F +Y+S+ +    GFA  + Y  ++L + P +L  ASL I+YW   D++N
Sbjct: 143 AVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYW--NDSIN 200

Query: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLG 276
             V+I IF V I+ I+  G + +GE EF     K                    D   +G
Sbjct: 201 ADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIG 260

Query: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
            +YW  PGAF     A+     KF     V V   F+Y G EL  +   E  NPR+++  
Sbjct: 261 AKYWYDPGAF-----AVGSGATKFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQS 315

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRVLPH 396
             K  ++RI++ Y++T+ L+G  V +    L+            P+V+A+   G++++PH
Sbjct: 316 ITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSATHAS-PYVLAVSLHGVKIVPH 374

Query: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456
           I NA +LI V S  NS +Y G R L +LA  G AP         G P  +L  C +F LL
Sbjct: 375 IINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPLVALIACSVFGLL 434

Query: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516
           A++  S     VF +   +  +  L +W  I ++++ F +A++      S+  Y A    
Sbjct: 435 AFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKANTGV 494

Query: 517 YGTYFSLAWCVFIAFIKNFTVFLG-----HSFDYKNFITGYIGLPVFVIFYFGYKFI-KK 570
            G+   L++ + + FI  F V +         D  +F   Y+  P++V+ +FGY  + + 
Sbjct: 495 LGSVLGLSFNILV-FIAQFWVSIAPFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMIVFRN 553

Query: 571 TKIVKS-HEVDLFTGKEVFD-----QQEIEGKILDQEKQIRLRENKF 611
            +I+K   ++DL   + ++D     Q+++E KIL Q      + + F
Sbjct: 554 WEIIKPLKDIDLDHYRSIYDQDRLYQEDLEHKILIQNSSWARKLHNF 600

>SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 586

 Score =  228 bits (580), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 150/518 (28%), Positives = 247/518 (47%), Gaps = 31/518 (5%)

Query: 100 KKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA 159
           K+ L  RH++M                     +GP ++ I ++ +GI +F  +    E++
Sbjct: 73  KRTLSQRHLTMISIGGTLGTGLFIGLGYSLT-SGPGNLLIGFTIIGISIFCVVQCAAELS 131

Query: 160 SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
              P+ G F ++ SR++D ++GF V   Y   +LI  P++L   ++ ++YW   D+VNP 
Sbjct: 132 CQYPVSGSFATHVSRFIDSSVGFTVSTNYALAWLISFPSELIGCAITLRYW--NDSVNPA 189

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDR-LGF 277
           VWI IF V I+ +N+ GV+ F E EFWLS  K                   P  +  +G 
Sbjct: 190 VWIAIFYVFIMCLNLFGVRGFAETEFWLSLIKIAAIVIFIIIGIVLICGGGPHSNGYIGA 249

Query: 278 RYWQHPGAF-KPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336
           +YW  PGAF KP           F    + FV A F++ G EL  + A E+    +S+ R
Sbjct: 250 KYWHDPGAFVKPV----------FKGLCNTFVSAAFSFGGAELVVLTANES-RKIESISR 298

Query: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI--RVL 394
           A K T WRI +FY+ T+ ++G  V   D RLL            PFV+A+ N+G     +
Sbjct: 299 AAKGTFWRIAVFYITTVVIIGCLVPSTDERLLGAASDVDVTAS-PFVIALSNTGSFGDKV 357

Query: 395 PHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFA 454
            H  NA +LI V S CNS +Y  SR + SL    + P+        G P   +G+C +F 
Sbjct: 358 SHFMNAVILIAVLSVCNSCVYAASRVIQSLGASRQLPSFCGYIDRKGRPLVGIGICGVFG 417

Query: 455 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPF 514
           LL ++  SS   +VF +   + SI    +W CI  + + F  A++ QG    + AY +  
Sbjct: 418 LLGFLVASSKEGEVFTWLFALCSISSFFTWFCICFSQVRFRLALRAQGRSSDEIAYKSML 477

Query: 515 QPYGTYFSLAWCVFIAFIKNFTVF-----LGHSFDYKNFITGYIGLPVFVIFYFGYKFIK 569
             +G       CV    +    ++     LG S + + F    + +P+ +  YF ++  +
Sbjct: 478 GFWGGVLG---CVLNILLIAGEIYVSLFPLGGSPNAEGFFQYCLSIPIMIFVYFCHRIYR 534

Query: 570 KT---KIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQI 604
                 I+ + ++DL TG++  D + ++ +IL ++ +I
Sbjct: 535 NNWTDWIISTKKIDLDTGRKAEDLELMKHEILTEKARI 572

