Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A065305.431ON49249225100.0
ZYRO0F09966g5.431ON5545187197e-88
Kpol_1016.75.431ON5625196762e-81
TDEL0E019405.431ON5675286631e-79
KNAG0B042305.431ON5775756572e-78
TPHA0H017905.431ON5655276518e-78
Smik_15.2965.431ON5665336432e-76
NCAS0H020505.431ON5735256343e-75
NDAI0C016105.431ON5845436345e-75
Suva_8.1715.431ON5675256256e-74
CAGL0L11616g5.431ON5555236124e-72
Skud_15.2815.431ON5675316101e-71
YOR118W (RTC5)5.431ON5675326091e-71
SAKL0G02464g5.431ON5635266021e-70
KLTH0F16126g5.431ON5545225722e-66
Kwal_55.214375.431ON5545235627e-65
Ecym_47645.431ON5665265559e-64
KLLA0E21143g5.431ON5725345365e-61
AER258C5.431ON5573064655e-51
TBLA0B033508.768ON527133860.057
ZYRO0D16082g7.205ON810142714.6
TPHA0G014808.698ON660119705.7
SAKL0G18414g4.364ON679138688.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A06530
         (492 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa] ...   971   0.0  
ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} simila...   281   7e-88
Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON...   265   2e-81
TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {O...   259   1e-79
KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {O...   257   2e-78
TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.4...   255   8e-78
Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118...   252   2e-76
NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.4...   248   3e-75
NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {O...   248   5e-75
Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W ...   245   6e-74
CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa...   240   4e-72
Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118...   239   1e-71
YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Prote...   239   1e-71
SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} simila...   236   1e-70
KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]...   224   2e-66
Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {...   221   7e-65
Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {O...   218   9e-64
KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]...   211   5e-61
AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}...   183   5e-51
TBLA0B03350 Chr2 complement(781108..782691) [1584 bp, 527 aa] {O...    38   0.057
ZYRO0D16082g Chr4 (1342194..1344626) [2433 bp, 810 aa] {ON} simi...    32   4.6  
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    32   5.7  
SAKL0G18414g Chr7 complement(1588834..1590873) [2040 bp, 679 aa]...    31   8.7  

>TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa]
           {ON} Anc_5.431 YOR118W
          Length = 492

 Score =  971 bits (2510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/492 (95%), Positives = 471/492 (95%)

Query: 1   MGQKYSSTETLPLPKNPNTLIKEIFTVSELITFQKRINRSLDDIISDKEIIKFSYIPDSK 60
           MGQKYSSTETLPLPKNPNTLIKEIFTVSELITFQKRINRSLDDIISDKEIIKFSYIPDSK
Sbjct: 1   MGQKYSSTETLPLPKNPNTLIKEIFTVSELITFQKRINRSLDDIISDKEIIKFSYIPDSK 60

Query: 61  PHLQHLYLRFIRNLNKYPSNDNIITGYSYLKIITLLNKKRRNKMFPKIEWIKIIFMCLSD 120
           PHLQHLYLRFIRNLNKYPSNDNIITGYSYLKIITLLNKKRRNKMFPKIEWIKIIFMCLSD
Sbjct: 61  PHLQHLYLRFIRNLNKYPSNDNIITGYSYLKIITLLNKKRRNKMFPKIEWIKIIFMCLSD 120

Query: 121 EEVQFPCWETTHDIHVLENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDTYWRKS 180
           EEVQFPCWETTHDIHVLENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDTYWRKS
Sbjct: 121 EEVQFPCWETTHDIHVLENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDTYWRKS 180

Query: 181 ASCIVRDMKECNVEEFENVLLIVPNIFDCLKNLIEHSLYTKDQLKECPLGPSQFTKTKMN 240
           ASCIVRDMKECNVEEFENVLLIVPNIFDCLKNLIEHSLYTKDQLKECPLGPSQFTKTKMN
Sbjct: 181 ASCIVRDMKECNVEEFENVLLIVPNIFDCLKNLIEHSLYTKDQLKECPLGPSQFTKTKMN 240

Query: 241 QAILCQILLSMRKRSMDISKLYIGRENGYSMRSFQSKVFKWKAPTILLITGKKIINDQEY 300
           QAILCQILLSMRKRSMDISKLYIGRENGYSMRSFQSKVFKWKAPTILLITGKKIINDQEY
Sbjct: 241 QAILCQILLSMRKRSMDISKLYIGRENGYSMRSFQSKVFKWKAPTILLITGKKIINDQEY 300

Query: 301 SEKNNRYKSFLNSYPRLKDGKTTFQTPLHYTFAIYIEEPWKMTKGYFGGLHTKIIQLSPR 360
           SEKNNRYKSFLNSYPRLKDGKTTFQTPLHYTFAIYIEEPWKMTKGYFGGLHTKIIQLSPR
Sbjct: 301 SEKNNRYKSFLNSYPRLKDGKTTFQTPLHYTFAIYIEEPWKMTKGYFGGLHTKIIQLSPR 360

Query: 361 QDVFTCTDPNAVYFHTQNGIGIGNEHMSSDNKYKPGNVSITIDSTLEFAVFRHSGPGVFK 420
           QDVFTCTDPNAVYFHTQNGIGIGNEHMSSDNKYKPGNVSITIDSTLEFAVFRHSGPGVFK
Sbjct: 361 QDVFTCTDPNAVYFHTQNGIGIGNEHMSSDNKYKPGNVSITIDSTLEFAVFRHSGPGVFK 420

Query: 421 TGIIANQEIFEIRLHIQSVEVWGCGGAKXXXXXXXXXXXXXXXXXXXXXVSMHVTEDRAL 480
           TGIIANQEIFEIRLHIQSVEVWGCGGAK                     VSMHVTEDRAL
Sbjct: 421 TGIIANQEIFEIRLHIQSVEVWGCGGAKELAEQKHEWEWEEREAQRRQHVSMHVTEDRAL 480

Query: 481 LELAGIIGERPV 492
           LELAGIIGERPV
Sbjct: 481 LELAGIIGERPV 492

>ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 554

 Score =  281 bits (719), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 181/518 (34%), Positives = 286/518 (55%), Gaps = 57/518 (11%)

Query: 25  FTVSELITFQKRINRSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYPSNDNI- 83
           FTV+EL++F+ ++ + L++ ++++E+ K+  +P  +  L+ L   F++ L  +P   N  
Sbjct: 34  FTVTELVSFKNKLGKDLNERLTNEELTKWLSVPQDEILLRELLYNFVQVLGNFPLMKNSY 93

Query: 84  --ITGYSYLKIITLLNKKRRNKMFPKIEW--IKIIFMCLSDEEV--QFP----------- 126
             +TG   LK I L N +R  K      +  +K+ F+ LS  +   + P           
Sbjct: 94  ENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWFIALSIRKTVKEDPNLSSSSSSEES 153

Query: 127 -----CWETTHDIHVLEND-----LIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDTY 176
                  +T   +HV E       ++ FIS LL L   C  + C +     F++  W++Y
Sbjct: 154 FDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILTTYCPINNCKLENVAMFDN--WNSY 211

Query: 177 WRKSASCIVRDMK---ECNVEEFE----NVLLIVPNIFDCLKNLIEHSLYTKDQLKECPL 229
             KSA  I+R M+   E +  E+E     +  I P+IFD L  ++EH L+  D+L + PL
Sbjct: 212 I-KSAHTILRSMRPMDESSWIEYEPFAHTMRSIAPHIFDPLTRVMEHLLFKDDELVD-PL 269

Query: 230 GPSQ---FTKTKMNQAILCQILLSMRKRS--MDISKLYIGRENGYSMRSFQSKVFKWKAP 284
             ++    +   +N A+L QI  ++ K+     + +LY+GR++G+SMRSFQ+KVFKW AP
Sbjct: 270 SENRGEIASSKLLNSALLAQISSALSKQLPIYHLQRLYLGRDHGFSMRSFQAKVFKWSAP 329

Query: 285 TILLITGKKIINDQEYSEKNNRYKSFLNSYPRLKDGKTTFQTPLHY------TFAIYIEE 338
           TI+L+ GK+I++D+EYS KN R++ FL+ YP+LK      +    Y        A+Y+ +
Sbjct: 330 TIMLLRGKRILDDEEYSVKNTRFRKFLHEYPKLKPSDMDTEVEEMYPAKSKIILAVYVSD 389

Query: 339 PWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHTQNGIGIGNEHM----SSDNKY 393
           PWK+T K +FGG HT I+QLSP Q+VF  +  NA+YF+T  G            S+   Y
Sbjct: 390 PWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENALYFNTIGGGIGIGNKQPVIKSTAKSY 449

Query: 394 KPGNVSITIDSTLEFAVFRHSGP-GVFKTGIIANQEIFEIRLHIQSVEVWGCGGAKXXXX 452
            PGNVS+T+DS LEFAV RH+G  GV K G++   + FE+++ +Q VEVWGCGG K    
Sbjct: 450 SPGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVGDKDFEVKMLLQDVEVWGCGGEKELEE 509

