Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A065405.430ON65961920280.0
NDAI0B056405.430ON66950812991e-171
Suva_2.5385.430ON62961412811e-168
TPHA0H017805.430ON62262212651e-166
Kwal_55.214445.430ON64461212391e-162
KLTH0F16148g5.430ON64661212341e-161
TDEL0E019505.430ON61761912131e-158
SAKL0G02442g5.430ON62351112061e-157
Smik_4.6325.430ON62746112061e-157
Skud_4.6355.430ON62961811621e-151
ZYRO0F09944g5.430ON61146111471e-149
Kpol_1016.85.430ON63750811431e-148
CAGL0L11638g5.430ON60846411401e-148
NCAS0F033505.430ON63950811271e-145
KNAG0C049405.430ON64246711241e-145
YDR365C (ESF1)5.430ON62850411191e-144
KLLA0E21165g5.430ON62746111001e-141
KAFR0E039105.430ON6253339321e-116
Ecym_47905.430ON6303028371e-102
AER259W5.430ON6193367989e-97
Suva_7.4354.77ON70833724.4
Skud_7.4674.77ON70833724.7
YGR145W (ENP2)4.77ON70733725.1
Smik_6.2484.77ON70733715.3
Kwal_14.22584.77ON69931716.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A06540
         (659 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON} Anc_5...   785   0.0  
NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa] ...   504   e-171
Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON...   498   e-168
TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {O...   491   e-166
Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365...   481   e-162
KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} simi...   479   e-161
TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.4...   471   e-158
SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {...   469   e-157
Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {...   469   e-157
Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {...   452   e-151
ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {...   446   e-149
Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON} (16620.....   444   e-148
CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON} sim...   443   e-148
NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {O...   438   e-145
KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.4...   437   e-145
YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}...   435   e-144
KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} simi...   428   e-141
KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {O...   363   e-116
Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {O...   327   e-102
AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic ...   311   9e-97
Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W ...    32   4.4  
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    32   4.7  
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    32   5.1  
Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W ...    32   5.3  
Kwal_14.2258 s14 (679677..681776) [2100 bp, 699 aa] {ON} YGR145W...    32   6.5  

>TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON}
           Anc_5.430 YDR365C
          Length = 659

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/619 (69%), Positives = 428/619 (69%)

Query: 1   MSERKPKEDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIIDR 60
           MSERKPKEDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIIDR
Sbjct: 1   MSERKPKEDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIIDR 60

Query: 61  NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLAELARLDRAR 120
           N                                               VLAELARLDRAR
Sbjct: 61  NEKDKKDFDKYYTKDEDEENKDEEQDKSDQEEESEEEDVDEKADDDEDVLAELARLDRAR 120

Query: 121 GDVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPETGDPSKTVAVVNLDWDH 180
           GDVP                                    KPETGDPSKTVAVVNLDWDH
Sbjct: 121 GDVPSDYVSSSDDYSSSESESSGESEVDSDEESDAEIESAKPETGDPSKTVAVVNLDWDH 180

Query: 181 VKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPXXXXXXXXXXXXXSTA 240
           VKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPP             STA
Sbjct: 181 VKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPKELFKKKNKKGKKSTA 240

Query: 241 EDNEDDVSDVDINDLYEEGDADKNIDSKSXXXXXXXXXXXXXAVVYCNNIGTAESIYKNC 300
           EDNEDDVSDVDINDLYEEGDADKNIDSKS             AVVYCNNIGTAESIYKNC
Sbjct: 241 EDNEDDVSDVDINDLYEEGDADKNIDSKSLRQYQLERLRYYYAVVYCNNIGTAESIYKNC 300

Query: 301 DGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDET 360
           DGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDET
Sbjct: 301 DGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDET 360

Query: 361 PADRVEISKRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXXXXXXLKSLVGGGAFGNVFGK 420
           PADRVEISKRAFSQKEIDEMDFKAYLA                 LKSLVGGGAFGNVFGK
Sbjct: 361 PADRVEISKRAFSQKEIDEMDFKAYLASDSDESESELNNDSKNKLKSLVGGGAFGNVFGK 420

Query: 421 XXXXXXXXXXXXXXXXMEITFTPGLDEKKEASDNETKKEESTIXXXXXXXXXXXXXXXXX 480
                           MEITFTPGLDEKKEASDNETKKEESTI                 
Sbjct: 421 DTEYDLDGSDDEDGVDMEITFTPGLDEKKEASDNETKKEESTIEKLQRKEKERRKLRKQK 480

Query: 481 VKDLKEKSVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAELELLMMDEDDRISGVN 540
           VKDLKEKSVQ                                AELELLMMDEDDRISGVN
Sbjct: 481 VKDLKEKSVQERKEKLNSNRNRNKKNNNELLKDEKEKQDKSKAELELLMMDEDDRISGVN 540

Query: 541 NKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQPE 600
           NKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQPE
Sbjct: 541 NKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQPE 600

Query: 601 FKQTSAMKEILNERTKRAS 619
           FKQTSAMKEILNERTKRAS
Sbjct: 601 FKQTSAMKEILNERTKRAS 619

>NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa]
           {ON} Anc_5.430 YDR365C
          Length = 669

 Score =  504 bits (1299), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 270/508 (53%), Positives = 316/508 (62%), Gaps = 13/508 (2%)

Query: 116 LDRARGDVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPETGDPSKTVAVVN 175
           +DRARGDVP                                    +PE+G+PSKT+AVVN
Sbjct: 119 IDRARGDVPADYVSSSDEYTSSESEASDEEELDSDVESGEEVTTQEPESGEPSKTLAVVN 178

Query: 176 LDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPXXXXXXXXXXX 235
           LDWDHVKS+DLMITFS F+P+GG+I  IAIYPSEFGKERMQRE++EGPP           
Sbjct: 179 LDWDHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQKRKKKT 238

Query: 236 XXSTA---EDNEDDVSDVDINDLYEEGDADKNIDSKSXXXXXXXXXXXXXAVVYCNNIGT 292
             S     E N+ DVSDVDI DLYEEGDADK++D+K+             AVVYCNNI T
Sbjct: 239 SKSKKISDEANDSDVSDVDIKDLYEEGDADKDVDTKALRQYQLERLRYYYAVVYCNNIET 298

Query: 293 AESIYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSN 352
           A +IY+NCDGTEYESTAN+FD+RYVPD M F D PRD+CD LPKNYKP QFSTDALQHSN
Sbjct: 299 ATAIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSN 358

Query: 353 VKLTWDETPADRVEISKRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXXXXXXLKSLVGGG 412
           VKLTWDETP +R E++KRAF+QKEID+MDFKAYLA                 LK+LVGGG
Sbjct: 359 VKLTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVGGG 418

Query: 413 AFGN--VFGKXXXXXXXXXXXXXXXXMEITFTPGLDEKKEASDNETKKEESTIXXXXXXX 470
            FG+  +FG                 MEITF P LDE     D E   EE+TI       
Sbjct: 419 GFGSREIFG---GKGAKAGEDEDEVDMEITFNPALDENSPKEDGE--HEETTIEKVARKE 473

Query: 471 XXXXXXXXXXVKDLKEKSVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAELELLMM 530
                     +K+LK K+ Q                                AELELLMM
Sbjct: 474 KERRKARKQKLKELKTKAQQ--EKKDKLKLSKNKKNHTKEDDAEAKKNQKSRAELELLMM 531

Query: 531 DEDDRI-SGVNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFED 589
           D+D+   S +NNKAHFNMNEILRSEKEKGK+ KYQ+K+KIV+DEFKP+LND RF E+FED
Sbjct: 532 DDDEETGSTINNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFED 591

Query: 590 HAFAIDPTQPEFKQTSAMKEILNERTKR 617
           H FAIDP++PEFK+T AMKEIL ER+KR
Sbjct: 592 HDFAIDPSRPEFKETKAMKEILKERSKR 619

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (77%)

Query: 2  SERKPKEDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIID 59
          SE K   D RFA ++ DPKFR++K   LK+KLD+RFSKKDL++  KSKVD+YGRK+ D
Sbjct: 6  SENKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLAD 63

>Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  498 bits (1281), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 288/614 (46%), Positives = 343/614 (55%), Gaps = 45/614 (7%)

Query: 9   DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIIDRNXXXXXXX 68
           DARFAG++ DPKF+ ++    K+KLD+RFSKKDL+V +KSKVD+YGRKI D +       
Sbjct: 12  DARFAGIYNDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDAHNTKELED 71

Query: 69  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLAELARLDRARGDVPXXXX 128
                                                        A +DRARG+VP    
Sbjct: 72  FDKYFEKEAENEEDTEADVK-------------------------ATVDRARGEVPNDYV 106