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  228 bits (580), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 140/519 (26%), Positives = 249/519 (47%), Gaps = 17/519 (3%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           H+  LK+N++ RHV +                      GP  + I Y FV I+ +  M A
Sbjct: 67  HSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVSIISYIMMQA 126

Query: 155 IGEMASYIPM--DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
            GEMA   P     F +Y+S ++    GFA  + +  ++  + P +L  +S+V++YW  +
Sbjct: 127 AGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWTTILPLELITSSIVVKYWTTK 186

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
             +N  +++ IF + I+ I+  G + +GE EF  +S K                    D 
Sbjct: 187 --INADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGILINCGAVGDD 244

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
             +G +YW  PGAF     A    + +F     V V A F+Y G+EL  +   E  NPRK
Sbjct: 245 GYIGGKYWHEPGAF-----AAGSGIDRFKGIAYVLVTAYFSYGGMELYALSVNELPNPRK 299

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           ++P A    V+RI+I Y++T+ ++G  V ++  +LL            P+V+A+   GI+
Sbjct: 300 AIPSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSSGVHPS--PYVLALSLHGIK 357

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
           ++PHI NA +LI V S  NS +Y G R L SLA  G AP I       G P  +L +C +
Sbjct: 358 IVPHIINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKILDYVDRQGRPLMALIICSV 417

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
           F L+A++  S     +F +   +  +  L +W  I +++  F RA+K+QG       Y +
Sbjct: 418 FGLIAFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFRRAMKLQGRSLETLGYRS 477

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYKFI 568
               +G+ +++ + VF+   + +   +    G  F  K+     + LP+++    GY  +
Sbjct: 478 TTGEWGSLYAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFKSCLALPLWLSMAVGYMIV 537

Query: 569 KK--TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIR 605
            K  T +     + + + +  +D + ++ + L+ +++++
Sbjct: 538 TKNWTILNPLSSISVDSHRRSYDVEVMKQEDLEYKQKMK 576

>TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.397
           YBR132C
          Length = 583

 Score =  227 bits (578), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 150/504 (29%), Positives = 247/504 (49%), Gaps = 12/504 (2%)

Query: 100 KKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA 159
           K+NL+ RHV                        GP ++ IA++   I +     +  EM 
Sbjct: 68  KRNLKNRHVQFIAISGVIGTAIFVAIGKALYKGGPGNLIIAFAVWCIPILCITMSTAEMV 127

Query: 160 SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
           S+ P+   F   A+   D +      + + F   +  P ++ + + +I YW  RD  +  
Sbjct: 128 SFYPVHSPFLRLATMCGDDSFSIMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAA 185

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
           + + + +V+ ++I+V  VK++GE EFWL+SFK                   P HDR GFR
Sbjct: 186 IPLVVQVVLYILISVLAVKYYGELEFWLASFKIILALGLFLFTFITMVGGNPKHDRYGFR 245

Query: 279 YWQHPGAFKPY---SDAIDG-SVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSV 334
           Y      FK Y    D   G S G F  F+   + A F   G E   ++A E   PRK +
Sbjct: 246 YLSE-SPFKKYYPDGDTTAGPSAGHFQGFLICLIQAAFTIAGGEYISMLAGEVCLPRKVM 304

Query: 335 PRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGIRV 393
           P+A K   WR+   ++ + F +G+  + NDP L              P+V+A+QN  IR+
Sbjct: 305 PKAFKQVFWRLTFIFIGSCFCVGIVCSSNDPLLTSAINESRPGAGSSPYVIAMQNLQIRI 364

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP I N  ++   FSA N+  Y  SR+LY +A+DG AP IFK+    G+P Y + V  L+
Sbjct: 365 LPDIVNIALITAAFSAGNAYTYCSSRTLYGIALDGNAPKIFKKCNKEGVPIYCVLVSTLW 424

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
           ALL+ + ++S SA V N+ +N+++   L+++ CI ITY+ F RA + Q     +  +++ 
Sbjct: 425 ALLSLLQLNSNSAVVLNWLINLITASQLINFSCICITYLLFRRAYRAQEDSLPRLPFTSW 484

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFI---KK 570
           +QPY TYF L   + +  ++ +TVF    +   +F+  Y+ + + +  Y G KFI    K
Sbjct: 485 YQPYTTYFGLFCSISMMLVQGYTVFFKKLWAVDDFLFNYLMIFIDLAIYLGVKFIWKRGK 544