Query: 453 XXXXXXXXXXXXXXXXXVSMH-VTEDRALLELAGIIGE 489
                            +++  + EDRALLE+AG++G+
Sbjct: 510 QLKQWEWEESEAKRRQQINLRSIGEDRALLEMAGLVGQ 547

>Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON}
           complement(14315..16003) [1689 nt, 563 aa]
          Length = 562

 Score =  265 bits (676), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 187/519 (36%), Positives = 272/519 (52%), Gaps = 66/519 (12%)

Query: 29  ELITFQKRI-NRSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYP---SNDNII 84
           E+  F+ R+ ++ L D ++  E      I DS   LQ L   F   ++ +P   +    +
Sbjct: 44  EIECFKSRLGDKDLSDPLTKDEFNTLLRIADSNSQLQILLWNFFLKISAFPFLSNRSESM 103

Query: 85  TGYSYLKIITLLNKKRRNKM--FPKIEWIKIIFMCLSDEE-----VQFPCWETTHDIHVL 137
           TG+  LK I LL ++R  K   +   + IK+IF+ L+ +E      +   ++  H +  L
Sbjct: 104 TGFGILKGIILLTRERIKKYLGWSNAKLIKLIFIGLTSQEKVGVKTEASVFKIQHVLDTL 163

Query: 138 EN-----------DLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDTYWRKSASCIVR 186
           +            D++ FI+ LL L+++C T  C +N+   ++   W  Y    AS +VR
Sbjct: 164 DGIDLASSTVKDTDMLSFITWLLLLSVHCPTSNCKLNEKSLYDK--WKDY-EIVASSMVR 220

Query: 187 DMKE----------CNVEEFENVLLIVP-NIFDCLKNLIEHSLYTKDQLKECPLGPSQFT 235
            M +           +  +F + ++ V  N+   L+N++EH LY +D L E P   +   
Sbjct: 221 SMNKKITTTGKGIGISYSDFSHTIVAVSKNVMSPLENIVEHMLYKQDDLLEFPCLDTFLK 280

Query: 236 KTKMNQ----AILCQILLSMRKRSMDISKLYIGRENGYSMRSFQSKVFKWKAPTILLITG 291
           +TK+      A LC +L +    S  + KLY+GRE+GYSMRS QSKVF WKA TILL++G
Sbjct: 281 ETKLMTYPLVAQLCTVLPNEIVMSQ-LQKLYVGRESGYSMRSLQSKVFNWKAATILLVSG 339

Query: 292 KKIINDQEYSE-KNNRYKSFLNSYPRLKDGKTTFQT----PLHYTFAIYIEEPWKMT-KG 345
            +I++D EYSE KN RYK FL  YP+LKD               TFA+YI+EPW++T K 
Sbjct: 340 TRIVDDIEYSENKNPRYKRFLEEYPKLKDEDQEMDDCHNLKKKVTFAVYIDEPWRVTNKN 399

Query: 346 YFGGLHTKIIQLSPRQDVFTCTDPNAVYFHT--QNGIGIGNEHMSSDN--KYKPGNVSIT 401
           YFG   T II+LSPRQD F      +VYF+T         N+ ++  N  +Y PGNVS+T
Sbjct: 400 YFGEKRTSIIELSPRQDKFNSLKVGSVYFNTIGGGIGIGNNQPVTKLNSVRYAPGNVSLT 459

Query: 402 IDSTLEFAVFRHSGPGVFKTGIIANQEI----------FEIRLHIQSVEVWGCGGAKXXX 451
           +D+TLEF VFRH+G G    G I   E+          FEIR  I+ VEVWGCGG K   
Sbjct: 460 LDNTLEFGVFRHTGYG----GTIGPSELLKKNNEENKAFEIRFLIRDVEVWGCGGEKELE 515

Query: 452 XXXXXXXXXXXXXXXXXXVSMH-VTEDRALLELAGIIGE 489
                             +++  + EDRALLE+AGIIG+
Sbjct: 516 EQLREWKWEEAEAKRRQEINLKTMGEDRALLEMAGIIGQ 554

>TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {ON}
           Anc_5.431 YOR118W
          Length = 567

 Score =  259 bits (663), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 179/528 (33%), Positives = 277/528 (52%), Gaps = 69/528 (13%)

Query: 24  IFTVSELITFQKRI-NRSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYP---- 78
           +FT +EL  F+ ++  ++L D +  +E+ ++  IP     L      F+R L+ +P    
Sbjct: 38  MFTATELAAFKSKLEGKTLKDPVRSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKD 97

Query: 79  SNDNIITGYSYLKIITLLNKKRRNKMF--PKIEWIKIIFMCLSDEEV---QFPCWETTH- 132
           S D++ TG   LK + L N  + +K       + +K++F+ LS  +    +  C  +T  
Sbjct: 98  SFDDV-TGVGLLKSVLLTNPSKCHKYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSL 156

Query: 133 -------------------DIHVLENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDW 173
                              D+ +    L++ ++ LL L   C T  C   +D+ +   +W
Sbjct: 157 EDGGGSINLLRTYNNIVVDDLAIPATSLVQLLAWLLILTSYCPTSNCQFPEDVVY--AEW 214

Query: 174 DTYWRKSASCIVRDMKE---CNVEEF--------ENVLLIVPNIFDCLKNLIEHSLYTKD 222
            ++ + +A+ ++R M      N+E +        + +  ++PNIF  L+N++EH LY   
Sbjct: 215 GSF-KLAATNLLRTMNNNIVTNLESYSVKFEQFSKAISTVMPNIFRALQNVMEHLLYQDS 273

Query: 223 QLKECP---LGPSQFTKTKMNQAILCQILLSMRKRSMDISK---LYIGRENGYSMRSFQS 276
            L   P    GP   T     QA+L Q++ ++    M  +K   LY+GRE+G+SMRS Q+
Sbjct: 274 DLVSFPSNSAGPI-LTSKPTTQAVLAQLITALSNE-MTFAKFQNLYVGRESGFSMRSLQA 331

Query: 277 KVFKWKAPTILLITGKKIINDQEYSEKNNRYKSFLNSYPRLKDGKTTF----QTPLHYTF 332
           KVFKW APT++L++GK +++D+++S+KN+RY+ FL+ YP+LKD         +      F
Sbjct: 332 KVFKWMAPTVMLLSGKCVLDDEDFSKKNSRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVF 391

Query: 333 AIYIEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHT---QNGIGIGNEHMS 388
           A+YI EPWK T K YFGG  T I+QLSP QDVF       +YF+T     GIG    H+ 
Sbjct: 392 AVYIPEPWKTTNKDYFGGSGTTIVQLSPTQDVFKAASNEVMYFNTLGGGIGIGNNQPHIK 451

Query: 389 SDNK-YKPGNVSITIDSTLEFAVFRHSG-PGVFKTGIIANQ-----EIFEIRLHIQSVEV 441
           +  K Y PGNVS+TIDSTLEFA FRH G  G F  G++  Q     + FEI+  IQ VEV
Sbjct: 452 NGVKSYSPGNVSLTIDSTLEFAAFRHVGYGGTFNPGLLLTQFNREDDPFEIKFLIQDVEV 511

Query: 442 WGCGGAKXXXXXXXXXXXXXXXXXXXXXVSMH-VTEDRALLELAGIIG 488
           WGCGG +                     +++    EDRALLE+AG++G
Sbjct: 512 WGCGGKEELEEQYKKWQWEEAEAKRRQNINLRSFGEDRALLEMAGLVG 559

>KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {ON}
           Anc_5.431 YOR118W
          Length = 577

 Score =  257 bits (657), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 192/575 (33%), Positives = 288/575 (50%), Gaps = 91/575 (15%)

Query: 1   MGQKYSSTETLPL----PKNPNTLIKEI-----------FTVSELITFQKRIN--RSLDD 43
           MGQ  SS E  P     P+  N   +EI           F  SEL TF+ R+   R L+D
Sbjct: 1   MGQSVSSQEPEPTQESDPQLGNGTTEEIEQEYNDRVLRQFNASELYTFKCRVGMTRQLND 60

Query: 44  IISDKEIIKFSYIPDSKPHLQH---LYLRFIRNLNKYPSNDNI---ITGYSYLKIITLLN 97
           ++ ++E++++  +P  + HLQ    L +  I+ L ++P   N    +T  S LK + L+N
Sbjct: 61  VVLEQELLEWLCLP-LEGHLQQPSKLLVGVIKVLGQFPFISNTGGNLTAVSLLKAVILIN 119

Query: 98  KKR-----RNKMFPKIEWIKIIFMCLSDE-----------------EVQFPCWETTHD-- 133
           + +      NK +  +E I +      D                  E     ++   D  
Sbjct: 120 RGKCLKYIGNKSYNHLELIFMALYLAQDSHDSTKKESYDPKEPHNIEKVISSYDGNSDCV 179