Query: 129 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPETGDPSKTVAVVNLDWDHVKSTDLMI 188
                                           KPE+GD SKT+AVVNLDWDHVKS DLMI
Sbjct: 107 SSGDEFTSSDSESSGESEIESEEESEVEAEDAKPESGDASKTLAVVNLDWDHVKSEDLMI 166

Query: 189 TFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPXXX-XXXXXXXXXXSTAEDNEDDV 247
           TFSGF+PKGGKI +I++YPSEFGKERMQREEIEGPP                  D+ D  
Sbjct: 167 TFSGFVPKGGKIERISVYPSEFGKERMQREEIEGPPKELFQRKKQVKASKKENADDSDSD 226

Query: 248 SDVDINDLYEEGDADKNIDSKSXXXXXXXXXXXXXAVVYCNNIGTAESIYKNCDGTEYES 307
            D+ I DLYEEGDADK++DS++             A+V C++I TA +IY+NCDGTEYES
Sbjct: 227 IDIGIKDLYEEGDADKDVDSRALRQYQLDRLRYYYAIVDCSDISTARAIYENCDGTEYES 286

Query: 308 TANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDETPADRVEI 367
           TAN+FD+RYVPD MTFDDT RD C  LPKNY+P QFSTDALQHSNVKLTWDETPADRVE+
Sbjct: 287 TANMFDLRYVPDGMTFDDTARDACSTLPKNYRPHQFSTDALQHSNVKLTWDETPADRVEV 346

Query: 368 SKRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXXXXXXLKSLVGGGAFGNVFGKXXXXXXX 427
           +KRAF+QKEID+MDFKAYLA                 LKSLVGG  F +           
Sbjct: 347 AKRAFTQKEIDDMDFKAYLASDSDESDEEVNEDAKSKLKSLVGGLGFNS------KKENA 400

Query: 428 XXXXXXXXXMEITFTPGLDEKKEASDNE--TKKEESTIXXXXXXXXXXXXXXXXXVKDLK 485
                    MEITFTP L    E  D +    +EE++I                 VK+LK
Sbjct: 401 NDGDEEEVDMEITFTPAL----EGGDEKPIEGQEETSIEKIRRKEKERRKARKQKVKELK 456

Query: 486 EKSVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAELELLMMDEDD--RISGVNNKA 543
           ++S                                  AELELLM D+ D    S +N+KA
Sbjct: 457 QQS-----EKEKRGKFKSANKKHVADEEEIKNNAKSKAELELLMDDDGDAEAESSINSKA 511

Query: 544 HFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQPEFKQ 603
           HFNMNEILRSEKEK KKS+YQ K +IV+D F P+L D RF E+FEDH FAIDPTQPE+K 
Sbjct: 512 HFNMNEILRSEKEKHKKSRYQKKERIVEDNFTPDLEDPRFKEVFEDHDFAIDPTQPEYKG 571

Query: 604 TSAMKEILNERTKR 617
           T AM +IL ER KR
Sbjct: 572 TQAMNKILKERGKR 585

>TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {ON}
           Anc_5.430 YDR365C
          Length = 622

 Score =  491 bits (1265), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 300/622 (48%), Positives = 360/622 (57%), Gaps = 41/622 (6%)

Query: 1   MSERKP-KEDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIID 59
           MS  KP   D RF+GVF DPKF+ ++K +LK+KLD+RFSK DL+VN K++VD+YGRKI +
Sbjct: 1   MSSDKPVNTDERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLEVNRKARVDKYGRKISN 60

Query: 60  RNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLAELARLDRA 119
            N                                                +A    +DRA
Sbjct: 61  LNNQEAKDFDKYFEKEEDGKGEE---------------------------IAVKPLIDRA 93

Query: 120 RGDVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPETGDPSKTVAVVNLDWD 179
           RG+VP                                    KPE+GD SKT+AVVNLDWD
Sbjct: 94  RGEVPSDYQSSLDDYTSSESEDSEDEDLESEGESEAEIEETKPESGDSSKTIAVVNLDWD 153

Query: 180 HVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPXXXXXXXXXXXXXST 239
           HVK+TDL++TFS F+PKGGKI +IAI+PSEFGK+RM+REE+EGPP              +
Sbjct: 154 HVKATDLLVTFSSFVPKGGKIERIAIFPSEFGKQRMEREELEGPPKELFQKKKKKNSKKS 213

Query: 240 AEDNEDDVSDVDINDLYEEGDADKNIDSKSXXXXXXXXXXXXXAVVYCNNIGTAESIYKN 299
             +  DD SDVDINDLYEEGD DK +DSKS             AVV+CNNI TAE+IY N
Sbjct: 214 NAEFNDD-SDVDINDLYEEGDVDKEVDSKSLRQYQLDRLRYYYAVVFCNNISTAEAIYNN 272

Query: 300 CDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDE 359
           CDGTEYESTANVFD+RYVPD M F+D P DEC +LPKNY PL F+TDALQHSNVKLTWDE
Sbjct: 273 CDGTEYESTANVFDLRYVPDGMDFEDQPYDECTELPKNYTPLNFTTDALQHSNVKLTWDE 332

Query: 360 TPADRVEISKRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXXXXXXLKSLVGGGAFGNVFG 419
           TPADRVEI+KRAF+QKEIDEMDFKAYLA                 LKSLVG        G
Sbjct: 333 TPADRVEIAKRAFTQKEIDEMDFKAYLA-SDSEESEGENEEVKNKLKSLVG---LSMKIG 388

Query: 420 KXXXXXXXXXXXXXXXXMEITFTPGLDEKKEASDNETKKEESTIXXXXXXXXXXXXXXXX 479
                            MEITFTPGL  + + +D E + EE+TI                
Sbjct: 389 DKSIMDNKSDNEDGEVDMEITFTPGL-AENDNNDKEEENEETTIEKVRRKEKERRKARKQ 447

Query: 480 XVKDLKEKSVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAELELLMMDED--DRIS 537
            +K++K+ S Q                                AELELLMMDED  +  S
Sbjct: 448 KLKEIKQNSEQ-----EKREKLKSLKTERSKKSEDTESDKNAKAELELLMMDEDEINGTS 502

Query: 538 GVNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPT 597
            +N KAHFNM EILRSEKEK KKSK+Q+K KIV+D FK +LND RF+E+FEDH FAIDPT
Sbjct: 503 TINKKAHFNMKEILRSEKEKTKKSKFQNKEKIVEDNFKADLNDPRFNEMFEDHDFAIDPT 562

Query: 598 QPEFKQTSAMKEILNERTKRAS 619
           Q E+K+T+AMKEIL ER+KR++
Sbjct: 563 QSEYKETAAMKEILKERSKRST 584

>Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365C -
           Protein required for cell viability [contig 130] FULL
          Length = 644

 Score =  481 bits (1239), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 280/612 (45%), Positives = 341/612 (55%), Gaps = 21/612 (3%)

Query: 9   DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIIDRNXXXXXXX 68
           D RFA V +DPKFR +K    K+KLD+RFSKKDLQ   K++VD+YGR +  +        
Sbjct: 14  DPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLKGQENKDKKDF 73

Query: 69  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLAELARLDRARGDVPXXXX 128
                                                    +  ++ LDRARG+VP    
Sbjct: 74  DKYYEKDDKKKEDKVKPDDEEKSDSEAESANEAKDIGDSAAVKPVS-LDRARGEVPSDYV 132

Query: 129 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPETGDPSKTVAVVNLDWDHVKSTDLMI 188
                                           KP++GD SKT+AVVNLDWDHVKSTDLMI
Sbjct: 133 SSSEDESSSESEAGSEDSDIESEESEVEIEDTKPQSGDSSKTLAVVNLDWDHVKSTDLMI 192

Query: 189 TFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPXXXXXXXXXXXXXSTAEDNEDDVS 248
           TFS F+P GGKI KIA+YPSEFGKER++REE+EGPP                + + D   
Sbjct: 193 TFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFKSKNSKKKSHDDDSDSDVDV 252

Query: 249 DVDINDLYEEGDADKNIDSKSXXXXXXXXXXXXXAVVYCNNIGTAESIYKNCDGTEYEST 308
                DLYEEGDA+ + D+KS             AVVYCNN+ TAE+IYKNCDGTE+EST
Sbjct: 253 ----RDLYEEGDAE-DYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCDGTEFEST 307

Query: 309 ANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDETPADRVEIS 368
           AN+FD+RYVPD MTFDD  RDEC  +PKNY+P QFSTDALQHS VKLTWDETPADRV +S
Sbjct: 308 ANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETPADRVAMS 367

Query: 369 KRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXXXXXXLKSLVGGGAFGNVFGKXXXXXXXX 428
           KRAF+QKEI++MDFKAYLA                 LKSLV         G         
Sbjct: 368 KRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSV---KVGDKSIFDQAP 424