Query: 571 TKIVKSHEVDLFTGKEVFDQQEIE 594
             +    ++D  T  +  +Q E++
Sbjct: 545 DPVKDPKKIDFETELKNIEQHELD 568

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  226 bits (576), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 150/529 (28%), Positives = 257/529 (48%), Gaps = 26/529 (4%)

Query: 97  DGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIG 156
           + L++ L+ RH++M                      GPAS+F+ Y+ +G +V+ T+  +G
Sbjct: 52  EDLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMGGVVYLTLLCLG 111

Query: 157 EMASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTV 215
           EM++Y+P+ G F SYA ++   +   A+ + Y F   +   + +TA  LV+ YW D +  
Sbjct: 112 EMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQLVMDYW-DTEAS 170

Query: 216 NPGVWIT--IFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
               W    +F  ++V++NV  V+F+GE E+WL+  K                   P H+
Sbjct: 171 GFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFFILSIVVNVGHNPQHE 230

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +GF+ W H  A  P+ D   G       F S+FV A FAY G E   +   EA NP ++
Sbjct: 231 YIGFKNWNHGEA--PFVDGFKG-------FASLFVSASFAYGGTESITLTNGEAANPLRN 281

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
            P+ VK   WRI++FY+ + F + M + Y+ P L             PF +  Q +G + 
Sbjct: 282 TPKIVKTVFWRILVFYVGSTFFIAMNIPYDYPGL-----DTKSVVTSPFTLVFQMAGTKA 336

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAP-AIFKRTTSWGLPHYSLGVCVL 452
                NA ++  V SACN  L+ GSR +Y++ ++G  P  I  RT  + +P+ S+ +   
Sbjct: 337 AGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKVPYVSVLITSS 396

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
             LL +     G+  V+ +  N+V +   ++W+CI IT I F + ++ QG    +  Y  
Sbjct: 397 IGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQG-KTHELRYKN 455

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK 572
              PYG YF + +  FI  ++ ++ F    +D  NF + Y+ L VF   +  +   K+ +
Sbjct: 456 WTYPYGPYFLVIFVTFIILVQGWSAF--DPWDVTNFFSYYLDLFVFPFCFIIWWLYKRDR 513

Query: 573 IVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFL 621
            VK  ++D  T + +  ++ IE      E    L+  K + +W+ + F+
Sbjct: 514 FVKLEDMDFVTDRYIPTKEIIE----LNENLDHLKGWKRTRQWLNDYFV 558

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  226 bits (575), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 151/511 (29%), Positives = 248/511 (48%), Gaps = 23/511 (4%)

Query: 97  DGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIG 156
           + L + L+ R V+M                      GPAS+F+ Y+ +G +V+ T+ A+G
Sbjct: 48  EDLTRALKPRVVNMISIAGIIGTGLYLSTSKSLHTGGPASLFMNYTIMGGVVYLTLLALG 107

Query: 157 EMASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTV 215
           EM++Y+P+ G F  YA ++   +   A+ + Y F   +   + LTA  LV+ YW   +  
Sbjct: 108 EMSTYMPISGSFCVYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVMDYWKTSEHG 167

Query: 216 NPGVWIT--IFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            P  W    IF  V+V +NV  V+F+GE E+WL+  K                   P H+
Sbjct: 168 FP-YWAASLIFWFVVVCLNVIHVRFYGEAEYWLAMLKIIAIIIFFILSIVVNVGKNPQHE 226

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +GF+ W    A  P+ D I G       F S+FV A FAY G E   +   EA NP ++
Sbjct: 227 YIGFKNWTRGEA--PFVDGIKG-------FASLFVSASFAYGGTESITLTNGEAENPIRN 277

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
            P+ VK   WRI+IFY+ + F + M + Y+ P L             PF +  Q +G + 
Sbjct: 278 TPKIVKTVFWRILIFYVGSTFFIAMNIPYDYPGL-----DSKSIVTSPFTLVFQMAGTKG 332

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPA-IFKRTTSWGLPHYSLGVCVL 452
                NA ++  V SACN  L+ GSR +Y++ ++G  PA I  RT    +P+ S+ +   
Sbjct: 333 AGSFMNAVIMTSVISACNHALFAGSRIMYNMGLEGFLPARIVSRTNRNKVPYVSVLITAA 392

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
              L +     G+  ++ +  N+V +   ++W+CI IT I F + ++ QG    +  Y  
Sbjct: 393 VGALCFGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQG-KTHELIYKN 451

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK 572
              PYG YF + +  FI  I+ ++ F    ++  NF + Y+ L VF + +  +  +K+ +
Sbjct: 452 WTYPYGPYFVIIFVSFIILIQGWSAF--APWNVSNFFSYYLELFVFPVCFIIWWLVKRDR 509