Query: 134 --IHVLENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDTYWRKSASCIVRDMKEC 191
             I V  ++L++F ++LL L+         I  DL   D+DW  Y  KSA  ++R M   
Sbjct: 180 SEITVQADNLLQFTTMLLLLSARIPRPNSQI--DLKTADNDWAKY-EKSAYNVIRTMNSS 236

Query: 192 ----------NVEEFENVL-LIVPNIFDCLKNLIEHSLYTKDQLKE-CPLGPSQFTKTK- 238
                     +  +F +V+ +++P I   L NL++H LYT DQL +   LGP+ FT+TK 
Sbjct: 237 IISSCQTHTISFHQFYDVISILLPTILTTLDNLLQHLLYTPDQLVDHTALGPT-FTETKV 295

Query: 239 MNQAILCQILLSMRKRSMDISKL---YIGRENGYSMRSFQSKVFKWKAPTILLITGKKII 295
           MN      +  ++  +   ISKL   Y+GR++G+SMRSFQ KVF W APT+L ++G +I 
Sbjct: 296 MNHGSFALLQFALADKGYPISKLQKLYVGRDSGFSMRSFQGKVFHWHAPTLLFVSGSRIQ 355

Query: 296 NDQEYSE-KNNRYKSFLNSYPRLKDGKTTFQTPL----HYTFAIYIEEPWKMT-KGYFGG 349
           +D +YS+ KN RY  FL  + +L+D        L       F IYIE PW++T K YF  
Sbjct: 356 DDDDYSKNKNPRYSKFLEDFRKLRDTDQQLSPCLLKKRKVMFVIYIESPWRVTNKDYFSA 415

Query: 350 LHTKIIQLSPRQDVFTCTDPNAVYFHTQ-NGIGIGNEHMSSD---NKYKPGNVSITIDST 405
             T I QLSP  D+F     + VYF+T   GIGIG+    +     +Y+PGN+S+T+DS+
Sbjct: 416 GRTTIFQLSPELDIFKANRDDVVYFNTMGGGIGIGDTQPYTKVNYREYRPGNISLTLDSS 475

Query: 406 LEFAVFRHSGP-GVFKTGI---------IANQEIFEIRLHIQSVEVWGCGGAKXXXXXXX 455
           LEF  FR+ GP G+F+ G          +     +E+R  IQ VEVWGCGG K       
Sbjct: 476 LEFGAFRNVGPGGMFEPGALFTRRNGDGVVTSNSYELRFLIQDVEVWGCGGEKELSEQMK 535

Query: 456 XXXXXXXXXXXXXXVSM-HVTEDRALLELAGIIGE 489
                         V++  ++EDRALLE+AG++G+
Sbjct: 536 QLQWEETEAKRRQHVNLKSLSEDRALLEMAGLVGQ 570

>TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.431
           YOR118W
          Length = 565

 Score =  255 bits (651), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 184/527 (34%), Positives = 273/527 (51%), Gaps = 73/527 (13%)

Query: 25  FTVSELITFQKRINRSLDD---IISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYP--- 78
           F+  EL+ F+  +   +DD   II D  + K   I D    L++L L FI+ L  +P   
Sbjct: 40  FSNIELLCFKHLL--EIDDYSTIIDDAVVYKLLQIQDVSDRLRNLILNFIKRLTNFPFIS 97

Query: 79  -SNDNIITGYSYLKIITLLNKKRRNKMFP--KIEWIKIIFMCLSDEEVQ------FPCWE 129
              DN+ T Y  LK I +L K++  K     ++  +KI+F+ L D + +        C  
Sbjct: 98  TVADNV-TAYGLLKTIVILQKQKFIKYTNNNQLNMLKILFIALGDYDREEDNKKILDCHN 156

Query: 130 TT-------------HDIHVLENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDTY 176
            +             HDI V  +++I F++ +L L+  C T+  +++    F       Y
Sbjct: 157 ISISTILTTYDGIPIHDISVSSSNMISFLTWILALSNVCPTNNSIVDTKHMFK------Y 210

Query: 177 WRK---SASCIVRDMKE--CNVEEFENVLLI---------VPNIFDCLKNLIEHSLYTKD 222
           W K   SA  +VR M       ++ +N+L I         +P+++  L++L+ H L+ + 
Sbjct: 211 WEKYETSAISLVRSMNPDIIKPDDNQNILFIQFKTALETIMPHVYLPLEHLLNHLLFMES 270

Query: 223 QLKECPLGPSQFTKTKMNQAILCQILLSMRKRSMDISKL---YIGRENGYSMRSFQSKVF 279
            L +       F ++K+    +   L ++ +  + ISKL   Y GRE+G+SMRSFQSK F
Sbjct: 271 SLIKSQEIEISFQESKLMTFAVASQLSTLLRNDVVISKLHKLYSGRESGFSMRSFQSKAF 330

Query: 280 KWKAPTILLITGKKIINDQEYSEKNN-RYKSFLNSYPRLKDGKTTFQTPLH-----YTFA 333
           KW APTILLI+G ++ +D EY+ K N RYK F++ YPRL+D     + P H      TFA
Sbjct: 331 KWNAPTILLISGMRVTDDVEYATKKNPRYKKFIDQYPRLRDLDQNLE-PCHSKLRKVTFA 389

Query: 334 IYIEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHTQNGIGIGNEHMSSDNK 392
           +Y++EPWK++ K  FGGL T I++LSPRQD F    P  +YF+T  G            K
Sbjct: 390 VYVDEPWKVSNKLQFGGLKTLIVELSPRQDCFRAAKPGVIYFNTVGGGIGIGSSQPVQKK 449

Query: 393 ----YKPGNVSITIDSTLEFAVFRHSGPG--VFKTGIIANQE----IFEIRLHIQSVEVW 442
               Y PGNVS+TID++LEF  FRH+G G  +  + I+  +E     FEIR  IQ +EVW
Sbjct: 450 NSLSYTPGNVSLTIDNSLEFGAFRHTGYGGSIEPSSILQKKEDATRTFEIRFLIQDIEVW 509

Query: 443 GCGGAKXXXXXXXXXXXXXXXXXXXXXVSM-HVTEDRALLELAGIIG 488
           GCGG K                     V++  + EDRALLE+AGIIG
Sbjct: 510 GCGGEKEIDEQLKQWAWEEEEAKKRQRVNLKSMGEDRALLEMAGIIG 556

>Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118W
           (REAL)
          Length = 566

 Score =  252 bits (643), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 181/533 (33%), Positives = 272/533 (51%), Gaps = 66/533 (12%)

Query: 18  NTLIKEIFTVSELITFQKRIN-RSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNK 76
           NT  +   TV EL++ +  +   +L+  IS K +  F Y P +   +  +    +R L+ 
Sbjct: 32  NTKAQRQITVPELVSLKGNLQIENLNTPISHKRLCNFLYFPQNHTIIVGIVTNMLRVLSN 91

Query: 77  YP---SNDNIITGYSYLKIITLLNKKRRNKMFPKI---EWIKIIFMCLS----DEEVQFP 126
           +P   S+   ITGY  LK I LLNK R  K F KI   + +K++F+ LS    D+E    
Sbjct: 92  FPLVNSSYEPITGYGLLKCIVLLNKSRCEK-FLKIKSYDQLKLLFISLSLQKTDKEELSE 150

Query: 127 CWET-------------------THDIHVLENDLIEFISLLLTLNMNCCTDYCLINQDLT 167
             E                    T  +++  + +++F++ LL L++ C T    IN +  
Sbjct: 151 DNENNGVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLILSVECPTTNSTINNE-- 208

Query: 168 FNDHDWDTYWRKSASCIVRDMKECNVEEFEN-----------VLLIVPNIFDCLKNLIEH 216
             +  WD + +  A  ++R M    V   E+           +  ++PN+   L+NL+EH
Sbjct: 209 -TNVQWDKF-KIPAMNLLRTMNPDVVNNIESHFITYQQFSTAIRTVMPNLLKPLENLMEH 266

Query: 217 SLYTKDQLKECPLGPSQFTKTK-MNQAILCQILLSMRKRSM--DISKLYIGRENGYSMRS 273
            LY +  L +     S    +K M  A+L Q+   + K      +  LYIGR++G+SMRS
Sbjct: 267 FLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQSLYIGRKSGFSMRS 326

Query: 274 FQSKVFKWKAPTILLITGKKIINDQEYSE-KNNRYKSFLNSYPRLKDGKTTFQTPL---- 328
            Q+KVFKW AP+IL+++G +I N +EY+  KN RY+ FL  +P LKD        L    
Sbjct: 327 LQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILKDSDQKMDASLMNKK 386

Query: 329 HYTFAIYIEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHTQNGIGIGNEHM 387
             TFA+YI++PWK+T K YFG L+T+IIQ+SPRQD++       VYF+T  G        
Sbjct: 387 KTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVYFNTIGGGIGIGNKQ 446

Query: 388 ----SSDNKYKPGNVSITIDSTLEFAVFRHSG------PGVFKTGIIANQEIFEIRLHIQ 437
               S+  +Y PGNVS+T DSTLEFAVFR++G      PG+           FE+ + IQ
Sbjct: 447 PLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEENSSFELHILIQ 506

