Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A065205.433ON2062069461e-131
NCAS0F033705.433ON2112044932e-62
Kpol_1062.305.433ON2142124881e-61
KAFR0E039305.433ON2112064872e-61
CAGL0A02794g5.433ON2162134838e-61
KNAG0C049205.433ON2172094707e-59
Suva_2.5395.433ON2272194622e-57
TPHA0E017705.433ON2172144612e-57
ZYRO0F10010g5.433ON2082024602e-57
TDEL0E019205.433ON2202144586e-57
YDR367W (KEI1)5.433ON2212134482e-55
Smik_4.6335.433ON2212144412e-54
Skud_4.6365.433ON2342234397e-54
TBLA0G020105.433ON2131804107e-50
SAKL0G02508g5.433ON2282204013e-48
AER256C5.433ON2392123702e-43
Ecym_47625.433ON2212193464e-40
KLLA0E21099g5.433ON2242163422e-39
Kwal_55.214325.433ON2072073394e-39
NDAI0B056605.433ON1611603232e-37
KLTH0F16082g5.433ON2061693108e-35
Kpol_1050.485.113ON202660701.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A06520
         (206 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   369   e-131
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   194   2e-62
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   192   1e-61
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   192   2e-61
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   190   8e-61
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   185   7e-59
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   182   2e-57
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   182   2e-57
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   181   2e-57
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   181   6e-57
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   177   2e-55
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   174   2e-54
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   173   7e-54
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   162   7e-50
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   159   3e-48
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   147   2e-43
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   137   4e-40
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   136   2e-39
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   135   4e-39
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   129   2e-37
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   124   8e-35
Kpol_1050.48 s1050 (104245..110325) [6081 bp, 2026 aa] {ON} (104...    32   1.8  

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  369 bits (946), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 181/206 (87%), Positives = 181/206 (87%)

Query: 1   MTPERYRAAVKRFILPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQ 60
           MTPERYRAAVKRFILPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQ
Sbjct: 1   MTPERYRAAVKRFILPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQ 60

Query: 61  WVLYTWSIVCLAIYAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTT 120
           WVLYTWSIVCLAIYAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTT
Sbjct: 61  WVLYTWSIVCLAIYAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTT 120

Query: 121 TRPPAAQGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFRPAYTLDTDEVETEX 180
           TRPPAAQGASDAYEY             RLYFNFIVGSFLQELFFRPAYTLDTDEVETE 
Sbjct: 121 TRPPAAQGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFRPAYTLDTDEVETEL 180

Query: 181 XXXXXXXXXXXQNQHYCYILSRRILS 206
                      QNQHYCYILSRRILS
Sbjct: 181 RHSSLLRRLWLQNQHYCYILSRRILS 206

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  194 bits (493), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 97/204 (47%), Positives = 127/204 (62%), Gaps = 12/204 (5%)

Query: 15  LPK---RFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCL 71
           LPK    F G+ PLYLGVE+VLGITIFNKC GAYGILALF GHPL+F QWV Y WSI  L
Sbjct: 8   LPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIFTL 67

Query: 72  AIYAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTTTRPPA------ 125
            I+AQGL ++H+PTL TFSQ+ +F+S+DT+ TC FT++FT +WF    T    A      
Sbjct: 68  IIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEPTGTEEALQRRNE 127

Query: 126 ---AQGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFRPAYTLDTDEVETEXXX 182
              +QGA++AYEY             RLYFN ++ +F+QEL   P Y +D D+VE +   
Sbjct: 128 SLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDDVEQDLKN 187

Query: 183 XXXXXXXXXQNQHYCYILSRRILS 206
                    +NQ + Y +   +L+
Sbjct: 188 KPVWKRWWIKNQKWSYKVCSHLLA 211

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  192 bits (488), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 96/212 (45%), Positives = 123/212 (58%), Gaps = 6/212 (2%)

Query: 1   MTPERYRAAVKRFILPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQ 60
           +  E  R       LP+ F G  PLY+GVE VLGITI NKC GAYGILALF GHPL   Q
Sbjct: 3   INQELSRVKTHYSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQ 62

Query: 61  WVLYTWSIVCLAIYAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTT 120
           WV Y WS+  L IY+QGL +VH P+L T+SQ+F+ FS DT LTC FT+ F+ +WF    +
Sbjct: 63  WVSYLWSVFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGS 122

Query: 121 TRPPAA------QGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFRPAYTLDTD 174
                +      QGAS+ YEY             R+YFNFI+ +F QELF  P Y +D D
Sbjct: 123 GMSDGSGVDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFD 182