Query: 573 IVKSHEVDLFTGKEVFDQQEIE-GKILDQEK 602
            VK  ++D  T + +  ++ IE  + LD  K
Sbjct: 510 FVKYEDMDFTTDRYIPTKEIIELNETLDNLK 540

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  226 bits (577), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 157/508 (30%), Positives = 251/508 (49%), Gaps = 24/508 (4%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           K  + L +++++RH+ M                     +GPA + I Y    I+V+F + 
Sbjct: 87  KTENQLNRSIKSRHLLMISLGTGIGTGLLVGNGQVLAKSGPAGLVIGYGVASIMVYFIVQ 146

Query: 154 AIGEMA-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GE+   Y  + G +  Y S  VDPALGFA+   Y  ++L + P QL  A++ I YW +
Sbjct: 147 AAGELGICYSGLTGNYIRYPSILVDPALGFAISIIYTLQWLTVMPLQLVTAAMTIGYWTN 206

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
              +NP +++ I LV++V+ N  G K + E EF  + FK                     
Sbjct: 207 ---INPNIFVAIVLVIVVLTNCFGAKGYVEAEFLCNIFKVLMMVGFVLLAILINTGAIGT 263

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +G  YW++PGAF             F    SVF YA F+Y GIE+  + AAE  NP 
Sbjct: 264 DGYIGTIYWKNPGAF----------ANGFKGVCSVFCYAAFSYGGIEVLALTAAEQENPI 313

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           K++P A K TV+RI+  Y++T  L+G  V Y+ P+L+            PFV+AI + G+
Sbjct: 314 KAIPSACKKTVYRILFLYMLTTILIGFLVPYDSPQLMGSTSGGGSHSS-PFVIAIASHGV 372

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           +V+PH+ NA +LI + S  NS  Y  +R L SL+  GK P IF      G P Y +    
Sbjct: 373 KVVPHLINAVILISIVSVANSAFYSSTRLLLSLSEQGKIPKIFNYVDKEGRPWYCILFAS 432

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
           LF  + ++  S    +VF + + +  +  +  W+ I +++I F RA+  QG    +  Y 
Sbjct: 433 LFGSIGFVASSPYKEEVFTWLLAISGLSQIFLWMSICLSHIRFRRAMIKQGKSLDEIGYK 492

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLG-----HSFDYKNFITGYIGLPVFVIFYFGYK 566
           AP   +G++ +L+  +F + I  F V +         D   F   Y+  P+ +I Y GYK
Sbjct: 493 APTGCWGSWIALSIALF-SLISQFWVAIAPIGKDGKLDVLVFFQNYLAAPIVLIAYLGYK 551

Query: 567 -FIKKTKI-VKSHEVDLFTGKEVFDQQE 592
            + K  ++ + S ++DL  G+E++  +E
Sbjct: 552 TYYKDWRLYIPSDKIDLSYGREIYVPEE 579

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  226 bits (575), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 149/520 (28%), Positives = 248/520 (47%), Gaps = 19/520 (3%)

Query: 96  TDG-LKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           TDG L+++++ RHV+M                      GP  + I Y+ V ++ +  M A
Sbjct: 75  TDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMMQA 134

Query: 155 IGEMA-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDR 212
            GEMA +Y  M G F +Y+S ++    GFA  + Y  ++L + P +L  ASL I+YW D 
Sbjct: 135 AGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKYWTD- 193

Query: 213 DTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDH 272
            +VN  V+I IF V I+ I+  G + +GE EF     K                    + 
Sbjct: 194 -SVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAGNS 252

Query: 273 DRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRK 332
             +G RYW  PGAF     A+     KF  F  V V   F+Y G EL  +   E  +PR+
Sbjct: 253 GYIGARYWHDPGAF-----AVGDPASKFKGFCYVLVTGYFSYGGTELYAMTVNEQSSPRR 307

Query: 333 SVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIR 392
           ++  A K  ++RI++ Y++T+ L+G  V +    L+            P+V+A+   G++
Sbjct: 308 AIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHAS-PYVLAVSLHGVK 366

Query: 393 VLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVL 452
           V+PHI NA +LI V S  NS +Y G R L +LA  G AP         G P  +L  C +
Sbjct: 367 VVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACSV 426

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
             LLA++  S     VF +   +  +  L +W  I +++I F +A+K  G   S+  Y +
Sbjct: 427 IGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKS 486

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLG-----HSFDYKNFITGYIGLPVFVIFYFGYKF 567
               +G+ + + + + + F+  F V L         D  +F   Y+  P++ +F+ GY  
Sbjct: 487 ITGLWGSIYGVCFNILV-FVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLGYMV 545