Query: 429 XXXXXXXXMEITFTPGLDEKKEASDNETKKEESTIXXXXXXXXXXXXXXXXXVKDLKEKS 488
                   M+ITF PGL E  E  D +   EE+T+                 +K+LK+++
Sbjct: 425 EEGESDVDMQITFAPGLAEGAE-DDKQENAEETTLEKLKRKEKERKKMRKERIKELKKQA 483

Query: 489 VQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAELELLMMDEDDRISG--VNNKAHFN 546
            +                                AELELLMMD+D+  S   +N KAHFN
Sbjct: 484 EE---------EKKQKRKESRYKPESTVEDAKSKAELELLMMDDDENNSSSKLNKKAHFN 534

Query: 547 MNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQPEFKQTSA 606
           MNEI+RSEKEKGKKS+YQ+K+KIV+DEFKP+LND RF E+FED  FAIDP+QPEFK T+A
Sbjct: 535 MNEIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAA 594

Query: 607 MKEILNERTKRA 618
           MK+IL ERTKR+
Sbjct: 595 MKQILQERTKRS 606

>KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 646

 Score =  479 bits (1234), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 273/612 (44%), Positives = 341/612 (55%), Gaps = 22/612 (3%)

Query: 9   DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIIDRNXXXXXXX 68
           D RFAGV  DPKFR ++    K+KLD+RFSKKDL+   K++VD+YGR++           
Sbjct: 14  DPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRL---KGQESKDK 70

Query: 69  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLAELARLDRARGDVPXXXX 128
                                                     A+   LDRARG+V     
Sbjct: 71  RDFDKYYEKEKSGKTAPDSELVGKPSEEDSEGGSSDEEGAASAKTVSLDRARGEVHSDYV 130

Query: 129 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPETGDPSKTVAVVNLDWDHVKSTDLMI 188
                                           + ++GD SKT+AVVNLDWDHVKSTDLM+
Sbjct: 131 SSSDEESSSESEEDSADSDLESEESEVQIEEGEVKSGDSSKTLAVVNLDWDHVKSTDLMV 190

Query: 189 TFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPXXXXXXXXXXXXXSTAEDNEDDVS 248
           TFS F+PKGGKIN++AIYPSEFGKER+ +EE EGPP             S  +D++++++
Sbjct: 191 TFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKK-SHGDDSDEELT 249

Query: 249 DVDINDLYEEGDADKNIDSKSXXXXXXXXXXXXXAVVYCNNIGTAESIYKNCDGTEYEST 308
              + DLYEEGDAD + D+KS             AVVYCNN  TAESIYKNCDGTEYEST
Sbjct: 250 ---VKDLYEEGDAD-DFDAKSLRRYQLERLRYYYAVVYCNNKQTAESIYKNCDGTEYEST 305

Query: 309 ANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDETPADRVEIS 368
           AN+FD+RYVPD M FDD  RDECD +PKNY+P +FSTDALQHS VK TWDETPADR  ++
Sbjct: 306 ANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPADRTAMA 365

Query: 369 KRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXXXXXXLKSLVGGGAFGNVFGKXXXXXXXX 428
           KRAF+Q+EI++MDFKAYLA                 LKSLV         G+        
Sbjct: 366 KRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSV---QVGEKSIFDQDP 422

Query: 429 XXXXXXXXMEITFTPGLDEKKEA-SDNETKKEESTIXXXXXXXXXXXXXXXXXVKDLKEK 487
                   M+ITF P L E     +D+  K EE+T+                 +K+LK++
Sbjct: 423 KDGESDVDMQITFAPALAEGGSGDADDGEKTEETTLEKVRRKEKERKKMRKERIKELKKQ 482

Query: 488 SVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAELELLMMDEDDRI-SGVNNKAHFN 546
           +                                  AELELLMMD+ +   S +N KAHFN
Sbjct: 483 A---------EDDKKQKLKEARRKPEPSATDSKSQAELELLMMDDSEEANSKLNKKAHFN 533

Query: 547 MNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQPEFKQTSA 606
           MNEI+RSEKEKGKK+K+QDKN+IV+DEFKP+LND RF E+FEDH FAIDP+QPEFK T+A
Sbjct: 534 MNEIVRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAA 593

Query: 607 MKEILNERTKRA 618
           MK+IL ER KR+
Sbjct: 594 MKQILQERNKRS 605

>TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.430
           YDR365C
          Length = 617

 Score =  471 bits (1213), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 291/619 (47%), Positives = 351/619 (56%), Gaps = 43/619 (6%)

Query: 1   MSERKPKEDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIIDR 60
           MSE++ K D RF+ ++ DPKF   K    KVKLD+RFSKKDL++  K+KVD+YGR++ D 
Sbjct: 1   MSEKRSK-DPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDV 59

Query: 61  NXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLAELARLDRAR 120
                                                              E+  +DRAR
Sbjct: 60  EDSKESKDFDKYFEQSDEEKKKDKD-------------------------TEILTVDRAR 94

Query: 121 GDVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPETGDPSKTVAVVNLDWDH 180
           G+VP                                    +P +GD SKT+AVVNLDWD+
Sbjct: 95  GEVPSDYVSSSDEFTSSDSEVSDNEVESESESEVELEKT-EPSSGDSSKTLAVVNLDWDN 153

Query: 181 VKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPXXXXXXXXXXXXXSTA 240
           V+S+DLMITFS F+P GG+I KIAIYPSEFGKERMQREE+EGPP                
Sbjct: 154 VRSSDLMITFSSFLPAGGRIEKIAIYPSEFGKERMQREEVEGPPKELFQKKKKKSKKGQQ 213

Query: 241 EDNEDDVSDVDINDLYEEGDADKNIDSKSXXXXXXXXXXXXXAVVYCNNIGTAESIYKNC 300
           ED++   SD+D+ DLYEEGDADKN+D+K+             AVVYCNN+  AESIY NC
Sbjct: 214 EDSD---SDIDVKDLYEEGDADKNVDNKALRQYQLDRLRYYYAVVYCNNVAAAESIYNNC 270

Query: 301 DGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDET 360
           DGTEYESTAN+FDIRYVPD M FD  P+D C +LPKNYKPLQFSTDALQHSNVKLTWDET
Sbjct: 271 DGTEYESTANIFDIRYVPDGMDFDGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDET 330

Query: 361 PADRVEISKRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXXXXXXLKSLVGGGAFGNVFGK 420
           PADR++++KRAF+QKEI++MDFKAYLA                 LKSLV G +    F  
Sbjct: 331 PADRLDVAKRAFTQKEIEDMDFKAYLASDSDDSEDEVDAQSKSKLKSLVTGSS---AFDF 387

Query: 421 XXXXXXXXXXXXXXXXMEITFTPGLDEKKEASDNETKKEESTIXXXXXXXXXXXXXXXXX 480
                           MEITFTPGLDE  +    E ++EESTI                 
Sbjct: 388 TRKNADEVDGNDEEVDMEITFTPGLDEANKDG-QEGQEEESTIDKVRRKEKERRKARKAK 446

Query: 481 VKDLKEKSVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAELELLMM-DEDDRISGV 539
           VK+LK ++ Q                                AELELLMM DEDD    +
Sbjct: 447 VKELKHQAEQ--------DKKVKLKKGRGKQTSDIEQDPKSKAELELLMMDDEDDTEKSI 498

Query: 540 NNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQP 599
           N KAHFNM EIL+SEKEK KK+KYQDKNKIV D+FKP+L D RF E+FE H FAIDPTQ 
Sbjct: 499 NKKAHFNMKEILKSEKEKKKKNKYQDKNKIVVDDFKPDLEDPRFKEMFEGHDFAIDPTQS 558

Query: 600 EFKQTSAMKEILNERTKRA 618
           EF+ T AMKE+LN+R+K+A
Sbjct: 559 EFRGTKAMKEMLNKRSKQA 577

>SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 623

 Score =  469 bits (1206), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 261/511 (51%), Positives = 306/511 (59%), Gaps = 24/511 (4%)

Query: 113 LARLDRARGDVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPETGDPSKTVA 172
           +  LDRARG+VP                                    KP TGD ++ +A
Sbjct: 95  VTSLDRARGEVPSDYLSSSEEESSSESEEESENSELESEESDLEIEESKPPTGDATRMLA 154

Query: 173 VVNLDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPXXXXXXXX 232
           VVNLDWDHVKSTDLM+TFS F+PKGGKI KIAIYPSEFGKERMQREE+EGPP        
Sbjct: 155 VVNLDWDHVKSTDLMVTFSSFVPKGGKILKIAIYPSEFGKERMQREEVEGPPRELFQGKK 214