Query: 438 SVEVWGCGGAKXXXXXXXXXXXXXXXXXXXXXVSMH-VTEDRALLELAGIIGE 489
            VEVWGCGG K                     +++  + EDRALLE+AG++G+
Sbjct: 507 DVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEMAGLVGQ 559

>NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.431
           YOR118W
          Length = 573

 Score =  248 bits (634), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 180/525 (34%), Positives = 268/525 (51%), Gaps = 63/525 (12%)

Query: 25  FTVSELITFQKRINRSLDD------IISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYP 78
           FT  EL+ F+K+I     D       IS  E+    ++P     L  L  + I  L+ +P
Sbjct: 45  FTPLELVAFKKKIGHEQTDSEAGVEYISKNELTNLLHLPRENVLLVDLTYKLIAILSNFP 104

Query: 79  ---SNDNIITGYSYLKIITLLNKKRRNKMFPK--IEWIKIIFMCLSDEEVQ--FPCWETT 131
                   +T    L  I LL+K+R ++       + + +IF+ +S +      P   T 
Sbjct: 105 LLREPQTEVTEIGLLMCIILLSKERCHRFIGSNTYDQLGLIFIAMSLDYADKLLPYARTP 164

Query: 132 HDIHVLE-----------------NDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWD 174
             ++V E                   L++F+S  L L + C T  C +     F   +W 
Sbjct: 165 KKLNVEELLRTFDNIPIDELEIPAPVLLQFLSWGLLLLIKCPTSNCQLKPINEFY-QNWS 223

Query: 175 TYWRKSASCIVRDMKEC----------NVEEFENVL-LIVPNIFDCLKNLIEHSLYTKDQ 223
           +Y  K+A  I+R M +           N  +F +V   ++PN    L++L+ H LY    
Sbjct: 224 SY-EKAAKNIIRSMDQSIIRNLTDVRINYTQFSDVFKAVLPNFTTPLESLMGHLLYMDSD 282

Query: 224 LKECPLGPSQFTKTKMNQAILCQILLSMRKRSM--DISKLYIGRENGYSMRSFQSKVFKW 281
           L +    P   +K  M++ +L Q+   + K      + KLY+GRE+G+SMRS QSK F W
Sbjct: 283 LIDHETMPMNNSKL-MSEPLLAQLATVLPKELFLSKLQKLYVGRESGFSMRSLQSKCFNW 341

Query: 282 KAPTILLITGKKIINDQEYS-EKNNRYKSFLNSYPRLKDGKTTFQT----PLHYTFAIYI 336
           +AP+ILL++G  I +D +Y+ EKN RY  FL  YP+LK+ +             TFA+YI
Sbjct: 342 EAPSILLVSGMLISDDLQYAKEKNPRYGKFLEQYPKLKEEQQHLDACHSQRKKATFAVYI 401

Query: 337 EEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHT-QNGIGIGNEH---MSSDN 391
           ++PW++T K +FG +++ IIQL+PRQDVF  + PN +YF+T   GIG GN+     ++  
Sbjct: 402 DDPWRVTNKEFFGSMNSMIIQLAPRQDVFHASKPNMIYFNTVGGGIGFGNKQPLISNAHK 461

Query: 392 KYKPGNVSITIDSTLEFAVFRHSG-PGVFKTGIIANQ-----EIFEIRLHIQSVEVWGCG 445
           KY PGNVS+TIDSTLEFAVFRH G  G FK   +  +     E FEI+  IQ VEVWGCG
Sbjct: 462 KYIPGNVSLTIDSTLEFAVFRHIGYGGAFKPSALLTKRGKEDESFEIKFIIQDVEVWGCG 521

Query: 446 GAKXXXXXXXXXXXXXXXXXXXXXVSMH-VTEDRALLELAGIIGE 489
           G K                     +++  + EDRALLE+AG++G+
Sbjct: 522 GEKELQEQIKKLEWEEAEAKRRQHINLKSLGEDRALLEMAGLVGQ 566

>NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {ON}
           Anc_5.431 YOR118W
          Length = 584

 Score =  248 bits (634), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 185/543 (34%), Positives = 288/543 (53%), Gaps = 84/543 (15%)

Query: 25  FTVSELITFQKRINRS-LDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYP-SNDN 82
           FT  ELI+++ ++N   LDD+I+ +EII+  ++PD    L ++    + +L  +P   + 
Sbjct: 41  FTPLELISYKNKLNHDHLDDMITKEEIIQLLHLPDDNVILSNMIFNMVHSLCNFPFLGER 100

Query: 83  I--ITGYSYLKIITLLNKKRRNKMFPKIEW--IKIIF--MCLS----------------- 119
           I  IT  + L  I LL+  R  +      +  IK++F  +CLS                 
Sbjct: 101 IWDITAGNLLTCIILLDNDRCQRFIGSKSYDQIKLLFILLCLSTNNSSGKPLSASNSKLR 160

Query: 120 ------------DEEVQFPCWE--------TTHDIHVLENDLIEFISLLLTLNMNCCTDY 159
                        +E+ +   +        +  D+ V    L E  +  L +++ C T  
Sbjct: 161 EKSENISTTSIYSQEIGYNLTDILQSYNGISIDDLSVPALSLSECFTWTLIMSIKCPTAN 220

Query: 160 CLINQDLTFNDHDWDTYWRKSA-------SCIVRDMKECNVE--EFENVLL-IVPNIFDC 209
           C I  + T  +  W+ Y + S        S IV ++ +  +   +FENV   +VPN    
Sbjct: 221 CKILPNETIYN-SWNEYQKASLNILRSMDSSIVSNLDDYRISFTQFENVFTSVVPNFTHP 279

Query: 210 LKNLIEHSLYTKDQLKECPLGPSQFTKTK-MNQAILCQILLSMRKRSM--DISKLYIGRE 266
           L+N++ H LY    L   P+   +  K+K M++++L Q+  ++ K      + KLYIGR+
Sbjct: 280 LENIMNHLLYMDKDLINHPV--MEIPKSKLMSESLLAQLSTTLPKELFISKLQKLYIGRQ 337

Query: 267 NGYSMRSFQSKVFKWKAPTILLITGKKIINDQEYSEKNNRYKSFLNSYPRLKDGKTTFQT 326
           +G+SMRS QSK FKW APTILL++G  I ND+EY+  N R+K FL  +P+L D + + + 
Sbjct: 338 SGFSMRSLQSKCFKWLAPTILLVSGLIIPNDEEYN--NPRFKRFLQEFPKLNDNEQSLE- 394

Query: 327 PLH-----YTFAIYIEEPWKMT-KGYFGGLHTKIIQLSPRQDVF-TCTDPNAVYFHTQN- 378
           P H      +FA+YI+EPW++T K +FG L+++II+LSPRQD+F +      +YF+T   
Sbjct: 395 PCHSYKKKISFAVYIDEPWRVTNKEFFGDLNSRIIELSPRQDIFKSLKSHELIYFNTIGC 454

Query: 379 GIGIGNE--HMS---SDNKYKPGNVSITIDSTLEFAVFRHSG------PGVFKTGIIANQ 427
           GIGIG++  H+S   +  KY+PGNVS+T++STLEFAVFRH G      P    T     +
Sbjct: 455 GIGIGDKQPHVSNGANSRKYQPGNVSLTLESTLEFAVFRHVGHGGAFSPSELLTKRGTEE 514

Query: 428 EIFEIRLHIQSVEVWGCGGAKXXXXXXXXXXXXXXXXXXXXXVSM-HVTEDRALLELAGI 486
           E FEI+  IQ VEVWGCGG K                     V++  ++EDRALLE+ G+
Sbjct: 515 ESFEIKFIIQDVEVWGCGGEKELEEQMKQLAWEEAEAKRRQQVNLKSISEDRALLEMVGL 574

Query: 487 IGE 489
           +G+
Sbjct: 575 VGQ 577

>Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  245 bits (625), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 170/525 (32%), Positives = 266/525 (50%), Gaps = 65/525 (12%)

Query: 26  TVSELITFQKRIN-RSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYP---SND 81
           TV EL++ +  +    ++  IS K +    + P     L  +    +R L+ +P   S+ 
Sbjct: 40  TVPELVSLKGNLQIEDMNTPISHKSLCSVLHFPQKHTLLSGIVTNMLRVLSNFPLMNSSY 99

Query: 82  NIITGYSYLKIITLLNKKRRNKM--FPKIEWIKIIFMCLSDEEVQFPCWET--------- 130
             ITGY  LK I LLNK R  K   F   + +K++F+ LS ++                 
Sbjct: 100 EPITGYGLLKCILLLNKGRCGKYLKFKSYDQLKLLFISLSLQKTDKEELSEENENNVKKE 159

Query: 131 --------------THDIHVLENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDTY 176
                         +  ++V  + +++F+S LL L++ C T    +     ++   WD++
Sbjct: 160 RNIKQIIANFDDVDSEVLYVPADFMLQFLSWLLILSVECPTSNSKMGNSKIYDQ--WDSF 217