Query: 568 IKKTKIVKS--HEVDLFTGKEVFDQQEIEGKILDQEKQIR 605
                ++     ++D+   + V+D++ IE + L+ +  ++
Sbjct: 546 YSGEWMILRPLKDIDINHFRCVYDEERIEQEKLEHKTMLQ 585

>NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.397
           YBR132C
          Length = 584

 Score =  225 bits (574), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 145/503 (28%), Positives = 244/503 (48%), Gaps = 11/503 (2%)

Query: 100 KKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIGEMA 159
           K+NL  RHV +                      GPA + +A++   I +     +  EM 
Sbjct: 74  KRNLVNRHVQLIAISGVIGTAIFVAIGKPLYRGGPAFLLLAFAIWCIPILCITVSTAEMV 133

Query: 160 SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218
            ++P+   F   A++ VD +L     + + F   +  P ++   + +I YW  RD  +  
Sbjct: 134 CFMPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPYEIVTVNTIIHYW--RDDYSAA 191

Query: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHDRLGFR 278
           + + I  ++ ++I++A VK++GE EFWL+SFK                   P  DR GFR
Sbjct: 192 IPLVIQSLLYLLISLAAVKWYGEMEFWLASFKIVLAMGLFCFTFITMLGGNPKKDRFGFR 251

Query: 279 YWQHPGAFKPY-SDAID--GSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVP 335
           Y+ H   FK Y  D ID   S G F  F    + A F   G E   ++A E   PR+ +P
Sbjct: 252 YF-HDTPFKKYFPDGIDRGSSAGYFQGFFICLIQASFTIAGGEYISMLAGEIEIPRRVLP 310

Query: 336 RAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGIRVL 394
           RA K    R+ I +L +   +G+  + ND  L              P+V+A+ N GIR+L
Sbjct: 311 RAFKQVFMRLTILFLGSCLCVGILCSPNDSSLTAAINEARPGAGSSPYVIAMNNLGIRIL 370

Query: 395 PHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFA 454
           P I N  ++   FS+ N+  Y  SR+LY +A+DG AP IF R    G+P Y++GV +L+A
Sbjct: 371 PDIVNITLITAAFSSGNAYTYCSSRTLYGMALDGYAPKIFTRCNKQGVPIYAVGVSLLWA 430

Query: 455 LLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPF 514
            ++ + ++S SA V N+ +N+++   L+++  + ITY+ F RA  +Q     +  + + +
Sbjct: 431 FISLLQLNSNSAIVLNWLINIITASQLINFAILCITYLFFRRAYLLQKDKLPELPFKSWW 490

Query: 515 QPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFI---KKT 571
           QPY   F L   + +  ++ +TVF   +++ ++F+  Y+ + + +  Y  YKFI    K 
Sbjct: 491 QPYTAIFGLVCAMVMMIVQGYTVFFPKNWNVQDFLFCYLMIFINIGIYIFYKFIWRLGKD 550

Query: 572 KIVKSHEVDLFTGKEVFDQQEIE 594
           KI     +         +  E+E
Sbjct: 551 KIKDPATISFEDELREIENHELE 573

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  224 bits (571), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 153/521 (29%), Positives = 246/521 (47%), Gaps = 23/521 (4%)

Query: 97  DGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIG 156
           + L + L  RH++M                      GPAS+F+ Y+ +G +V+ TM  +G
Sbjct: 44  EDLTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLG 103

Query: 157 EMASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTV 215
           EM++++P+ G F SYA ++   +   A+ + Y F   +   + LTA  LV+ YW   D  
Sbjct: 104 EMSTFMPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHH 163

Query: 216 NPGVW--ITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            P  W    IF   ++ +NV  V+ +GE E+WL+  K                   P H+
Sbjct: 164 FP-YWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHE 222

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +GF+ W H  A  P+       V  F  F S+FV A FAY G E   +   EA NP ++
Sbjct: 223 YIGFKNWTHGEA--PF-------VNGFKGFASLFVSACFAYGGTESITLTGGEASNPVRN 273

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
            P+ VK   WRI+IFY+++ F +GM + Y+ P L             PF +  Q +G R 
Sbjct: 274 TPKIVKTVFWRILIFYVLSTFFIGMNIPYDYPGL-----STKSVMTSPFTLVFQMAGTRG 328

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAP-AIFKRTTSWGLPHYSLGVCVL 452
                NA +L  V SACN  L+ GSR +Y++A+DG  P  I  RT  +  P+ ++ +   
Sbjct: 329 AGSFMNAVILTSVISACNHALFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWA 388