Query: 233 XXXXXSTAEDNEDDVSDVDINDLYEEGDADKNIDSKSXXXXXXXXXXXXXAVVYCNNIGT 292
                   +D     SDVDI DLYEEGDA+K+ DSK+             AVV+CNN+ T
Sbjct: 215 KKSQRKDGDD-----SDVDIKDLYEEGDAEKDYDSKALRRYQLDRLRYYYAVVFCNNVET 269

Query: 293 AESIYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSN 352
           AE+IY+NCDGTEYESTAN+FD+RYVP+ M F D P+DEC+ +PKNYKP QFSTDALQHSN
Sbjct: 270 AEAIYQNCDGTEYESTANMFDLRYVPEGMDFSDEPKDECEDVPKNYKPAQFSTDALQHSN 329

Query: 353 VKLTWDETPADRVEISKRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXXXXXXLKSLVGGG 412
           VKLTWDETPA+RVE+SKRAF+QKEI++MDFKAYLA                 LKSLV   
Sbjct: 330 VKLTWDETPAERVEMSKRAFTQKEIEDMDFKAYLASDSEGSEEEINEDSRNKLKSLVSES 389

Query: 413 A-FGN--VFGKXXXXXXXXXXXXXXXXMEITFTPGLDEKKEASDNETKKEESTIXXXXXX 469
              G+  +F K                MEITFTPGLDE K+  D+E  K+E+TI      
Sbjct: 390 IRIGDKSLFDK-------SDNEGGDVDMEITFTPGLDEAKK--DDEDGKDETTIEKIRRK 440

Query: 470 XXXXXXXXXXXVKDLKEKSVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAELELLM 529
                      V                                         AELELLM
Sbjct: 441 EKERRKMRKERV------KELKKKAEEKKREKLNKSDSQSKTADEVEKEKKSKAELELLM 494

Query: 530 MDED-DRISGVNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFE 588
           MD+D D  S +N KAHFNM EILRSEKEKGK++KYQ++ KIV+DEFKP+LND RF E+FE
Sbjct: 495 MDDDNDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPDLNDPRFREVFE 554

Query: 589 DHAFAIDPTQPEFKQTSAMKEILNERTKRAS 619
           DH FAIDP+QPEFK T+AMKEIL ER +R S
Sbjct: 555 DHDFAIDPSQPEFKGTTAMKEILKERNQRVS 585

 Score = 67.0 bits (162), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 43/51 (84%)

Query: 9  DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIID 59
          D RF+G+ +DPKF+ +K  +LK+KLD+RFSKKDL++  K+KVD+YGR++ D
Sbjct: 13 DPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKD 63

>Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {ON}
           YDR365C (REAL)
          Length = 627

 Score =  469 bits (1206), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 250/461 (54%), Positives = 294/461 (63%), Gaps = 18/461 (3%)

Query: 161 KPETGDPSKTVAVVNLDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEI 220
           KPE GD SKT+AVVNLDWDHVKS DLMITFS F+PKGGK+ ++AIYPSEFGKERMQREE+
Sbjct: 139 KPECGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPKGGKLERVAIYPSEFGKERMQREEV 198

Query: 221 EGPPXXXXXXXXXXXXXSTAEDNEDDVSDVDI--NDLYEEGDADKNIDSKSXXXXXXXXX 278
           EGPP                + +E D SD+DI  NDLYEEGDADK++DS++         
Sbjct: 199 EGPPKELFQKKNKNKVSRKKKSDESD-SDIDIGINDLYEEGDADKDVDSRALRQYQLDRL 257

Query: 279 XXXXAVVYCNNIGTAESIYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNY 338
               A+VYC++I T+++IY NCDGTEYESTAN+FD+RYVPD MTFDD  RDEC  LPKNY
Sbjct: 258 RYYYAIVYCSDITTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDAVRDECTLLPKNY 317

Query: 339 KPLQFSTDALQHSNVKLTWDETPADRVEISKRAFSQKEIDEMDFKAYLAXXXXXXXXXXX 398
           +P QFSTDALQHSNVKLTWDETPADR+E++KRAF+QKEID+MDFKAYLA           
Sbjct: 318 RPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKAYLASDSDESDEQID 377

Query: 399 XXXXXXLKSLVGGGAFGNVFGKXXXXXXXXXXXXXXXXMEITFTPGLDEKKEASDNETKK 458
                 LKSLVGG  F +                    MEITFTP L+   E    E  +
Sbjct: 378 EDAKNKLKSLVGGINFNS-------KKENVKDSDEEVDMEITFTPALEGGNEQPSEE--Q 428

Query: 459 EESTIXXXXXXXXXXXXXXXXXVKDLKEKSVQXXXXXXXXXXXXXXXXXXXXXXXXXXXX 518
           EE+TI                 VK+LK++S                              
Sbjct: 429 EETTIEKIRRKEKERRKARKQKVKELKQQS-----EKDKKTKLKSINKKYAEGEEDIKNN 483

Query: 519 XXXXAELELLMMDEDDRISG-VNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPN 577
               AELELLM D+D    G +NNKAHFNMNEILRSEKEK KKS+YQ+K +IV+D F P+
Sbjct: 484 AKAKAELELLMDDDDAEAQGTINNKAHFNMNEILRSEKEKNKKSRYQNKERIVEDNFTPD 543

Query: 578 LNDSRFDEIFEDHAFAIDPTQPEFKQTSAMKEILNERTKRA 618
           LND RF E+FEDH FAIDPTQPE+K T AM +IL ER KR 
Sbjct: 544 LNDPRFKEVFEDHDFAIDPTQPEYKSTQAMNKILKERGKRV 584

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 49/60 (81%), Gaps = 3/60 (5%)

Query: 1  MSERKPKE---DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKI 57
          M+E KP++   D RFAG+++DPKF+ ++    K+KLD+RFSKKDL+V +KSKVD+YGRKI
Sbjct: 1  MAEEKPQKEGADTRFAGIYSDPKFKNTRTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60

>Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  452 bits (1162), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 279/618 (45%), Positives = 342/618 (55%), Gaps = 53/618 (8%)

Query: 9   DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIID-RNXXXXXX 67
           DARFAG+ +DPKF+ ++    K+KLD+RFSKKDL+V +KSKVD+YGRKI D RN      
Sbjct: 12  DARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDARNNKELED 71

Query: 68  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLAELARLDRARGDVPXXX 127
                                                    V A++  +DRARG+VP   
Sbjct: 72  FDKYFEKEAEHDEDSE-------------------------VAAKIV-VDRARGEVPSDY 105

Query: 128 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPETGDPSKTVAVVNLDWDHVKSTDLM 187
                                              E+GD SKT+AVVNLDWDHVKS DLM
Sbjct: 106 VSSSDEFTSSDSESSGESEVESEVEGEVETEDVAAESGDVSKTLAVVNLDWDHVKSEDLM 165

Query: 188 ITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPP----XXXXXXXXXXXXXSTAEDN 243
           ITFS F+P+GGKI +IAI+PSEFG+ERM+REE+EGPP                 S   D+
Sbjct: 166 ITFSSFVPRGGKIERIAIFPSEFGRERMEREEVEGPPKELFQKKNKNKHAKEKNSVGTDS 225

Query: 244 EDDVSDVDINDLYEEGDADKNIDSKSXXXXXXXXXXXXXAVVYCNNIGTAESIYKNCDGT 303
           + D+    INDLYEEGDADK++DS++             AVV C++  +A++IY NCDGT
Sbjct: 226 DGDIG---INDLYEEGDADKDVDSRALRQYQLDRLRYYYAVVCCSDTTSAKAIYDNCDGT 282

Query: 304 EYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDETPAD 363
           EYESTAN+FD+RYVPD MTFDD  RDEC  LPKNY+P QFSTDALQHSNVKLTWDETPAD
Sbjct: 283 EYESTANMFDLRYVPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPAD 342

Query: 364 RVEISKRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXXXXXXLKSLVGGGAFGNVFGKXXX 423
           R+E++KRAF+QKEID+MDFKAYLA                 LKSLVGG  F         
Sbjct: 343 RLEVAKRAFTQKEIDDMDFKAYLASDSDESDEQVDEDAKNKLKSLVGGLDFN-----MKK 397

Query: 424 XXXXXXXXXXXXXMEITFTPGLDEKKEASDNET---KKEESTIXXXXXXXXXXXXXXXXX 480
                        MEITFTP L+      +NE     ++E+TI                 
Sbjct: 398 KGANDGKEEGEVDMEITFTPALE-----GENEKPIEGQDETTIEKIRRKEKERRKARKQK 452

Query: 481 VKDLKEKSVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAELELLMMDEDDRISG-V 539
           VK+LK++S                                  AELELLM ++D    G +
Sbjct: 453 VKELKQQS-----EKDKKSKLKSVNKKHVADEEEIKNNAKSKAELELLMDEDDAETEGSM 507