Query: 177 WRKSASCIVRDMKECNVEEFENVLL-----------IVPNIFDCLKNLIEHSLYTKDQLK 225
            + SA  ++R M    V   E+ L+           ++PN+   L+NL+EH  Y ++ L 
Sbjct: 218 -KISAMNLLRTMNPDVVSNTESHLITFDQFSTSIRTVMPNLLKPLENLMEHFFYLENDLV 276

Query: 226 ECPLGPSQFTKTK-MNQAILCQILLSMRKRSMDISKL---YIGRENGYSMRSFQSKVFKW 281
                 S    ++ M  A+L Q L ++  R + I KL   YIGR++G+SMRS Q+KVFKW
Sbjct: 277 NYDTSLSSVRDSRIMTPALLTQ-LSTVLPRELFIQKLQSLYIGRKSGFSMRSLQAKVFKW 335

Query: 282 KAPTILLITGKKIINDQEY-SEKNNRYKSFLNSYPRLKDG----KTTFQTPLHYTFAIYI 336
            AP+IL+++G +I N  EY ++KN RY+ FL  +P+LKD       ++      TFA+YI
Sbjct: 336 MAPSILIVSGTRITNSDEYAAQKNPRYRHFLEEFPKLKDSDQKMDASYTNKKKTTFAVYI 395

Query: 337 EEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHTQNGIGIGNEHM----SSDN 391
           ++PWK+T K YFG ++T+IIQ+SPRQD++       +YF+T  G     +       +  
Sbjct: 396 DDPWKVTNKDYFGDMNTRIIQISPRQDIYKVNRKGTIYFNTIGGGIGIGDKQPLIKPASK 455

Query: 392 KYKPGNVSITIDSTLEFAVFRHSG------PGVFKTGIIANQEIFEIRLHIQSVEVWGCG 445
           ++ PGNVS+T DSTLEFAVFRH+G      PG            FE+   IQ VEVWGCG
Sbjct: 456 RFIPGNVSLTFDSTLEFAVFRHTGYGGSLEPGSLSVERKEEDSFFELHFLIQDVEVWGCG 515

Query: 446 GAKXXXXXXXXXXXXXXXXXXXXXVSMH-VTEDRALLELAGIIGE 489
           G K                     +++  + EDRALLE+AG++G+
Sbjct: 516 GEKELEEQMKQMAWEEAESKRRQQINLRSLGEDRALLEMAGLVGQ 560

>CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q12108 Saccharomyces cerevisiae
           YOR118w
          Length = 555

 Score =  240 bits (612), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 165/523 (31%), Positives = 281/523 (53%), Gaps = 56/523 (10%)

Query: 18  NTLIKEIFTVSELITFQKRINR-SLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNK 76
           NT + ++FTV+E+  F+KR N   L++ I D  +IK +   D++P++       IR L  
Sbjct: 31  NTRVVKLFTVTEIAAFKKRFNAIDLNEPIDDT-LIKEALYLDAQPNVWSAVSETIRLLQN 89

Query: 77  YP----SNDNIITGYSYLKIITLLNKKRRNKM----FPKIEWIKIIFMCLSDEEVQFPCW 128
           +P       + ITG+  LK+I ++N KR  K+      + +    + +C   +E +    
Sbjct: 90  FPLFHQPIADSITGFGLLKVIAIINVKRFEKLVNTTITRYDITVTLGLCGQAKESENKIK 149

Query: 129 ET-------THD------IHVLENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDT 175
            T       T+D      IH+  + LI  ++ LLTL     T  C +  +L+    +W+ 
Sbjct: 150 STNLGDILKTYDHIEIESIHIPYDKLILLVAWLLTLVTGVATTNCKV--ELSDTIANWNN 207

Query: 176 YWRKSASCIVRDMKECNVEEFENVLLIVPNIFDC-----------LKNLIEHSLYTKDQL 224
           + + SA  I   +    +    ++ +   +I +            + NL EH L+  D L
Sbjct: 208 F-KSSAISIANTISTSALGNANDIGIPATDILNAFNTIMISLVPYMSNLFEHLLFGVDDL 266

Query: 225 KECPLGPSQFT-KTKMNQAILCQILLSMRKRSMDISKL---YIGRENGYSMRSFQSKVFK 280
            +     +  + +  +  ++  Q+++ +   S+ I+KL   Y+G+E+G+SMRS QSKVF+
Sbjct: 267 IDHVNDLANLSHQDVLTPSLYAQVIIGL-PNSITITKLQKLYVGKESGFSMRSLQSKVFR 325

Query: 281 WKAPTILLITGKKIINDQEYSE-KNNRYKSFLNSYPRLKDGKTTFQ----TPLHYTFAIY 335
           WKAPT+++++G +I +D+ Y++ KN RY+SFL S+P+L++          T    T+A+Y
Sbjct: 326 WKAPTLMIVSGTRISDDESYADSKNPRYRSFLYSFPKLRENDQNLDAIHLTKKKVTYAVY 385

Query: 336 IEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHT-QNGIGIGNEH---MSSD 390
           I+EPWK++ K  FG  +  I++L+P+Q  +       +YF+T   GIG+G+E      +D
Sbjct: 386 IDEPWKVSNKEKFGATNMTIMELTPQQKTYQSCMERTMYFNTIGGGIGVGSEQPIVKQND 445

Query: 391 NKYKPGNVSITIDSTLEFAVFRHSGP-GVFKTGIIANQE--IFEIRLHIQSVEVWGCGGA 447
            K+ PGN+S+T+DS+LEF VFRH G  G FKT ++ N +   FEIR  IQ+VEVWGCGG 
Sbjct: 446 IKFIPGNISLTMDSSLEFGVFRHVGAGGGFKTSLLDNDDSKSFEIRFIIQNVEVWGCGGE 505

Query: 448 KXXXXXXXXXXXXXXXXXXXXXVSMH-VTEDRALLELAGIIGE 489
           K                     +++  ++ED+ALLE+ G++G+
Sbjct: 506 KELAEQLKQLEWEEAEAKRRQTINLQSLSEDKALLEMVGLVGQ 548

>Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  239 bits (610), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 178/531 (33%), Positives = 274/531 (51%), Gaps = 71/531 (13%)

Query: 18  NTLIKEIFTVSELITFQKRIN-RSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNK 76
           N   ++  T+ EL++F+  +   +L+  IS K +    + P +   +  +    +R L+ 
Sbjct: 32  NNKAQQQVTIPELVSFKGNLQIENLNTPISHKPLFNVLHFPPNHTIVVGIVTNMLRVLSN 91

Query: 77  YP---SNDNIITGYSYLKIITLLNKKRRNKMFPKI---EWIKIIFMCLSDEEVQ------ 124
           +P   S+   ITG+  LK I LLN+ R  K F KI   + +K++F+ LS ++        
Sbjct: 92  FPLINSSYEPITGFGLLKCILLLNRTRCEK-FLKIKSYDQLKLLFISLSLQKTDKEELSE 150

Query: 125 ------------------FPCWETTHDIHVLEND-LIEFISLLLTLNMNCCTDYCLINQD 165
                             F   +T  ++  L  D +++F+S LL L++   T     + D
Sbjct: 151 ENEENINRERHVKQIITDFDDVDT--EMLCLPADFMLQFLSWLLILSVKFPTTNSKTDND 208

Query: 166 LTFNDHDWDTYWRKSASCIVRDMKE---CNVEE----FEN----VLLIVPNIFDCLKNLI 214
            T+    WDT+ + SA  ++R M      NVE     FE     +  ++PN+F  L+NL+
Sbjct: 209 KTY--EQWDTF-KISAMNLLRTMNPDVVSNVESHFITFEQFSTAIRTVMPNLFKPLENLM 265

Query: 215 EHSLYTKDQL--KECPLGPSQFTKTKMNQAILCQILLSMRKRSM--DISKLYIGRENGYS 270
           EH  Y  + L  ++  L   Q ++  M  A+L Q+   + K      +  LYIGR++G+S
Sbjct: 266 EHFFYLDNDLVSRDANLSSIQDSRI-MTPALLAQLSTGLPKELFIQKLQSLYIGRKSGFS 324

Query: 271 MRSFQSKVFKWKAPTILLITGKKIINDQEY-SEKNNRYKSFLNSYPRLKDG----KTTFQ 325
           MRS Q+KVFKW AP+IL+++G +I N  EY +EKN RY+ FL+ +P+LKD       +  
Sbjct: 325 MRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKNPRYRHFLDEFPKLKDSDQKMDASHL 384

Query: 326 TPLHYTFAIYIEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHTQNGIGIGN 384
           +    TFA+YI++PWK+T K YFG L+T+IIQ+SPRQD++       +YF+T  G     
Sbjct: 385 SKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNQKGTIYFNTIGGGIGIG 444

Query: 385 EHM----SSDNKYKPGNVSITIDSTLEFAVFRHSG------PGVFKTGIIANQEIFEIRL 434
           +      ++  +Y PGNVS+T DSTLEFAVFRH+G      PG+           FE+  
Sbjct: 445 DKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRHTGYGGLLDPGLLSMERKEENSFFELHF 504