Query: 453 FALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSA 512
              L       G+  ++ +  N+V +   ++W+CI IT I F + ++VQG       +  
Sbjct: 389 VGGLCLGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQG-KTDLLQFKN 447

Query: 513 PFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTK 572
              P+G YF + + VFI  I+ +  F    +   +F + Y+ L VF   Y  +   K+  
Sbjct: 448 WTYPFGPYFLVIFTVFIILIQGWQAF--DPWSVTDFFSVYLELFVFPFVYIIWWLWKRDW 505

Query: 573 IVKSHEVDLFTGKEVFDQQEIE-GKILDQEKQIRLRENKFS 612
            VK  ++D  T + +  ++ +E  + LD  K  +     FS
Sbjct: 506 FVKYEDMDFVTDRYIPTKEIVELNERLDNLKGWKKVRQIFS 546

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  226 bits (575), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 145/504 (28%), Positives = 241/504 (47%), Gaps = 24/504 (4%)

Query: 94  KHTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMA 153
           +  + L+K++++RH+ M                     AGPA + + Y    I+++  + 
Sbjct: 85  QEKNNLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQ 144

Query: 154 AIGEMA-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWID 211
           A GE+   Y  + G +T Y+S  VDP+LGFAV   Y  ++L + P QL  A++ ++YW +
Sbjct: 145 AAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTN 204

Query: 212 RDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
              VN  +++ +  + ++IIN+ G + + E EF  +  K                    D
Sbjct: 205 ---VNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGD 261

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
              +G  YW +PG F             F    +VF YA F+Y GIE+  + AAE  NP 
Sbjct: 262 RRYIGTEYWHNPGPF----------AHGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPT 311

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           +S+P A K  V+RI++ Y++T  L+G  V YN   LL            PFV+A+ + G+
Sbjct: 312 ESIPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHAS-PFVIAVSSHGV 370

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
           +V+PH  NA +LI V S  NS LY G R L SLA  G  P         G P     V +
Sbjct: 371 KVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSL 430

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
            F  + ++  S+   QVF + + + S+  L  W+ + +++I F  A+  QG    +  Y 
Sbjct: 431 AFGCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYK 490

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLGH-----SFDYKNFITGYIGLPVFVIFYFGYK 566
           A    +G++ ++   VF   +  F V +         D K F   Y+ +P+ ++ YFG+K
Sbjct: 491 AQTGYWGSWIAVLIAVFF-LVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHK 549

Query: 567 FIKKTKI--VKSHEVDLFTGKEVF 588
              K+    + + ++DL + + V+
Sbjct: 550 MYFKSWRFWIPAEKIDLDSHRNVY 573

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  224 bits (571), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 150/527 (28%), Positives = 232/527 (44%), Gaps = 30/527 (5%)

Query: 97  DGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIG 156
            G+K+ L+ RH+S+                      GP ++ + +  +GIL F  M +IG
Sbjct: 54  SGVKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESIG 113

Query: 157 EMASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTV 215
           EM +  P  G FT+   R+   AL    GY Y   +  +  N+    S ++Q+W      
Sbjct: 114 EMITLYPSGGGFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFW------ 167

Query: 216 NPGV----WITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPD 271
            P V    +I IF     +  + GV  FGE E+WL+ FK                    +
Sbjct: 168 GPQVPLYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKN 227

Query: 272 HDRLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPR 331
               GF+YW  PGA              F    +VFV+    Y G E   + A E+ NPR
Sbjct: 228 RPAFGFQYWNDPGALS----------NGFKGIANVFVFCSTFYSGTESVALAATESKNPR 277

Query: 332 KSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGI 391
           ++VP A++ T WRI+I YL      G+ V YND  L             P  +AI  +G 
Sbjct: 278 RAVPIAIRQTFWRILIVYLGISIFYGVTVPYNDENL----NFATKVLKSPIAIAISRAGW 333

Query: 392 RVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCV 451
               H+ NA +LI   SA N  LY+GSR+L  LA +G AP +   T   G+P  ++ V  
Sbjct: 334 PAGVHLVNAFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFN 393

Query: 452 LFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYS 511
              L++ MNVS  +   +NY VN+  +   + W  I +T++ F +A K+QG  R +  Y 
Sbjct: 394 ALGLISLMNVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYK 453

Query: 512 APFQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKT 571
           A   P     S+   +F+  ++ ++ F    FD KNF+  YI +P  +I Y G  + K  
Sbjct: 454 AKLFPVFPIVSIIANIFLGLVQGWSYF--KPFDAKNFVDAYILIPAGIILYLGVSYWKTK 511