Query: 540 NNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQP 599
           N+KAHF+M EILRSEKEK K+ +YQ K +IV+D F P+L D RF E+FEDH FAIDPTQP
Sbjct: 508 NSKAHFSMKEILRSEKEKHKRGRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQP 567

Query: 600 EFKQTSAMKEILNERTKR 617
           E+K T AM  IL ER KR
Sbjct: 568 EYKNTQAMSTILKERGKR 585

>ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 611

 Score =  446 bits (1147), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 253/461 (54%), Positives = 297/461 (64%), Gaps = 32/461 (6%)

Query: 161 KPETGDPSKTVAVVNLDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEI 220
           KPE+GDPSKT+AVVNLDWDHV++ DLMITFS F+P GGKI KI IYPSEFGKERMQREE 
Sbjct: 142 KPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGKIEKICIYPSEFGKERMQREEK 201

Query: 221 EGPPXXXXXXXXXXXXXSTAEDNEDDVSDVDINDLYEEGDADKNIDSKSXXXXXXXXXXX 280
           EGPP                  +ED  SDVDI DLYEEGDADK +D+ +           
Sbjct: 202 EGPPREIFNKKKKHH-------DEDSDSDVDIRDLYEEGDADKEVDNAALRQYQLERLRY 254

Query: 281 XXAVVYCNNIGTAESIYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKP 340
             A+VYCNN+ T ESIY NCDGTEYESTAN+FD+RYVP+ M FDD P+DEC +LPKNYKP
Sbjct: 255 YYAIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEFDDEPKDECKELPKNYKP 314

Query: 341 LQFSTDALQHSNVKLTWDETPADRVEISKRAFSQKEIDEMDFKAYLAXXXXXX--XXXXX 398
           L+FSTDALQHSNVKLTWDETP DR+E+SKRAFSQKE+++MDF+AYLA             
Sbjct: 315 LEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQAYLASGTDESDGEENNN 374

Query: 399 XXXXXXLKSLVGGGAFGNVFGKXXXXXXXXXXXXXXXXMEITFTPGLDEKKEASDNETKK 458
                 LKSLVG       +GK                MEITFTPGLD+ K  +D +   
Sbjct: 375 EEAKNKLKSLVGQSL---AYGK---------QQEEEPDMEITFTPGLDDSKPQADED--H 420

Query: 459 EESTIXXXXXXXXXXXXXXXXXVKDLKEKSVQXXXXXXXXXXXXXXXXXXXXXXXXXXXX 518
           EE+TI                 +K+LK+++ Q                            
Sbjct: 421 EETTIEKVKRKEQERRKARKQRLKELKQQAEQ--------EKKEKLRSGKNKKQVEDESD 472

Query: 519 XXXXAELELLMM-DEDDRISGVNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPN 577
               AELELLMM DEDD    +N KAHFNMNEIL+SEKEK KK KYQDK KI++DEFKP+
Sbjct: 473 AKSKAELELLMMEDEDDTEKSLNKKAHFNMNEILKSEKEKKKKGKYQDKGKIMEDEFKPD 532

Query: 578 LNDSRFDEIFEDHAFAIDPTQPEFKQTSAMKEILNERTKRA 618
           LND RF+E+FE+  FAIDP+QPE+K T AMKEIL ER+KRA
Sbjct: 533 LNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRA 573

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 39/49 (79%)

Query: 9  DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKI 57
          D RFAG+  DPKFR  KK  LKVKLD+RFSKKDL V  K+KVD+YGR+I
Sbjct: 12 DPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI 60

>Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON}
           (16620..18533) [1914 nt, 638 aa]
          Length = 637

 Score =  444 bits (1143), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 265/508 (52%), Positives = 306/508 (60%), Gaps = 12/508 (2%)

Query: 111 AELARLDRARGDVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPETGDPSKT 170
           A++  LDRARG+VP                                    KPE+GD SKT
Sbjct: 92  AKVKVLDRARGEVPSDYESSSEEFTSSDSESSGESEVDSDEESEDEVETSKPESGDSSKT 151

Query: 171 VAVVNLDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPXX---- 226
           +AVVNLDWD+VKS DLMITFS F+PKGGKI KI IYPSEFGKERM REE+EGPP      
Sbjct: 152 LAVVNLDWDYVKSQDLMITFSSFLPKGGKIEKICIYPSEFGKERMAREEVEGPPRELFNK 211

Query: 227 XXXXXXXXXXXSTAEDNEDDVSDVDINDLYEEGDADKNIDSKSXXXXXXXXXXXXXAVVY 286
                         +++++  SDVDI +LYEEGDA+K++DSK+             AVVY
Sbjct: 212 KKNKKSSKKSSKDDDEDDESDSDVDIRELYEEGDAEKDVDSKALRQYQLERLRYYYAVVY 271

Query: 287 CNNIGTAESIYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTD 346
           CNNI +AESIY+NCDGTEYES+AN+FD+RYVPD   FDD PRDEC QLPKNYK  QF+TD
Sbjct: 272 CNNIASAESIYENCDGTEYESSANIFDLRYVPDGTEFDDEPRDECLQLPKNYKVRQFTTD 331

Query: 347 ALQHSNVKLTWDETPADRVEISKRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXXXXXXLK 406
           ALQHSNVKLTWDETPADRVEI+KRAF+QKEI+EMDFKAYLA                 LK
Sbjct: 332 ALQHSNVKLTWDETPADRVEIAKRAFTQKEIEEMDFKAYLASDSDESEEEPNDDVKNKLK 391

Query: 407 SLVGGGAFGNVFGKXXXXXXXXXXXXXXXXMEITFTPGLDEKKEASDNETKKEESTIXXX 466
           SLV       +  K                MEITFTPGL E  E  D +   EE+TI   
Sbjct: 392 SLVSQST--TIGDKSIFDDKGDNNEEDDVDMEITFTPGLGEGGEDGDEDKDNEETTIEKV 449

Query: 467 XXXXXXXXXXXXXXVKDLKEKSVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAELE 526
                         +K LK++S                                  AELE
Sbjct: 450 RRKEKERRKARKDKLKQLKQQS-----ENEKKEKLKELKKERNGNGKNTNVDAKAKAELE 504

Query: 527 LLMM-DEDDRISGVNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDE 585
           LLMM DE +  S +N KAHFNMNEI+RSEKEKGKKSKYQDKNKIV+D+FKP+LND RF E
Sbjct: 505 LLMMDDETESTSTLNKKAHFNMNEIVRSEKEKGKKSKYQDKNKIVEDDFKPDLNDPRFKE 564

Query: 586 IFEDHAFAIDPTQPEFKQTSAMKEILNE 613
           IFEDH FAIDPTQ EFK+T+AMKEIL E
Sbjct: 565 IFEDHDFAIDPTQSEFKETTAMKEILKE 592

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 45/55 (81%)

Query: 5  KPKEDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIID 59
          K   D RF+G+++DPKF+ SK+ ++K+KLD+RF K DLQ+ +KSKVD+YGRK+ D
Sbjct: 8  KQSSDPRFSGIYSDPKFKNSKRKNIKIKLDDRFDKSDLQIKHKSKVDKYGRKLKD 62

>CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON}
           similar to uniprot|Q06344 Saccharomyces cerevisiae
           YDR365c
          Length = 608

 Score =  443 bits (1140), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 245/464 (52%), Positives = 298/464 (64%), Gaps = 33/464 (7%)

Query: 161 KPETGDPSKTVAVVNLDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEI 220
           K ETGD +KT+A VNLDWDHV+S D+M+TFS F+PKGGKI KI IYPSEFGKERM+REE+
Sbjct: 142 KVETGDATKTLAAVNLDWDHVRSVDMMVTFSSFLPKGGKIEKICIYPSEFGKERMKREEV 201

Query: 221 EGPPXXXXXXXXXXXXXSTAEDNEDDVSDVDINDLYEEGDADKNIDSKSXXXXXXXXXXX 280
           EGPP             +++ED E+  SDVDI DLYEEG+AD  +D ++           
Sbjct: 202 EGPPRELFQKNKKKKKKNSSEDEEE--SDVDIKDLYEEGNADDQVDKRALRQYQLDRLRY 259

Query: 281 XXAVVYCNNIGTAESIYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKP 340
             AV+YCNN+ +A++IY+NCDGTEYESTAN+ D+RYVPD M FDD P+D+C++LPKNYKP
Sbjct: 260 YYAVIYCNNVESAKAIYENCDGTEYESTANIIDLRYVPDGMDFDDEPKDQCEELPKNYKP 319

Query: 341 LQFSTDALQHSNVKLTWDETPADRVEISKRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXX 400
            QFSTDALQHSNVKLTWDETP DRVE++KRAF+QKEI++MDFKAYLA             
Sbjct: 320 HQFSTDALQHSNVKLTWDETPVDRVEVAKRAFTQKEIEDMDFKAYLASDSDESEEEVNEE 379