Query: 435 HIQSVEVWGCGGAKXXXXXXXXXXXXXXXXXXXXXVSMH-VTEDRALLELA 484
            IQ VEVWGCGG K                     ++   + EDRALLE+A
Sbjct: 505 LIQDVEVWGCGGEKELEEQIKQMAWEEAESKRRQQINFRSLGEDRALLEMA 555

>YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Protein
           of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; null
           mutation suppresses cdc13-1 temperature sensitivity
          Length = 567

 Score =  239 bits (609), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 168/532 (31%), Positives = 268/532 (50%), Gaps = 63/532 (11%)

Query: 18  NTLIKEIFTVSELITFQKRIN-RSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNK 76
           N   ++  T+ EL++F+  +    L+  IS K +    Y P +   +  +    +R L+ 
Sbjct: 32  NNKAQQQVTIPELVSFKGNLQIEDLNTPISHKALCNSLYFPQNHAMIVGIVTNMLRVLSN 91

Query: 77  YP---SNDNIITGYSYLKIITLLNKKRRNKMFPKIEW--IKIIFMCLS------------ 119
           +P   S+   ITGY  LK I LLN+ R  K      +  +K++F+ LS            
Sbjct: 92  FPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISLSLQKTDKEELSEE 151

Query: 120 -----DEEVQFPCWETTHD------IHVLENDLIEFISLLLTLNMNCCTDYCLINQDLTF 168
                ++E+      T  D      + +  + +++F++ LL L ++C T    ++   T 
Sbjct: 152 SENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTVDCPTTNSKLDNTET- 210

Query: 169 NDHDWDTYWRKSASCIVRDMKECNVEEFEN-----------VLLIVPNIFDCLKNLIEHS 217
             HD    ++ SA  ++R M    V + E+           +  ++PN+   L+NL+EH 
Sbjct: 211 --HDQWGNFKVSALNLLRTMNPDVVGDIESHSITFQQFSTAIRTVMPNLLKPLENLMEHF 268

Query: 218 LYTKDQLKECPLGPSQFTKTK-MNQAILCQILLSMRKRSM--DISKLYIGRENGYSMRSF 274
            Y +  L +     S    +K M  A+L Q+   + K      +  LYIGR++G+SMRS 
Sbjct: 269 FYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSLYIGRKSGFSMRSL 328

Query: 275 QSKVFKWKAPTILLITGKKIINDQEY-SEKNNRYKSFLNSYPRLKDGKTTFQTP----LH 329
           Q+KVFKW AP+IL+++G +I N +EY +EKN RY+ FL  +P+LK+              
Sbjct: 329 QAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKLKESDQMMDASHLNKRK 388

Query: 330 YTFAIYIEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHTQNGIGIGNEHM- 387
            TFA+YI++PWK+T K YFG L+T+II++SPRQD++       +YF+T  G     +   
Sbjct: 389 TTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTIYFNTIGGGIGIGDKQP 448

Query: 388 ---SSDNKYKPGNVSITIDSTLEFAVFRHSG------PGVFKTGIIANQEIFEIRLHIQS 438
               +  +Y PGNVS+T DSTLEFAVFR++G      PG+           +E+   IQ 
Sbjct: 449 LIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEENSPYELHFLIQD 508

Query: 439 VEVWGCGGAKXXXXXXXXXXXXXXXXXXXXXVSMH-VTEDRALLELAGIIGE 489
           VEVWGCGG K                     +++  + EDRALLE+AG++G+
Sbjct: 509 VEVWGCGGEKELEEQIKQLEWEEAESKRRQQINLRSLGEDRALLEMAGLVGQ 560

>SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score =  236 bits (602), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 177/526 (33%), Positives = 265/526 (50%), Gaps = 66/526 (12%)

Query: 25  FTVSELITFQKRI-NRSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYP----S 79
           FT  EL+ F+  +  +  +D +S +E+++   IP     L  L    I+ L+ +P    S
Sbjct: 36  FTTPELVAFKSNLKGKDQNDKVSVEEMLQLLKIPLGNELLADLLHNCIKTLSNFPLIRES 95

Query: 80  NDNIITGYSYLKIITLLNKKRRNKM--FPKIEWIKIIFMCLSDEEV--QFPC-------W 128
            D+I T    LK   LL+  R  K   F   + +K+I++ L+  +   + P        W
Sbjct: 96  YDDI-TVAGLLKSCILLSHDRCIKYVGFKNYDQLKLIYIALALRKTVKELPSSPDPAKPW 154

Query: 129 ETTH-----------DIHVLENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDTYW 177
           +              D++V  + +++ ++L L L+ +C  +   I + +      WD Y 
Sbjct: 155 DAKSIIRNYNSVDIDDLYVPADSMLQLLTLSLVLSRHCTVNNAKIRESVF---QHWDDY- 210

Query: 178 RKSASCIVRDMK----------EC--NVEEFENVLLIV-PNIFDCLKNLIEHSLYTKDQL 224
           + +A  ++R M           +C  + E+F N +  V P +   L+ L+EH LY    L
Sbjct: 211 KANAMNLLRTMNPDIVNTQDTVQCVISFEQFSNAIAAVFPQVLKPLEILVEHMLYLDRDL 270

Query: 225 KECPLGPSQFTKTKMNQAILCQILLSMRKRSM---DISKLYIGRENGYSMRSFQSKVFKW 281
            +     S  + +K+    L   L +M  + +    + KLY+GRE+G+SMRSFQSK FKW
Sbjct: 271 TDELNSTSMPSTSKLVTEPLLAQLSTMLPKELVYSKLRKLYVGRESGFSMRSFQSKAFKW 330

Query: 282 KAPTILLITGKKIINDQEYS-EKNNRYKSFLNSYPRLKDGKTTFQTPLHYT-----FAIY 335
            AP+ILLI G +I +DQEY+  KN RYK FL  YPRLKD       P         FA+Y
Sbjct: 331 MAPSILLIGGMRITDDQEYATTKNPRYKKFLEEYPRLKDKDQHIIDPCSLNRRKLLFAVY 390

Query: 336 IEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHT-QNGIGIGNEH---MSSD 390
           + EPWK+T K  FG L T ++QLSP+Q++F       VYF+T   GIG+G        + 
Sbjct: 391 VNEPWKVTNKELFGDLKTTVVQLSPKQELFKAVRTGNVYFNTLGGGIGVGCAQPVIKPNG 450

Query: 391 NKYKPGNVSITIDSTLEFAVFRHSG------PGVFKTGIIANQEIFEIRLHIQSVEVWGC 444
            KY PGNVS+TIDS+LEFA FRH G      PG   T +   +  FE +  +Q VEVWGC
Sbjct: 451 KKYFPGNVSLTIDSSLEFASFRHVGYGGAISPGTLMTKLEEEKTTFEYKFIVQDVEVWGC 510

Query: 445 GGAKXXXXXXXXXXXXXXXXXXXXXVSMH-VTEDRALLELAGIIGE 489
           GG K                     +++  + EDRALLE+AG++G+
Sbjct: 511 GGEKELQEQIKQWEWEEAEAKRRQRINLQSIGEDRALLEMAGLVGQ 556

>KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 554

 Score =  224 bits (572), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 165/522 (31%), Positives = 265/522 (50%), Gaps = 63/522 (12%)

Query: 23  EIFTVSELITFQKRIN-RSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYPSND 81
           ++ +  EL++++  I+ + LD  ++ KE+++   + ++   ++ L    ++ L  +P   
Sbjct: 34  KLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVEGLLFNCVQTLANFPLIK 93

Query: 82  NIITGYSYLKII---TLLNKKR-----RNKMF--PKIEWIKIIFMCLSDEEVQFPCWETT 131
           +     +Y+ ++    LLNK R     ++K +   K+ +I +       E    P    +
Sbjct: 94  DCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLALNKAVKEMSSLPNSNDS 153

Query: 132 HDI--------HVLENDLI-------EFISLLLTLNMNCCTDYCLINQDLTFNDHDWDTY 176
            D         +V E +L+       EF++L+LT++         ++ +++     WD++
Sbjct: 154 LDAPKVIATFNNVAEEELVVPAETMLEFLTLMLTMSKATVIKNSRLDVNIS---EKWDSF 210

Query: 177 WRKSASCIVRDMKE------------CNVEEFENVLL-IVPNIFDCLKNLIEHSLYTKDQ 223
            +  A  I+R M               +  +F+NV+  + PN+   L+ L+EH L+    
Sbjct: 211 -KTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLVPLECLMEHVLFLNRD 269

Query: 224 LKECPLGPSQFTKTKMNQAILCQILLSMRKRSMDIS---KLYIGRENGYSMRSFQSKVFK 280
           L +         ++K+    L   L ++  R +  S   KLY+GR++G+SMRSFQ+K FK
Sbjct: 270 LVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVGRDSGFSMRSFQAKAFK 329

Query: 281 WKAPTILLITGKKIINDQEYSE-KNNRYKSFLNSYPRLKDGKTTFQTPLH----YTFAIY 335
           W AP+ILL+ G +I +DQ+Y++ KN RYK FL+ YPRLKD        L       FAI 
Sbjct: 330 WMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLKDEDQHILPALSGKRKLLFAIL 389

Query: 336 IEEPWKMTKG-YFGGLHTKIIQLSPRQDVFTCTDPNAVYFHT-QNGIGIGNEH---MSSD 390
           I EPWK+T    FG + T I+QLSP Q+V+  + P  VYF+T   GIGIG+      SS 
Sbjct: 390 INEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYFNTLGGGIGIGSPQPIIKSSG 449

Query: 391 NKYKPGNVSITIDSTLEFAVFRHSGPGVFKTGIIA--NQEIFEIRLHIQSVEVWGCGGAK 448
            K+ PGNVS+TID  LEFA FR+ G G    G IA  N    E +  IQ +E WGCGG K
Sbjct: 450 VKFVPGNVSLTIDPNLEFAAFRNVGFG----GSIAPSNTPTSEHKFLIQDIETWGCGGEK 505

Query: 449 XXXXXXXXXXXXXXXXXXXXXVSM-HVTEDRALLELAGIIGE 489
                                +++  V +DRALLELAG++G+
Sbjct: 506 ELEEQMKNWEWEEAEAQRRQRINLKSVNDDRALLELAGLVGQ 547

>Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {ON}
           YOR118W - Hypothetical ORF [contig 130] FULL
          Length = 554

 Score =  221 bits (562), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 160/523 (30%), Positives = 260/523 (49%), Gaps = 69/523 (13%)

Query: 25  FTVSELITFQKRIN-RSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYPSNDNI 83
            T  EL++F+  IN + L D+++  E++K   +      +  L    ++ L+ +P   + 
Sbjct: 36  LTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVSSLIFNCVQTLSNFPFIRDC 95

Query: 84  ITGYSY---LKIITLLNKKR-----RNKMFPKIEWIKIIFMCLS---------------- 119
               +Y   LK   LLNK R     +NK +   +  K++++ L+                
Sbjct: 96  YENITYSGLLKSCVLLNKARCLSYVKNKRY---DHTKLVYISLALNKTVKEVSSSSNSQE 152

Query: 120 --DEEVQFPCWETT--HDIHVLENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDT 175
             D       + +    ++ V    ++EFI+L+L ++ +       ++ +++     W++
Sbjct: 153 SLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTIIKNSKLDPNVS---EGWES 209

Query: 176 YWRKSASCIVRDMKE------------CNVEEFENVLLIV-PNIFDCLKNLIEHSLYTKD 222
           + R  A  I+R M                  +F++ +  V PN+    ++L+EH L+   
Sbjct: 210 F-RPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNLLLPFESLMEHVLFLGR 268

Query: 223 QLKECPLGPSQFTKTKMNQAILCQILLSMRKRSMDIS---KLYIGRENGYSMRSFQSKVF 279
            L +         ++K+    L   L ++  R +  S   KLY+GR++G+SMRSFQ+K F
Sbjct: 269 DLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYVGRDSGFSMRSFQAKAF 328

Query: 280 KWKAPTILLITGKKIINDQEYSE-KNNRYKSFLNSYPRLKDGKTTFQTPLH----YTFAI 334
           KW AP+ILLI G +I ND+EY++ KN+RYK+FL  YPRLK+       P        FA+
Sbjct: 329 KWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLKEEDQVLLPPFSGKKKLLFAV 388

Query: 335 YIEEPWKMTKG-YFGGLHTKIIQLSPRQDVFTCTDPNAVYFHT-QNGIGIGNEH---MSS 389
           Y+  PWK+T    FG L T IIQLSP Q+V+  + P  +YF+T   GIG+G+       +
Sbjct: 389 YVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIYFNTLGGGIGVGSPQPIVKPT 448

Query: 390 DNKYKPGNVSITIDSTLEFAVFRHSGPG--VFKTGIIANQEIFEIRLHIQSVEVWGCGGA 447
             KY PGNVS+TID  LEFAVFR +G G  +  +  I N+  F     IQ +E WGCGG 
Sbjct: 449 SRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVNEHKF----LIQDIEAWGCGGE 504

Query: 448 KXXXXXXXXXXXXXXXXXXXXXVSM-HVTEDRALLELAGIIGE 489
           K                     +++  + +DRALLE+AG++G+
Sbjct: 505 KELEEQMKNWEWEEAEAQRRQRINLKSINDDRALLEMAGLVGQ 547

>Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {ON}
           similar to Ashbya gossypii AER258C
          Length = 566

 Score =  218 bits (555), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 164/526 (31%), Positives = 262/526 (49%), Gaps = 74/526 (14%)

Query: 29  ELITFQKRI--NRSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYP-----SND 81
           EL+ FQ  I  +  L D +S + +++   +P  K     ++ + I N +K+P     + +
Sbjct: 41  ELVAFQNNIGLDADLKDYLSCEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGE 100

Query: 82  NIITGYSYLKIITLLNKKR-----RNKMFPKIEWIKIIFMC-----LSDEEVQFP----- 126
           ++ T    +K   L + K+     + K + ++  I I+        +S +E+  P     
Sbjct: 101 DVPTFVGLVKACLLFDYKKLLKYAQCKTYDQVSLIFILLALEPHAKVSKKELGRPPSSYD 160

Query: 127 ---CWETTHDIH-----VLENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDTYWR 178
                E+ +DI+     V  +DL++F++ LL +   C  +   +N  +  N  D+++   
Sbjct: 161 ARKIMESFNDINLETIEVSADDLLQFMTFLLVITKYCIFENVEVNPSIYENWKDYES--- 217

Query: 179 KSASCIVRDMKECNVE------------EFENVLLIV-PNIFDCLKNLIEHSLYTKDQL- 224
             A  I+R M  C V             +F++ +  V PN+   L   ++H LY  + L 
Sbjct: 218 -QALNILRTMNPCIVSYSDAAKNVVTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLV 276

Query: 225 KECPLGPSQFTKTKMNQAILCQILLSMRKRSM--DISKLYIGRENGYSMRSFQSKVFKWK 282
            +     +  + T M   +L Q+     K  +  ++ KL+I +++G+S+RSFQ+KV  W 
Sbjct: 277 SDSGATINDRSSTVMTDPLLAQLCTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWM 336

Query: 283 APTILLITGKKIINDQEYSEKNNRYKSFLNSYPRLKD----GKTTFQTPLHYTFAIYIEE 338
           AP+ILL++G KI++D +   KN RYKSFL  YP+LKD      +        TFA+++ E
Sbjct: 337 APSILLVSGMKIMDDSKLLAKNQRYKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHE 396

Query: 339 PWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHT-QNGIGIGNEH---MSSDNKY 393
            WK+T K  FG L T I+QLSPRQ+VF  +    +YF+T   GIGIGN      SS  KY
Sbjct: 397 AWKVTNKEQFGNLKTLILQLSPRQEVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKY 456

Query: 394 KPGNVSITIDSTLEFAVFRHSGPGVFKTGIIANQEIF----------EIRLHIQSVEVWG 443
            PGNVS+TID + EF VFR+ G G    G I+  ++F          E R  IQ VEVWG
Sbjct: 457 FPGNVSLTIDPSFEFGVFRNVGHG----GSISPGKLFLERPDVEQSLECRFIIQDVEVWG 512

Query: 444 CGGAKXXXXXXXXXXXXXXXXXXXXXVSM-HVTEDRALLELAGIIG 488
           CGG K                     +++  + ED+ALLE+ G++G
Sbjct: 513 CGGDKEFEAQLKQWEWEEAESERRQYINLSSIGEDKALLEMVGLVG 558

>KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 572

 Score =  211 bits (536), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 165/534 (30%), Positives = 253/534 (47%), Gaps = 73/534 (13%)

Query: 25  FTVSELITFQKRI--NRSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYPSNDN 82
            T +ELI+F+  I   + L+D +   +I +  YIP     +  +++     L  +P   +
Sbjct: 36  LTTAELISFKNNIPEGKELNDYVEVSDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQD 95

Query: 83  IITGYSYLKIITLLNKKRRNKMFPKIEW-----IKIIFMCLS-----------DEEVQFP 126
                ++  ++       + +     +W     +K++F+ LS           D      
Sbjct: 96  SYEKVTFKTLLKATLLLVKERAIKYTDWKKYNDLKMLFITLSLEKNIKAEPLMDSSALSD 155

Query: 127 C--WETT---------HDIHVLENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDT 175
           C  W+            ++ V  N+L+ F++L+L L+  C  + C I+ D+     +   
Sbjct: 156 CKDWKGVIRSYNGTDFDELKVNANNLLHFLALILALSRCCILNNCKIDNDVLAKSLE--- 212