Query: 175 EVETEXXXXXXXXXXXXQNQHYCYILSRRILS 206
           +VE +            +++  CY L+R IL+
Sbjct: 183 DVEQDLKNKNKIVQWWIKSKKSCYNLARHILT 214

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  192 bits (487), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 121/206 (58%), Gaps = 12/206 (5%)

Query: 13  FILPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLA 72
           F LPK F GV PLYL VE+VLGIT FNK  GA+GILALF GHPL F QWV Y WS V L 
Sbjct: 6   FSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVTLF 65

Query: 73  IYAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTTTRPP-------- 124
           ++AQGL ++H+P + TFSQ+F+F+S+DTL  C FT++FT +WF   + T           
Sbjct: 66  VFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGSTITKR 125

Query: 125 ----AAQGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFRPAYTLDTDEVETEX 180
               ++QGAS  YEY             R YFNFI+ SF+QEL   P Y  D D++E + 
Sbjct: 126 TEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDDIEQDL 185

Query: 181 XXXXXXXXXXXQNQHYCYILSRRILS 206
                      + Q  CY L + +L+
Sbjct: 186 KNKSIWKRWWLKCQKSCYKLCKNLLA 211

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  190 bits (483), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 127/213 (59%), Gaps = 17/213 (7%)

Query: 10  VKRFILPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIV 69
           + +   PK F G  PLYLGVE+VLGITI NKC GAYGILALF GHPL++ QW+ Y WS+ 
Sbjct: 3   LNKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVF 62

Query: 70  CLAIYAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAA-----NTTTRPP 124
            L +++QGL  +H+P L  FSQ+ ++F+ DT+LTC FT++F+ +WF +     + T+ P 
Sbjct: 63  TLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPV 122

Query: 125 ------------AAQGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFRPAYTLD 172
                       A+QGAS+ YEY             R+YFNFI+ SF+QEL   P Y +D
Sbjct: 123 GVSQNYRRSTDLASQGASERYEYTVTMLFTLVTLMFRMYFNFILASFVQELLRHPKYMVD 182

Query: 173 TDEVETEXXXXXXXXXXXXQNQHYCYILSRRIL 205
            D+VE +            ++Q +CY L R  L
Sbjct: 183 QDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  185 bits (470), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 89/209 (42%), Positives = 121/209 (57%), Gaps = 18/209 (8%)

Query: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74
           LPK F G+ PLY+GVE+VLG+T+ NKC GA+GILALF GHPL+  QW  Y WS+  L +Y
Sbjct: 8   LPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVVY 67

Query: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTTTRPPAA-------- 126
           AQGL ++H+P L TFSQ+ + FS+DT+LTC FT++FT  WFA  + T             
Sbjct: 68  AQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAASAVAR 127

Query: 127 ----------QGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFRPAYTLDTDEV 176
                     QGA+++YEY             RLYFNF++ SF+QEL   P Y +D D++
Sbjct: 128 LVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQDDI 187

Query: 177 ETEXXXXXXXXXXXXQNQHYCYILSRRIL 205
           E +             +Q   Y + R +L
Sbjct: 188 EQDLKNKFFLRRWWVVSQKSSYSICRHVL 216

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  182 bits (462), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 93/219 (42%), Positives = 124/219 (56%), Gaps = 28/219 (12%)

Query: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74
           LPK F G  PLYL VE+VLGI+I NKC GAYGILALF GHPL+F QWV Y WS+  L ++
Sbjct: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVF 67

Query: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWF-----------AANTTTR- 122
           AQGL  +H+P L  FSQ+ + ++VDT+ TC FT++FT +WF           A++T T+ 
Sbjct: 68  AQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIVADASSTATQT 127

Query: 123 ----------------PPAAQGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFR 166
                             + QGAS++YEY             R YFNFI+ SF+QEL   
Sbjct: 128 INYNPIATGKLTARSTDTSGQGASESYEYSITILITLVSLIFRFYFNFILASFVQELLHH 187

Query: 167 PAYTLDTDEVETEXXXXXXXXXXXXQNQHYCYILSRRIL 205
           P Y +D D+VE +            ++Q  CY L + +L
Sbjct: 188 PKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  182 bits (461), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 96/214 (44%), Positives = 120/214 (56%), Gaps = 10/214 (4%)

Query: 2   TPERYRAAVKRFILPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQW 61
           T  R R    + +LPK F G  PLY+GVE VLGITIFNKC G YGILALF GHPL   QW
Sbjct: 5   TSGRVRMQTPK-LLPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQW 63

Query: 62  VLYTWSIVCLAIYAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAA---- 117
           V Y WS   L IYAQGL +VH P L T+ Q+ I +S DT+ TC FT+YF   WF      
Sbjct: 64  VSYLWSSFTLLIYAQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNA 123

Query: 118 -----NTTTRPPAAQGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFRPAYTLD 172
                ++TT     QGAS++ E+             R YFNFI+ SF Q+LF  P Y +D
Sbjct: 124 GDNINSSTTVDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMID 183

Query: 173 TDEVETEXXXXXXXXXXXXQNQHYCYILSRRILS 206
            D+VE +            +++  CY  S+R L+
Sbjct: 184 QDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFLA 217

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  181 bits (460), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 121/202 (59%), Gaps = 10/202 (4%)

Query: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74
           LPKRF G  PLY+GVE+ LG+TI NKC G +GILALF GHPLEF QWVLY WSI    +Y
Sbjct: 7   LPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFVVY 66

Query: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFA--ANTTTRPPAA------ 126
           AQGL    +P+L  FSQ+FI FS+DT LTC FT++FT++W+    NT T+   A      
Sbjct: 67  AQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLEDNTPTQKSIAAAAMQE 126

Query: 127 --QGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFRPAYTLDTDEVETEXXXXX 184
             QGAS ++E+             RLYFNF++ SF+Q L   P Y +D  +VE E     
Sbjct: 127 PNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQELRTQP 186

Query: 185 XXXXXXXQNQHYCYILSRRILS 206
                  + Q  C   S+++L+
Sbjct: 187 VWKRVWTRTQIRCLRYSKQLLT 208

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  181 bits (458), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 92/214 (42%), Positives = 122/214 (57%), Gaps = 18/214 (8%)

Query: 11  KRFILPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVC 70
           K   LPK F G  PLY+GVE+ LGI+I NKC GAYGILALF GHPL+  QWVLY WSI  
Sbjct: 7   KSMGLPKSFLGFVPLYIGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLYIWSIFT 66

Query: 71  LAIYAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWF-----------AANT 119
           L I  QGL ++H+P + TFS +FI F +DTL T  FT++FT +W+             ++
Sbjct: 67  LIICVQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEGNSNNVKDTKSS 126

Query: 120 TTRPP-------AAQGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFRPAYTLD 172
            +  P       A QGAS+ +EY             +LYF FI+ SF+QEL   P Y LD
Sbjct: 127 YSDAPVDYSSKIAHQGASEGFEYGVTMFITILSLAGKLYFTFIIASFVQELLLHPRYMLD 186

Query: 173 TDEVETEXXXXXXXXXXXXQNQHYCYILSRRILS 206
            D+VE +            ++Q  CY +S+ +L+
Sbjct: 187 QDDVEQDLKHQSFWKRWWIKSQKSCYKMSKSLLA 220

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  177 bits (448), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 117/213 (54%), Gaps = 22/213 (10%)

Query: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74
           LPK F G  PLYL VE+VLGI+I NKC GAYGILALF GHPL+F QW+ Y WS+  L ++
Sbjct: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTLIVF 67

Query: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTTTR------------ 122
           +QGL  +H+P L  FSQ+ + +++DT+ TC FT++FT +WF    T              
Sbjct: 68  SQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANIDGNNALQSNPI 127

Query: 123 ----------PPAAQGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFRPAYTLD 172
                       + Q A+++YEY             R YFNFI+ SF+QEL   P Y +D
Sbjct: 128 STGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYLVD 187

Query: 173 TDEVETEXXXXXXXXXXXXQNQHYCYILSRRIL 205
            D+VE              ++Q  CY L + +L
Sbjct: 188 RDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  174 bits (441), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 88/214 (41%), Positives = 116/214 (54%), Gaps = 22/214 (10%)

Query: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74
           LPK F G  PLYL VE+VLGI+I NKC G YGILALF GHPL+F QWV Y WS+  L I+
Sbjct: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAYLWSVFTLIIF 67

Query: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTTTRPPAA-------- 126
           +QGL  +H+P L  FSQ+   +++DTL TC FT++FT +WF    T    A+        
Sbjct: 68  SQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWFTTQWFTLEDTAGGVASQSNNSNLI 127

Query: 127 --------------QGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFRPAYTLD 172
                         Q A+++YEY             R YFN I+ SF+QEL   P Y +D
Sbjct: 128 STERLTVRNTDISKQSATESYEYSITILITLVSLIFRFYFNLILASFVQELLHHPKYLVD 187