Query: 572 KIVKS---HEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEW 615
             + +    EV+L  G+ +    +      D    + + +    + W
Sbjct: 512 GFLTAVDLSEVNLLFGQRLPTISQDMPSSTDSTTSVVITKTPRKINW 558

>Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W
           (REAL)
          Length = 586

 Score =  224 bits (572), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 156/500 (31%), Positives = 247/500 (49%), Gaps = 43/500 (8%)

Query: 132 AGPASMFIAYSFVGILVFFTMAAIGEMASYIPMDG-FTSYASRYVDPALGFAVGYCYLFK 190
           +GPA++ I +  VG  +F  + +  E++   P+ G + ++ SR++D ++GF V   Y   
Sbjct: 105 SGPAALLIGFLLVGTSMFCVVQSAAELSCQFPVSGSYATHVSRFIDQSIGFTVATNYALS 164

Query: 191 YLILCPNQLTAASLVIQYWIDRDTVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFK 250
           +LI  P++L   SL I YW    TVNP VW+ IF V I+ +N+ GVK F E EF LS  K
Sbjct: 165 WLISFPSELIGCSLTISYW--NQTVNPAVWVAIFYVFIMCLNLFGVKGFAETEFALSIIK 222

Query: 251 XXXXXXXXXXXXXXXXXXXPDHDR-LGFRYWQHPGAF-KPYSDAIDGSVGKFVAFVSVFV 308
                              P+    +G RYW +PG+F KP           F    + FV
Sbjct: 223 VISIFIFIIIGIVLIAGGGPNSTGYIGTRYWHNPGSFAKPV----------FKNLCNTFV 272

Query: 309 YALFAYLGIELTGIVAAEAYNPRKSVPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLL 368
            A F++ G EL  + + E+ N   S+ RA K T WRI IFY+ T+ ++G  V YNDPRLL
Sbjct: 273 SAAFSFGGSELVLLTSTESKNI-SSISRAAKGTFWRIAIFYITTVVIIGCLVPYNDPRLL 331

Query: 369 XXXXXXXXXXXXPFVVAIQNSG---IRVLPHIFNACVLIFVFSACNSDLYVGSRSLYSLA 425
                       PFV+A+ N+G    RV  +  N  +L+ V S CNS +Y  SR + +L 
Sbjct: 332 NGSTSEDISAS-PFVIALSNTGSMGTRV-SNFMNVVILVAVVSVCNSCVYASSRLIQALG 389

Query: 426 VDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWI 485
             G+ P I       G P   +G+  +F LL ++  S+   +VF +   + SI    +W 
Sbjct: 390 ASGQLPEICAYMDRKGRPLVGIGISGIFGLLGFLVASNKEGEVFTWLFALCSISSFFTWF 449

Query: 486 CIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYGTYFSLAWCVFIAFIKNFTVF-----LG 540
           CI ++ + F  A+K QG  +++ AY +    YG       CV  A +    ++     +G
Sbjct: 450 CICMSQVRFRMALKAQGRSKNEIAYKSMLGVYGGVLG---CVLNALLIAGEIYVSAAPVG 506

Query: 541 HSFDYKNFITGYIGLPVFVIFYFGYKFIK---KTKIVKSHEVDLFTGK-----EVFDQQ- 591
            +   K F    + +P+ ++ Y  ++  +   K   +K  ++DL TG      E+F++Q 
Sbjct: 507 GTSTAKGFFEYCLSIPIMIVVYISHRIYRGDWKNWYIKKSKIDLDTGCSVENLELFNEQK 566

Query: 592 EIEGKILDQEK-----QIRL 606
           + E +++D +      QIRL
Sbjct: 567 QAEKELIDDDNIPNQFQIRL 586

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  224 bits (571), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 157/532 (29%), Positives = 250/532 (46%), Gaps = 38/532 (7%)

Query: 95  HTDGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAA 154
           HT  LK+ L+ARH+ M                      GP ++ I +S  G  +  T+  
Sbjct: 81  HTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVGTIHG 140

Query: 155 IGEMASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRD 213
           +GE+    P+ G F +Y++R++DP++ F +   Y+ ++  + P ++ A+++ IQYW    
Sbjct: 141 LGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYW--NQ 198

Query: 214 TVNPGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
           +++P VW+ IF  VIV IN+ G + FGE EF  SS K                   PDHD
Sbjct: 199 SIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPDHD 258