Query: 401 XXXXLKSLVGGGAFGNVFGKXXXXXXXXXXXXXXXXMEITFTPGLDEK------KEASDN 454
               LKSLVG      + GK                MEITFTPGLDE       K+  DN
Sbjct: 380 AKNKLKSLVGESL--KIDGK------DGSDEDEGMDMEITFTPGLDEANAEGEDKDGEDN 431

Query: 455 ETKKEESTIXXXXXXXXXXXXXXXXXVKDLKEKSVQXXXXXXXXXXXXXXXXXXXXXXXX 514
               EE+TI                  K+ + +  +                        
Sbjct: 432 ----EETTIEKVRR-------------KEKERRKARKQKLKELKQKSEEEKKQKLKSKHD 474

Query: 515 XXXXXXXXAELELLMMDEDDRISGVNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEF 574
                   AELELLMMDE++  SG+N+KAHFNMNEILRSEKEK KK K+Q K +IV+D+F
Sbjct: 475 EPLSDKKKAELELLMMDENESNSGINSKAHFNMNEILRSEKEKSKKGKFQKKQRIVEDDF 534

Query: 575 KPNLNDSRFDEIFEDHAFAIDPTQPEFKQTSAMKEILNERTKRA 618
           KPNL+D RF E+FEDH FAIDP+QPEFK+T AMKEIL ER KR+
Sbjct: 535 KPNLDDDRFKEVFEDHDFAIDPSQPEFKETKAMKEILKERRKRS 578

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 1/57 (1%)

Query: 1  MSERKPKEDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKI 57
          MSE K   D RF+ ++ DPKF++S    LK+KLD+RF KKDL+V  ++KVD+YGRKI
Sbjct: 1  MSEEKSN-DPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVARRAKVDKYGRKI 56

>NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {ON}
           Anc_5.430 YDR365C
          Length = 639

 Score =  438 bits (1127), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 252/508 (49%), Positives = 301/508 (59%), Gaps = 16/508 (3%)

Query: 116 LDRARGDVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPETGDPSKTVAVVN 175
           +DRARG+VP                                     PETGD +KT+AVVN
Sbjct: 99  VDRARGEVPADYVSSSDEYTSSESEDSGESDLESEGESEIEVDEATPETGDATKTLAVVN 158

Query: 176 LDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPXXXXXXXXXXX 235
           LDWDHV+S+DLMITFSGF+PKGGKI KI + PSEFGKERMQREE EGPP           
Sbjct: 159 LDWDHVRSSDLMITFSGFLPKGGKIEKIVVLPSEFGKERMQREETEGPPRELFQKKKKKG 218

Query: 236 XXSTAEDNEDDVSDVDINDLYEEGDADKNIDSKSXXXXXXXXXXXXXAVVYCNNIGTAES 295
             ++ E + DD     I DLYEEGDADK++D+++             AVVYCN++  A +
Sbjct: 219 KRASVESDSDDSDVD-IKDLYEEGDADKDVDTRALRQYQLERLRYYYAVVYCNSVEAARA 277

Query: 296 IYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKL 355
           IY+NCDGTEYESTAN+FD+RYVPD M FDD PRD+C  LPKNYKP QFSTDALQHSNVKL
Sbjct: 278 IYENCDGTEYESTANMFDLRYVPDGMDFDDEPRDQCSSLPKNYKPHQFSTDALQHSNVKL 337

Query: 356 TWDETPADRVEISKRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXXXXXXLKSLVGGGA-F 414
           TWDETPA+RVE++KRAF+QKEI++MDFKAYLA                 LKSLVG     
Sbjct: 338 TWDETPAERVEVAKRAFTQKEIEDMDFKAYLASDSDGSEDEVNQDAKNKLKSLVGDSLRI 397

Query: 415 GN--VFGKXXXXXXXXXXXXXXXXMEITFTPGLDEKKEASDNETKKEESTIXXXXXXXXX 472
           GN  +FG                 MEITF PGL E  E ++   +     +         
Sbjct: 398 GNQPIFG----SKDTLEGEDEEVDMEITFDPGLSEGVEKTEEHEETTIEKVARKEKERRK 453

Query: 473 XXXXXXXXVKDLKEKSVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAELELLMM-D 531
                   +K+  +K  +                                AELELLMM D
Sbjct: 454 ARKQKLKELKNNAQKEKK-------DKLKSLKGKKHNDSTEGDASTAKSKAELELLMMDD 506

Query: 532 EDDRISGVNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHA 591
           EDD  +G+N KAHFNM EILRSEKEK KK KYQDK +IV+D FKP+LND RF E+FEDH 
Sbjct: 507 EDDTETGINKKAHFNMKEILRSEKEKSKKGKYQDKRRIVEDNFKPDLNDPRFKEVFEDHD 566

Query: 592 FAIDPTQPEFKQTSAMKEILNERTKRAS 619
           FAIDP++PEFK+T AMKEIL ER+KR+S
Sbjct: 567 FAIDPSRPEFKETPAMKEILKERSKRSS 594

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 47/57 (82%)

Query: 5  KPKEDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIIDRN 61
          K  +D+RF+G++ DPKFR++K  +LK+KLD RFSKKDL++  K+KVD+YGRKI + N
Sbjct: 8  KGTDDSRFSGIYNDPKFRKTKNKNLKIKLDERFSKKDLEIRRKAKVDKYGRKIHEDN 64

>KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.430
           YDR365C
          Length = 642

 Score =  437 bits (1124), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 257/467 (55%), Positives = 300/467 (64%), Gaps = 18/467 (3%)

Query: 161 KPETGDPSKTVAVVNLDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEI 220
           KPE+GDPSKT+AVVNLDWDHVKS DLMITF+GFIPKGGKI +I IYPSEFGKER+ REE 
Sbjct: 146 KPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPKGGKIERICIYPSEFGKERLNREEK 205

Query: 221 EGPPXXXXXXXXXXXXXSTAEDNEDD------VSDVDINDLYEEGDADKNIDSKSXXXXX 274
           EGPP             +      +       VSDVDI DLYEEGDA+K+IDSK+     
Sbjct: 206 EGPPKELFHKKKSKKNSAAKSKGAESGKSDDDVSDVDIKDLYEEGDAEKDIDSKALRQYQ 265

Query: 275 XXXXXXXXAVVYCNNIGTAESIYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQL 334
                   AVVYCNN+ TA++IY NCD TEYESTAN+FD+RYVP+ MTFDD PRDEC+ L
Sbjct: 266 LERLRYFYAVVYCNNVETAKAIYDNCDATEYESTANMFDLRYVPEGMTFDDDPRDECEAL 325

Query: 335 PKNYKPLQFSTDALQHSNVKLTWDETPADRVEISKRAFSQKEIDEMDFKAYLAXXXXXXX 394
           PKNYKPL F+TDALQHSNVKLTWDETPADRVEI+KRAFSQKEID+MDFKAYLA       
Sbjct: 326 PKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKRAFSQKEIDDMDFKAYLASDSEDSD 385

Query: 395 XXXXXXXXXXLKSLVGGGAFGNVFGKXXXXXXXXXXXXXXXXMEITFTPGLDEKKEASDN 454
                     LK+LVGG    +   +                MEITFTPGLDE + A   
Sbjct: 386 AKVDETMKNRLKALVGGTLKAS---RPKGGAEEDEDDEEGMDMEITFTPGLDEAQVAEQE 442

Query: 455 ETKKEESTIXXXXXXXXXXXXXXXXXVKDLKEKSVQXXXXXXXXXXXXXXXXXXXXXXXX 514
              +EESTI                 +K+LK+ +                          
Sbjct: 443 AAAEEESTIDKIRRKEKERRKNRKQKLKELKKNA------EKEKRDKLKSLKKGRKNGEE 496

Query: 515 XXXXXXXXAELELLMMDED---DRISGVNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQ 571
                   AELELLMMDED   D  S +N K HFNMNEI+RSEKEK KKSK+QDKN+IV+
Sbjct: 497 EPVDDKAKAELELLMMDEDEERDSKSTLNKKMHFNMNEIMRSEKEKKKKSKFQDKNRIVE 556

Query: 572 DEFKPNLNDSRFDEIFEDHAFAIDPTQPEFKQTSAMKEILNERTKRA 618
           DEFKP+L+D RF E+FEDH FAIDP++PEFK+T AM++IL ER+ RA
Sbjct: 557 DEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQERSNRA 603

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (85%)

Query: 9  DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKI 57
          D RF+GV+ DPKFR +K+  LKVKLD+RFSKKDL+V  K+KVD+YGRKI
Sbjct: 8  DPRFSGVYNDPKFRSTKEKKLKVKLDSRFSKKDLEVKKKAKVDKYGRKI 56

>YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}
           ESF1Nucleolar protein involved in pre-rRNA processing;
           depletion causes severely decreased 18S rRNA levels
          Length = 628

 Score =  435 bits (1119), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 241/504 (47%), Positives = 289/504 (57%), Gaps = 13/504 (2%)

Query: 116 LDRARGDVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPETGDPSKTVAVVN 175
           +DRARG+VP                                    KPE+GD SK +AVVN
Sbjct: 94  VDRARGEVPDDYVSSSDEFTSSDSESSGESEVESEEENEVEIENAKPESGDISKNLAVVN 153

Query: 176 LDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPXXXXXXXXXXX 235
           LDWDHVKS DLMITFS F+PKGGKI ++AIYPSEFGKERMQREE+EGPP           
Sbjct: 154 LDWDHVKSEDLMITFSSFVPKGGKIERVAIYPSEFGKERMQREEVEGPPKELFQKKNKNK 213

Query: 236 XXSTAEDNEDDVS-DVDINDLYEEGDADKNIDSKSXXXXXXXXXXXXXAVVYCNNIGTAE 294
                + ++ D   D+ I DLYEEGDADK++DS++             A+VYC++  T++
Sbjct: 214 TSKKKKTDDSDSDMDIGIKDLYEEGDADKDVDSRALRQYQLDRLRYYYAIVYCSDTTTSK 273

Query: 295 SIYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVK 354
           +IY NCDGTEYESTAN+FD+RYVPD MTFDD  RDEC  LPKNY+P QFSTDALQHS+VK
Sbjct: 274 AIYDNCDGTEYESTANMFDLRYVPDGMTFDDDVRDECSILPKNYRPHQFSTDALQHSSVK 333

Query: 355 LTWDETPADRVEISKRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXXXXXXLKSLVGGGAF 414
           LTWDETPADRVE++KRAF+QKEID+MDFKAYLA                 LKSLVG   F
Sbjct: 334 LTWDETPADRVEVAKRAFTQKEIDDMDFKAYLASDSDESDGQVDEEAKNKLKSLVGDFGF 393

Query: 415 GNVFGKXXXXXXXXXXXXXXXXMEITFTPGLDEKKEASDNETKKEESTIXXXXXXXXXXX 474
            +                    MEITFTP L+   E S  +  KEE+TI           
Sbjct: 394 NS-------KKETPNDEDEEVDMEITFTPALEGGNEKSSED--KEETTIEKIRRKEKERR 444

Query: 475 XXXXXXVKDLKEKSVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAELELLMMDEDD 534
                 VK+LK++S +                                   +    +   
Sbjct: 445 KARKQKVKELKQQSEKDKKSKLKSVNKKHTNDEEEIEKNAKSKAELELLMDDDDDTETQ- 503

Query: 535 RISGVNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAI 594
               +NNKAHFNMNEILRSEKEK KK +YQ K +IV+D F P+L D RF E+FEDH FAI
Sbjct: 504 --GTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAI 561

Query: 595 DPTQPEFKQTSAMKEILNERTKRA 618
           DPTQPEFK T AM +IL ER+KR 
Sbjct: 562 DPTQPEFKGTQAMSKILKERSKRV 585

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 3/60 (5%)

Query: 1  MSERKPKE---DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKI 57
          M+   PK+   DARFAG+++DPKF+ +K    K+KLD+RFSKKDL+V +KSKVD+YGRKI
Sbjct: 1  MAGENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60

>KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 627

 Score =  428 bits (1100), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 246/461 (53%), Positives = 290/461 (62%), Gaps = 26/461 (5%)

Query: 161 KPETGDPSKTVAVVNLDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEI 220
           KP +G+ + T+AVVNLDWDHVKS DL +TF  F+PKGG+I KIAIYPSEFGKERMQREEI
Sbjct: 151 KPASGNATNTLAVVNLDWDHVKSADLFVTFKSFVPKGGEIQKIAIYPSEFGKERMQREEI 210

Query: 221 EGPPXXXXXXXXXXXXXSTAEDNEDDVSDVDINDLYEEGDADKNIDSKSXXXXXXXXXXX 280
           EGPP                        ++++  +YEEGDA+ + DSK+           
Sbjct: 211 EGPPKELFQSKKSKKNDKDD-------DEINVESIYEEGDAE-DYDSKALRRYQLERLRY 262

Query: 281 XXAVVYCNNIGTAESIYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKP 340
             AVVYC++I TAESIY+NCDGTEYESTANVFD+RYVPD M  DD PRDEC  LPKNYKP
Sbjct: 263 YYAVVYCSDIRTAESIYQNCDGTEYESTANVFDLRYVPDGMEMDDDPRDECTSLPKNYKP 322

Query: 341 LQFSTDALQHSNVKLTWDETPADRVEISKRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXX 400
            QFSTDALQHS VKLTWDETPADRVEISKRAF+QKEI+EMDFKAYLA             
Sbjct: 323 AQFSTDALQHSKVKLTWDETPADRVEISKRAFTQKEIEEMDFKAYLASDSEESEVEHDDQ 382

Query: 401 XXXXLKSLVGGGAFGNVFGKXXXXXXXXXXXXXXXXMEITFTPGLDE--KKEASDNETKK 458
               LK+LV         G+                MEITFTPGLDE  +++ +DNE   
Sbjct: 383 VKNKLKALVMDSV---KVGQKSLFDQKEDEDDNEADMEITFTPGLDESGQQDTNDNE--- 436

Query: 459 EESTIXXXXXXXXXXXXXXXXXVKDLKEKSVQXXXXXXXXXXXXXXXXXXXXXXXXXXXX 518
           EESTI                 VK+LK++S                              
Sbjct: 437 EESTIDKIRRKEKERRKKRKDRVKELKKES----------EAKLKENLKKKKDTSHSIDD 486

Query: 519 XXXXAELELLMMDEDDRISGVNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNL 578
                ELELLM+DE++  S +NNKAHFNMNEIL+SEKEK KK+KYQ+K KIV DEF P++
Sbjct: 487 DKKKGELELLMLDENEGESTINNKAHFNMNEILKSEKEKSKKAKYQNKEKIVDDEFTPDV 546

Query: 579 NDSRFDEIFEDHAFAIDPTQPEFKQTSAMKEILNERTKRAS 619
           ND RF E+FEDH FAIDPTQPEFK+T AM++IL ERT R+S
Sbjct: 547 NDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERTVRSS 587

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 44/54 (81%)

Query: 8  EDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIIDRN 61
          ED RF+G+  DPKFR +K  + K+KLD+RFSK+DL+V  K+KVD+YGRKI+D N
Sbjct: 13 EDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVDAN 66

>KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {ON}
           Anc_5.430 YDR365C
          Length = 625

 Score =  363 bits (932), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 188/333 (56%), Positives = 214/333 (64%), Gaps = 12/333 (3%)

Query: 115 RLDRARGDVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPETGDPSKTVAVV 174
           ++DRARG+VP                                    KPETGD SKT+AVV
Sbjct: 93  KVDRARGEVPSDYVSSSDEYTSSESEDSEEEELDSDVESEVEIENTKPETGDASKTLAVV 152

Query: 175 NLDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPXXXXXXXXXX 234
           NLDWDHVKS DLM+TFS F+PKGGKI++I IYPSEFGKER+QREE+EGPP          
Sbjct: 153 NLDWDHVKSADLMVTFSSFVPKGGKISRICIYPSEFGKERLQREEVEGPPKELFQKKNKK 212

Query: 235 XXXSTAEDNEDDVSDVDINDLYEEGDADKNIDSKSXXXXXXXXXXXXXAVVYCNNIGTAE 294
              S  ED + D SDVDI DLYEEGDA+K++DSK+             AVVYCNNI TA 
Sbjct: 213 KA-SHKEDFDSD-SDVDIKDLYEEGDAEKDVDSKALRQYQLERLRYYYAVVYCNNIDTAR 270

Query: 295 SIYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVK 354
           +IY+NCDGTEYESTAN+FD+RYVPD MTFDD PRDEC+ LPKNYKP+QFSTDALQHSNVK
Sbjct: 271 AIYENCDGTEYESTANMFDLRYVPDGMTFDDEPRDECNSLPKNYKPMQFSTDALQHSNVK 330

Query: 355 LTWDETPADRVEISKRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXXXXXXLKSLVGGGA- 413
           LTWDETPADRVE++KRAFSQKEI++MDFKAYLA                 LK+LVG    
Sbjct: 331 LTWDETPADRVEVAKRAFSQKEIEDMDFKAYLASDSDESEEEVNENSKNKLKALVGESLD 390

Query: 414 FGNVFGKXXXXXXXXXXXXXXXXMEITFTPGLD 446
           FG                     MEITFTPGLD
Sbjct: 391 FGT---------NGASDGESEVDMEITFTPGLD 414