Query: 173 TDEVETEXXXXXXXXXXXXQNQHYCYILSRRILS 206
            D+VE              ++Q  CY L + +L+
Sbjct: 188 RDDVEQNLKNKPIWKRLYAKSQKGCYKLCKNLLN 221

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  173 bits (439), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 90/223 (40%), Positives = 120/223 (53%), Gaps = 31/223 (13%)

Query: 14  ILPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAI 73
           I  K F G  PLYL VE+VLGI+I NKC GAYGILALF GHPL+F QWV Y WS+  L +
Sbjct: 11  IFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIV 70

Query: 74  YAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFA----------ANTT--- 120
           ++QGL  +H+P L  FSQ+ I ++VDT+ TC FT++FT +WF           AN+T   
Sbjct: 71  FSQGLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDFGSIANSTADT 130

Query: 121 ------------------TRPPAAQGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQE 162
                             +   + Q A++ YEY             R YFN I+GSF+QE
Sbjct: 131 ALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLILGSFVQE 190

Query: 163 LFFRPAYTLDTDEVETEXXXXXXXXXXXXQNQHYCYILSRRIL 205
           L   P Y +D D+VE +            ++Q  CY L + +L
Sbjct: 191 LLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  162 bits (410), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 77/180 (42%), Positives = 103/180 (57%), Gaps = 14/180 (7%)

Query: 14  ILPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAI 73
           +LP  F  + PLYLGVEL+LGI I NKC G YGILALF GHPL   QW+ Y WSI  L I
Sbjct: 12  VLPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLI 71

Query: 74  YAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTTTRPPA-------- 125
           Y QG+  + +P +Y FSQ+F  FS+DT+ T   T+YF  +WF+++ + +           
Sbjct: 72  YTQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQSENSLQRTEK 131

Query: 126 ------AQGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFRPAYTLDTDEVETE 179
                  QGAS  YE              R Y+N ++ SFL +LF  P + +D D+VET+
Sbjct: 132 DIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFIIDQDDVETD 191

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  159 bits (401), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 115/220 (52%), Gaps = 28/220 (12%)

Query: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74
           LPK F G  PLY+GVEL LGI+IFNK  G YGILALF GHPL+F QW  Y+ S++ L +Y
Sbjct: 9   LPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLSVLTLLVY 68

Query: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAA----------------- 117
             GL ++ +P   T+S V + F++DTLL C FT++F+ +WF+                  
Sbjct: 69  LSGLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKLQS 128

Query: 118 -----------NTTTRPPAAQGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFR 166
                      N      A+Q AS  YEY             R YFNFI+ +F+Q++   
Sbjct: 129 AGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRH 188

Query: 167 PAYTLDTDEVETEXXXXXXXXXXXXQNQHYCYILSRRILS 206
           P Y +D D+VE +            +++ +CY   +R L+
Sbjct: 189 PKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  147 bits (370), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 78/212 (36%), Positives = 108/212 (50%), Gaps = 22/212 (10%)

Query: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74
           LPK F G+ PLY+GVEL LGI IFNK  G +G+LALF GHPL+  QW+ Y WS V L +Y
Sbjct: 29  LPKSFFGL-PLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLLVY 87

Query: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWF------------------- 115
             GL ++++P L  +  V + +S DT+LTC +T++FT  WF                   
Sbjct: 88  LHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVTATAKEDDADAT 147

Query: 116 --AANTTTRPPAAQGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFRPAYTLDT 173
             +      P + Q AS +YEY             R Y NF++ SF+Q +F    +    
Sbjct: 148 QGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKFAAGC 207

Query: 174 DEVETEXXXXXXXXXXXXQNQHYCYILSRRIL 205
           D+VE +            + Q +CY L RR L
Sbjct: 208 DDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  137 bits (346), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 107/219 (48%), Gaps = 29/219 (13%)

Query: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74
           LP+ F G+ PLY+GVEL LG+ IFNK  G YGILALF G PL+  QW  Y WS   L ++
Sbjct: 4   LPQSFFGL-PLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVF 62

Query: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTT---TRPPAAQG--- 128
            +GL++V++P L T+  V   +S+DT+L C F V FT +WF+   T   + P + +G   
Sbjct: 63  TKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGV 122

Query: 129 ----------------------ASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFR 166
                                 AS  YEY             R Y NFI+ SF++ +  +
Sbjct: 123 VDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQ 182