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +G RYW  PG               F   +SV V A ++  G E+  + + E  NPR+ 
Sbjct: 259 FVGARYWHDPGCLSH----------GFPGVLSVLVVASYSLGGTEMVCLASGET-NPRE- 306

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
           +P A+K T WRI+ F+L+++ L+G  V Y +P LL            PFV+AI+   I+ 
Sbjct: 307 LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSSVNNS----PFVIAIKLHHIKA 362

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
           LP I NA +LI + S  NS ++  SR+L S+A  G  P  F      G P   +    LF
Sbjct: 363 LPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLF 422

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
            LLA++  SS   +VF++ + +  +   + W+ I I++I F  A+K QG    +  + + 
Sbjct: 423 GLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSA 482

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFL-------GHSFDYKNFITGYIGLPVFVIF----- 561
              +G+ +S A    +  I  F   L         S   K F   Y+   +         
Sbjct: 483 VGMWGSAYS-ALINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLFVCHK 541

Query: 562 -YFGYKFIKKTKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFS 612
            ++ YK  K   I+   ++DL T     D++ I+  +L QE   R R  + S
Sbjct: 542 VFYRYKTGKWWAIMDLDKIDLET-----DRKNIDIDVLKQEIAERNRHLQAS 588

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  223 bits (569), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 147/517 (28%), Positives = 249/517 (48%), Gaps = 23/517 (4%)

Query: 97  DGLKKNLQARHVSMXXXXXXXXXXXXXXXXXXXXXAGPASMFIAYSFVGILVFFTMAAIG 156
           + LK++L  RH++M                      GPAS+F+ YS  G +V+ TM  +G
Sbjct: 66  EDLKRDLSPRHINMISIAGVIGTGLYLSTSKSLHVGGPASLFMNYSIFGGVVYLTMMCLG 125

Query: 157 EMASYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTV 215
           EM++Y+P+ G F SYA ++   +   A+ + Y F   +   + LTA  LV+ YW  +D  
Sbjct: 126 EMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWKTKDHH 185

Query: 216 NPGVWIT--IFLVVIVIINVAGVKFFGEFEFWLSSFKXXXXXXXXXXXXXXXXXXXPDHD 273
            P  W    +F V ++++NV  V+ +GE E+WL+  K                   P+H 
Sbjct: 186 FP-YWAASLLFWVFVLLLNVISVRLYGEAEYWLALLKVIAIIIFFILSIVVNVGHNPEHK 244

Query: 274 RLGFRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKS 333
            +GF  W H  A  P+       V  F  F S+FV A FAY G E   +   EA NP ++
Sbjct: 245 YIGFHNWNHGDA--PF-------VNGFKGFASLFVSASFAYGGTESITLTNGEATNPVRN 295

Query: 334 VPRAVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGIRV 393
            P+ +K   WRI+IFY+ + F + M V Y+ P L             PF +  Q +G + 
Sbjct: 296 TPKVIKTVFWRILIFYVFSAFFIAMNVPYDYPGL-----ATKSVMTSPFTIVFQMAGSKG 350

Query: 394 LPHIFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLF 453
                NA ++  V SACN  L+ GSR +Y++++DG  P    +T  +  P+ ++ +    
Sbjct: 351 AGSFMNAVIMTSVISACNHALFAGSRVMYNMSLDGYLPKWVTKTNRYKAPYVAVAITWAV 410

Query: 454 ALLAYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAP 513
             L +     G+  V+ +  N+V +   ++W+CI IT I F R +++QG    +  +   
Sbjct: 411 GGLCFGASFIGAGTVWIWLQNIVGVSNQIAWLCIAITSIRFRRGLELQG-KTHELKFKNW 469

Query: 514 FQPYGTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKI 573
             P+G YF + +  F+  I+ ++ F    +   NF + Y+ L VF   Y  +   K+ K 
Sbjct: 470 TYPWGPYFLVVFVSFVILIQGWSAF--DPWSTSNFFSVYLELFVFPACYLIWWLYKRDKF 527

Query: 574 VKSHEVDLFTGKEVFDQQ--EIEGKILDQEKQIRLRE 608
           +K  ++D  T K +  ++  E+  ++ + +   + R+
Sbjct: 528 IKYEDMDFVTDKYIPSKKVNELNERLDNLKGWPKWRQ 564

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.143    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,941,190
Number of extensions: 2280414
Number of successful extensions: 9186
Number of sequences better than 10.0: 372
Number of HSP's gapped: 7432
Number of HSP's successfully gapped: 395
Length of query: 625
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 509
Effective length of database: 40,180,143
Effective search space: 20451692787
Effective search space used: 20451692787
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)