Query: 176 YWRKSASCIVR-------DMKEC-----NVEEFE-NVLLIVPNIFDCLKNLIEHSLYT-K 221
            ++  A  IVR        M +C        +F   V  + PN+ + LK L+EH LY  +
Sbjct: 213 DFKHQALNIVRTMNPEIISMSDCLDSSITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDR 272

Query: 222 DQLKECPLGPSQFTKTKMNQAILCQILLSMRKRSM--DISKLYIGRENGYSMRSFQSKVF 279
           D +    L P       +N++ L Q+   + K  +     KLY+GRE+G+SMRSFQSKVF
Sbjct: 273 DLVDADVLQPISNPTKIVNESELSQLATFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVF 332

Query: 280 KWKAPTILLITGKKIINDQE-----YSEKNNRYKSFLNSYPRLKDGKTTFQT----PLHY 330
           KW APTIL + G +I ++ +     Y+ KN RY++FL  Y +LK       T        
Sbjct: 333 KWMAPTILFVEGMRIRDEDDEDGDAYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKL 392

Query: 331 TFAIYIEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDP---NAVYFHTQNGIGIGNEH 386
            FA+ I +PWK++ K  FG   TKIIQL PRQ++F   DP     VYF+T  G       
Sbjct: 393 LFAVCIRDPWKVSNKDLFGDSSTKIIQLHPRQEIFDA-DPFKTGNVYFNTVGGGIGIGSS 451

Query: 387 M----SSDNKYKPGNVSITIDSTLEFAVFRHSG------PGVFKTGIIANQEIFEIRLHI 436
                ++  KY PGNVS+TIDS+LEF +FRH G      PG   +G    +  FE R  I
Sbjct: 452 QPIIKANGKKYFPGNVSLTIDSSLEFGIFRHLGAGGSFKPGRLISGRGEERNSFEYRFII 511

Query: 437 QSVEVWGCGGAKXXXXXXXXXXXXXXXXXXXXXVSMH-VTEDRALLELAGIIGE 489
           Q VEVWGCGG K                     +++  + EDRALLE+AG++G+
Sbjct: 512 QDVEVWGCGGEKELEEQVKQWQWEEAEAKRRQKINLQSMGEDRALLEMAGLVGQ 565

>AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR118W
          Length = 557

 Score =  183 bits (465), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 111/306 (36%), Positives = 167/306 (54%), Gaps = 19/306 (6%)

Query: 202 IVPNIFDCLKNLIEHSLYTK-DQLKECPLGPSQFTKTKMNQAILCQILLSMRKRSM--DI 258
           + PN+FD L   +E   Y K D   +    P++ T T +   +L Q+     + ++   +
Sbjct: 244 VFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLSTLYPRINLFTSM 303

Query: 259 SKLYIGRENGYSMRSFQSKVFKWKAPTILLITGKKIINDQEYSEKNNRYKSFLNSYPRLK 318
            +L++  + G+SM  FQ+KVFKW APTIL ++G +I +D+    KN RYK+FL  YP LK
Sbjct: 304 QRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDDEIVCTKNKRYKAFLQDYPALK 363

Query: 319 DGKTTF----QTPLHYTFAIYIEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVY 373
           D +       +   +  +AI++ +PWK+T K  FG + T IIQL+PRQ +F   +   +Y
Sbjct: 364 DAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQLAPRQKIFKAQEAPNIY 423

Query: 374 FHT-QNGIGIGNEHMS---SDNKYKPGNVSITIDSTLEFAVFRHSG-PGVFKTGII---- 424
           F+    GIG G+   S   +  +Y PGNVS T+D ++EFAVFR+ G  G+F  G      
Sbjct: 424 FNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAVFRNVGDGGMFSHGSAVPAP 483

Query: 425 ANQEI-FEIRLHIQSVEVWGCGGAKXXXXXXXXXXXXXXXXXXXXXVSMH-VTEDRALLE 482
           A Q + +E RL I+ +EVWG GG +                     +  +   EDRALLE
Sbjct: 484 AEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEATKRKYIKTNGGNEDRALLE 543

Query: 483 LAGIIG 488
           +AGI+G
Sbjct: 544 MAGIVG 549

>TBLA0B03350 Chr2 complement(781108..782691) [1584 bp, 527 aa] {ON}
           Anc_8.768 YOR298W
          Length = 527

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 64/133 (48%), Gaps = 22/133 (16%)

Query: 61  PHLQHLYLRFIRNLNKYPSNDNIITGYSYLKIITLL--NKKRRNKMFPKIEWIKIIFMCL 118
           P + + +L FIR ++ +  N+ +    ++ + +TL+  NK  R KMF   E +K IFM  
Sbjct: 77  PFIGNKFLHFIRYIDDFNRNNCVSFFENFKRYLTLMFYNKLGR-KMFVNKECVK-IFMNE 134

Query: 119 SDEEVQFPCWETTHDIHVLENDLIEFISLLLTLNMNCCTDYCLINQDL-TFNDHD----- 172
            +E+  F   + T D          F S LL  N     DY +IN  + TFN +D     
Sbjct: 135 GNEKFDFIREDGTED---------PFKSTLLICNHRSLVDYFVINHIVETFNIYDQEFSI 185

Query: 173 WD---TYWRKSAS 182
           WD   T+W K+ +
Sbjct: 186 WDITKTFWSKNTN 198

>ZYRO0D16082g Chr4 (1342194..1344626) [2433 bp, 810 aa] {ON} similar
           to uniprot|P43610 Saccharomyces cerevisiae YFR038W
           Hypothetical ORF
          Length = 810

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 65/142 (45%), Gaps = 6/142 (4%)

Query: 137 LENDLIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDTYWRKSASCIVRDMKECNVEEF 196
           L+N+LIE  SLL  +  +   D+ + N+   F   D ++  +K +  I  ++++  +   
Sbjct: 348 LQNNLIELWSLLNFIMPDVFADFEIFNKWFDFKSLDLESSSKKLSKMINDELEKNLITNL 407

Query: 197 ENVLLIVPNIFDCLKNLIEHSLY--TKDQLKECPLGPSQ--FTKTKMNQAILCQILLSMR 252
             +L   P +   +KN++   +    ++ L  C L P Q  F +  +   +   I   M 
Sbjct: 408 HTIL--KPFLLRRMKNVVLAGILPPKREYLINCSLTPIQKKFYRMGLTGKLKRTIFKEMV 465

Query: 253 KRSMDISKLYIGRENGYSMRSF 274
           K    ++  Y+G+ +  S+R F
Sbjct: 466 KSFFTLNTDYVGQVSNKSIRDF 487

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 59/119 (49%), Gaps = 28/119 (23%)

Query: 4   KYSSTETLPLPK-NPNTLIK---EIFTVSELITFQ-KRINRSLDDIISDKEIIK-----F 53
           KYS  E L LP  N +  I+   +IFTV +L T   K+I + L   ISD+E++K      
Sbjct: 365 KYS--EILQLPNVNKDHFIENSEDIFTVGKLFTLDDKKIGKVLG--ISDEELLKDTLAVA 420

Query: 54  SYIPDSKPHLQHLYLRFIRNLNKYPSNDNIITG-YSYLKIITLLNKKRR----NKMFPK 107
           S IP         +LR ++   K P   N+ITG   Y+ +  L++  R+     K FP+
Sbjct: 421 SNIP---------FLRLLKAEFKVPGEKNVITGSIPYISLKILVHSARQKVISEKKFPE 470

>SAKL0G18414g Chr7 complement(1588834..1590873) [2040 bp, 679 aa]
           {ON} similar to uniprot|P47166 Saccharomyces cerevisiae
           YJR134C SGM1 Protein of unknown function required for
           wild- type growth rate on galactose and mannose
           localizes to COPI coated vesicles and the Golgi
           apparatus
          Length = 679

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 63/138 (45%), Gaps = 12/138 (8%)

Query: 192 NVEEFENVL------LIVPNIFDCLK----NLIEHSLYTKDQLKECPLGPSQFTKTKMNQ 241
           ++E F NVL      L +  + +CLK    NL +    TK +LK+  L P Q  + K N 
Sbjct: 80  DLEIFANVLPEDFTQLTIKQLLECLKPHFVNLRDELEETKKELKQEQLQPKQELQNK-NT 138

Query: 242 AILCQILLSMRKRSMDISKLYIGRENGYSMRSFQSKVFKWKAPTILLITGKKIINDQEYS 301
           +    I L ++++   I +L    EN   M   QS + K     I  +     I+ ++  
Sbjct: 139 SDSSLIKL-IKEKDAKIDQLLKEGENLSKMELKQSNIIKSLKKKIRNVETDLEIHREDLK 197

Query: 302 EKNNRYKSFLNSYPRLKD 319
           +K  +Y+S   SY  L++
Sbjct: 198 DKVGKYESLQGSYSHLQN 215

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,993,164
Number of extensions: 2522106
Number of successful extensions: 6739
Number of sequences better than 10.0: 37
Number of HSP's gapped: 6800
Number of HSP's successfully gapped: 42
Length of query: 492
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 378
Effective length of database: 40,409,475
Effective search space: 15274781550
Effective search space used: 15274781550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)