Query: 167 PAYTLDTDEVETEXXXXXXXXXXXXQNQHYCYILSRRIL 205
             Y  + D+VE +              Q +CY   RR L
Sbjct: 183 NRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  136 bits (342), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 108/216 (50%), Gaps = 26/216 (12%)

Query: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74
           LP+ F    PLY+GVE+ LG+  FNK  G YG+LALF GHPL+F QW  Y WSI CL ++
Sbjct: 10  LPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLVVF 68

Query: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFA------------------ 116
             G+ +V++P +   S V   FSVDT+++C + ++FT  WF+                  
Sbjct: 69  ISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTALG 128

Query: 117 -------ANTTTRPPAAQGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFRPAY 169
                  +  +T+   ++ AS  YE+             R YFNFI+ +F Q+L     +
Sbjct: 129 PAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSGKF 188

Query: 170 TLDTDEVETEXXXXXXXXXXXXQNQHYCYILSRRIL 205
           T D +++E              + + +C+ L +R L
Sbjct: 189 TFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  135 bits (339), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 110/207 (53%), Gaps = 27/207 (13%)

Query: 27  LGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIYAQGLAKVHRPTL 86
           +GVE+ LGIT+ NKC G YGIL L  GH L+F QWVLY  SI+ + +Y+ GL+ +++P++
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 87  YTFSQVFIFFSVDTLLTCAFTVYFTHEWFAA--------NTTTRPPAA------------ 126
            ++S + + F+ DTL+TC FT++F+ +WF+A        N+TT   +A            
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120

Query: 127 -------QGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFRPAYTLDTDEVETE 179
                  Q AS   EY             R YFNFI+ +F+Q L   P Y +D D+VE +
Sbjct: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180

Query: 180 XXXXXXXXXXXXQNQHYCYILSRRILS 206
                       + + + Y + RR L+
Sbjct: 181 LKHRGFLRRWWIRAETHSYKICRRYLA 207

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  129 bits (323), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 91/160 (56%), Gaps = 13/160 (8%)

Query: 60  QWVLYTWSIVCLAIYAQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWF---- 115
           QWV Y WSI CL I+AQGL ++H+PTL TFSQ+ +FF++DTL TC FT++FT +WF    
Sbjct: 2   QWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWFQGSE 61

Query: 116 ---AANTTT------RPPAAQGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFR 166
              A  T+T         A+QGA+  YEY             R YFN I+ SF+QEL   
Sbjct: 62  GESAVQTSTGVQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQELLSN 121

Query: 167 PAYTLDTDEVETEXXXXXXXXXXXXQNQHYCYILSRRILS 206
           P + +D D+VE +            +N+ +CY L + +LS
Sbjct: 122 PKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  124 bits (310), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 69/169 (40%), Positives = 91/169 (53%), Gaps = 26/169 (15%)

Query: 27  LGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIYAQGLAKVHRPTL 86
           +GVE+ LGITI NKC G YGIL L  GH L+F QWVLY  S+  L +Y+ GL  V++P L
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 87  YTFSQVFIFFSVDTLLTCAFTVYFTHEWFAANTT--TRPPAA------------------ 126
            T++ V + F+ DTL+TC FT++F+  WFAA  +  + P +A                  
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPSSATQQTSGGISSGSKLLTAR 120

Query: 127 ------QGASDAYEYXXXXXXXXXXXXXRLYFNFIVGSFLQELFFRPAY 169
                 Q AS A EY             R YFNFI+ +F+Q LF  P Y
Sbjct: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKY 169

>Kpol_1050.48 s1050 (104245..110325) [6081 bp, 2026 aa] {ON}
            (104245..110325) [6081 nt, 2027 aa]
          Length = 2026

 Score = 31.6 bits (70), Expect = 1.8,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 3/60 (5%)

Query: 58   FAQWVLYTWSIVCLAIYAQGLAKVHRPTLYTF---SQVFIFFSVDTLLTCAFTVYFTHEW 114
            F   VLY   I  LAI  +G   +H P    F   + VF+F    T+ +  F +YF   W
Sbjct: 1512 FIHLVLYAHVICLLAISYRGNDLIHTPATNYFMFSTLVFLFNECLTIYSYGFKLYFRKAW 1571

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.142    0.459 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,291,729
Number of extensions: 647823
Number of successful extensions: 1227
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1223
Number of HSP's successfully gapped: 27
Length of query: 206
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 102
Effective length of database: 41,556,135
Effective search space: 4238725770
Effective search space used: 4238725770
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 63 (28.9 bits)