 Score =  129 bits (325), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 85/97 (87%), Gaps = 1/97 (1%)

Query: 523 AELELLMM-DEDDRISGVNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDS 581
           AELELLM+ DEDD    +N KAHFN+NEI+RSEKEKGKK KYQ K KIV+D+FKP+L+D 
Sbjct: 484 AELELLMIEDEDDTEQSLNKKAHFNLNEIIRSEKEKGKKGKYQRKEKIVEDDFKPDLSDP 543

Query: 582 RFDEIFEDHAFAIDPTQPEFKQTSAMKEILNERTKRA 618
           RF E+FEDH FAIDP+QPEFKQT+AMK+ILNER+KR+
Sbjct: 544 RFKEVFEDHDFAIDPSQPEFKQTNAMKQILNERSKRS 580

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 28/55 (50%), Positives = 42/55 (76%)

Query: 5  KPKEDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIID 59
          K  +D RF+ ++ DPKF+ +K   LK++LD+RFSK+DL++  K+KVD+YGRK  D
Sbjct: 6  KKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKD 60

>Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {ON}
           similar to Ashbya gossypii AER259W + AER260C
          Length = 630

 Score =  327 bits (837), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 167/302 (55%), Positives = 203/302 (67%), Gaps = 18/302 (5%)

Query: 161 KPETGDPSKTVAVVNLDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEI 220
           KPETGDP+K  AVVNLDWDHV+S DL+ TF+ F+P GG I K+AIYPSEFGKERM+REE+
Sbjct: 147 KPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIKKVAIYPSEFGKERMKREEV 206

Query: 221 EGPPXXXXXXXXXXXXXSTAEDNEDDVSDVDINDLYEEGDADKNIDSKSXXXXXXXXXXX 280
           EGPP                +D++D+ SD+DINDLYE  DA+K+ DSK+           
Sbjct: 207 EGPPRELFKRKQSKKE----KDSDDENSDIDINDLYEVDDAEKDYDSKALRRYQLDRLRY 262

Query: 281 XXAVVYCNNIGTAESIYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKP 340
             AVVYC+++ TA++IY+NCDGTE+ESTAN+FD+RYVPD M F+D PRD+C  +PK+YKP
Sbjct: 263 YYAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFEDDPRDQCVSVPKDYKP 322

Query: 341 LQFSTDALQHSNVKLTWDETPADRVEISKRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXX 400
            QFST ALQHS VKLTWDETPADRVEISKRAF+QKEI+EMDFKAYLA             
Sbjct: 323 TQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKAYLASDSDSSEGETNEK 382

Query: 401 XXXXLKSLVGGG---AFGNVFGKXXXXXXXXXXXXXXXXMEITFTPGL---DEKKEASDN 454
               L+SLV      A  +VF K                +EITFTPGL   D  KE ++ 
Sbjct: 383 TKNALRSLVNDSIQVAHKSVFDK--------HGSEEEADVEITFTPGLENGDAPKEENEE 434

Query: 455 ET 456
           ET
Sbjct: 435 ET 436

 Score =  129 bits (323), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 72/83 (86%)

Query: 537 SGVNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDP 596
           S +NN AHFNMNEI++S+KEK KKS+YQ+KN IV D FKP+LND RF E+FEDH FAIDP
Sbjct: 507 STLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAIDP 566

Query: 597 TQPEFKQTSAMKEILNERTKRAS 619
           +QPEFK+T AMKEIL ERT+R+S
Sbjct: 567 SQPEFKKTPAMKEILEERTRRSS 589

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 40/49 (81%)

Query: 9  DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKI 57
          D+RFAG+  DPKFR+ K + LK+ LD+RFSKKDL+   K+KVD+YGR+I
Sbjct: 14 DSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRI 62

>AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR365C (ESF1)
          Length = 619

 Score =  311 bits (798), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 160/336 (47%), Positives = 202/336 (60%), Gaps = 17/336 (5%)

Query: 113 LARLDRARGDVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPETGDPSKTVA 172
           +A+LDRARG+VP                                      E+GDPSK +A
Sbjct: 96  VAKLDRARGEVPADYVSSSDEESSSESEADSDDATAESDEEVEIEEEKP-ESGDPSKVLA 154

Query: 173 VVNLDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPXXXXXXXX 232
           VVNLDWDHVK  DL++ F+ F+P+GGKI ++AIYPSEFGKERMQREE+EGPP        
Sbjct: 155 VVNLDWDHVKCADLLVAFNSFVPEGGKIERVAIYPSEFGKERMQREEVEGPPREVFKSKK 214

Query: 233 XXXXXSTAEDNEDDVSDVDINDLYEEGDADKNIDSKSXXXXXXXXXXXXXAVVYCNNIGT 292
                   +       ++ + DLYE+GDA+K+ DSK+             AVVYCNN+ T
Sbjct: 215 DKKAKQDDD------DEIGLKDLYEQGDAEKDYDSKALRRYQLERLRYYYAVVYCNNVAT 268

Query: 293 AESIYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSN 352
           AE+IY+NCDGTEYESTAN+FD+RYVP+ +TFDD PR+EC  +PK+YKP+QFST ALQH  
Sbjct: 269 AEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDEPREECASVPKDYKPVQFSTSALQHLQ 328

Query: 353 VKLTWDETPADRVEISKRAFSQKEIDEMDFKAYLAXXXXXXXXXXXXXXXXXLKSLVGGG 412
           VKLTWDETPADRVE++KRAFSQKEI++MDFKAYLA                 L+SLV   
Sbjct: 329 VKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYLASDSEESEADDNSEAKNKLRSLVSSV 388

Query: 413 AFGN--VFGKXXXXXXXXXXXXXXXXMEITFTPGLD 446
              +  +F                  ++ITFTPGL+
Sbjct: 389 KVADKPLFA--------DESDEEEADVQITFTPGLE 416

 Score =  121 bits (303), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 80/91 (87%)

Query: 523 AELELLMMDEDDRISGVNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSR 582
           AELELLMM++D+    +N+ AHFNMN+ILRSEKE+GKKSKYQ K+KIV+D+FKP+LND R
Sbjct: 484 AELELLMMEDDENSQSINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPR 543

Query: 583 FDEIFEDHAFAIDPTQPEFKQTSAMKEILNE 613
           F E+FED  FAIDP+QPEFK+T+AMK+IL E
Sbjct: 544 FKEVFEDRDFAIDPSQPEFKETAAMKQILQE 574

 Score = 63.5 bits (153), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 40/49 (81%)

Query: 9  DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKI 57
          D RFA + +DPKFR  K+ +LK+KLD+RFSK+DL+   K+KVD+YGR+I
Sbjct: 14 DKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRI 62

>Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 578 LNDSRFDEIFEDHAFAIDPTQPEFKQTSAMKEI 610
           L D RF E+FED  F +D    +FKQ + +K I
Sbjct: 477 LTDDRFKEMFEDEQFQVDEDDYDFKQLNPVKSI 509

>Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 578 LNDSRFDEIFEDHAFAIDPTQPEFKQTSAMKEI 610
           L D RF E+FE+  F +D T  +FKQ + +K +
Sbjct: 477 LTDDRFKEMFENEEFQVDETDYDFKQLNPVKSL 509

>YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essential
           nucleolar protein, required for biogenesis of the small
           ribosomal subunit; contains WD repeats, interacts with
           Mpp10p and Bfr2p, and has homology to Spb1p
          Length = 707

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 578 LNDSRFDEIFEDHAFAIDPTQPEFKQTSAMKEI 610
           L D RF E+FED  F +D    +FKQ + +K I
Sbjct: 477 LTDDRFKEMFEDEEFQVDEDDYDFKQLNPVKSI 509

>Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W
           (REAL)
          Length = 707

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%)

Query: 578 LNDSRFDEIFEDHAFAIDPTQPEFKQTSAMKEI 610
           L D RF E+FED  F +D    +FKQ + +K I
Sbjct: 477 LTDDRFKEMFEDEEFQVDEDDYDFKQLNPVKSI 509

>Kwal_14.2258 s14 (679677..681776) [2100 bp, 699 aa] {ON} YGR145W -
           Protein required for cell viability [contig 227] FULL
          Length = 699

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 20/31 (64%)

Query: 578 LNDSRFDEIFEDHAFAIDPTQPEFKQTSAMK 608
           L D RF E+FED AF +D    ++KQ + +K
Sbjct: 480 LTDDRFKEMFEDEAFQVDEQDYDYKQLNPVK 510

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,514,875
Number of extensions: 1902766
Number of successful extensions: 6483
Number of sequences better than 10.0: 40
Number of HSP's gapped: 6607
Number of HSP's successfully gapped: 78
Length of query: 659
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 543
Effective length of database: 40,180,143
Effective search space: 21817817649
Effective search space used: 21817817649
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)