Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A054501.83ON60660628270.0
YEL063C (CAN1)1.83ON59061819140.0
Smik_5.241.83ON59061218900.0
NDAI0A006101.83ON56552118860.0
Skud_5.261.83ON59056318860.0
Suva_5.41.83ON59052318690.0
KNAG0C007901.83ON57956218260.0
TPHA0B044801.83ON60360818260.0
NCAS0B085701.83ON53252218060.0
TDEL0C061801.83ON58351417980.0
Kpol_2000.651.83ON59555017970.0
CAGL0J08184g1.83ON57251317380.0
SAKL0C02684gsingletonON58856717390.0
KLLA0C02343g1.83ON58151917330.0
SAKL0C02662g1.83ON54851917030.0
Kwal_33.134011.83ON55950716650.0
NCAS0A006001.83ON54451416560.0
SAKL0C02640gsingletonON54851916520.0
KAFR0D007001.83ON57452716460.0
ZYRO0F16654g1.83ON58052616360.0
Skud_14.701.83ON57351116320.0
YNL270C (ALP1)1.83ON57351216310.0
Smik_14.671.83ON57351016280.0
TDEL0C061701.84ON57352116210.0
NDAI0F042001.83ON56652116170.0
KNAG0C05920singletonON59951216170.0
NDAI0F041901.84ON59951116140.0
Suva_14.731.83ON49747915990.0
TBLA0A054601.84ON60851116100.0
NCAS0A006101.84ON60760616090.0
TPHA0B044701.84ON59952015980.0
CAGL0J08162g1.84ON59751215950.0
Kpol_2000.641.84ON61052115920.0
KLTH0F02398g1.83ON55552115840.0
Smik_14.681.84ON61150815790.0
YNL268W (LYP1)1.84ON61151115750.0
SAKL0C02728g1.84ON56251415660.0
KLTH0F02420g1.84ON62151415630.0
Skud_14.711.84ON61251115590.0
KNAG0F004801.84ON59760015550.0
Kwal_33.134111.84ON56051715490.0
Suva_14.751.84ON61151115500.0
KAFR0D039401.83ON59761415420.0
Ecym_10881.84ON56752115370.0
Ecym_10871.83ON57060115260.0
KLLA0C02365g1.84ON57952014970.0
ZYRO0F16632g1.84ON60760414970.0
AFR667C1.84ON56358714250.0
AFR668W1.83ON55650914130.0
CAGL0A01199gna 1ON6134928411e-104
KAFR0B06430singletonON5934958241e-101
Kpol_358.3na 1ON5754938151e-100
SAKL0G14916gna 1ON5814927995e-98
TPHA0M00130singletonON6114858016e-98
Kwal_33.15545na 1ON5765327855e-96
TBLA0A07060na 1ON6254797861e-95
Skud_16.12na 1ON6074867806e-95
Smik_6.473na 1ON6064887762e-94
YPL265W (DIP5)na 1ON6084867763e-94
Suva_16.40na 1ON6064857737e-94
KNAG0L02470singletonON6384737741e-93
Ecym_2480na 1ON5864857701e-93
NCAS0D02260na 1ON5974907692e-93
KLLA0E16281gna 1ON6054777684e-93
NDAI0I02660na 1ON5944947632e-92
KLTH0B01166gna 1ON5774857593e-92
KNAG0L02460singletonON5884857518e-91
ZYRO0D17908gna 1ON5184897152e-86
Ecym_47895.158ON5885687151e-85
Kwal_26.69407.44ON5704837096e-85
AGR319W5.158ON6265727138e-85
Ecym_60211.244ON6005487055e-84
Kwal_33.154075.158ON5875527046e-84
Kwal_27.126811.244ON5934797046e-84
CAGL0E05632g7.44ON5984997012e-83
SAKL0C01232gsingletonON6134927004e-83
KNAG0C02140singletonON5984826994e-83
TDEL0A08030singletonON5144826925e-83
TDEL0C065101.50ON6424737007e-83
KNAG0E003907.44ON5995006951e-82
Skud_4.7841.50ON6635816982e-82
Smik_3.531.50ON6335776962e-82
Suva_8.4027.44ON6835316984e-82
Suva_3.1891.50ON6335816954e-82
SAKL0G14014g5.158ON6054826934e-82
YOR348C (PUT4)7.44ON6275616944e-82
Skud_3.381.50ON6335756911e-81
TDEL0C00930singletonON5955506891e-81
Suva_4.3073.284ON6095686891e-81
KLTH0D01474g7.44ON6244836901e-81
YBR068C (BAP2)3.284ON6095686891e-81
YCL025C (AGP1)1.50ON6335776892e-81
TPHA0H028507.44ON6014906872e-81
Suva_2.716singletonON6035546863e-81
TPHA0B010901.244ON6064836864e-81
ACL135Wna 1ON5884926845e-81
Smik_4.7901.50ON6634716895e-81
SAKL0F09790gsingletonON5585256808e-81
KLTH0B02046g5.158ON5894986811e-80
TDEL0H040707.44ON5774816801e-80
Smik_15.5327.44ON6315266832e-80
CAGL0B01012g1.50ON6234706832e-80
TBLA0A05190na 2ON6675796852e-80
Smik_2.2013.284ON6094776794e-80
NDAI0B052201.244ON6114756794e-80
KAFR0A011203.284ON5925636775e-80
NCAS0A106803.284ON5935246767e-80
KLTH0E15642g1.244ON5964796777e-80
SAKL0D00836gna 3ON6014806761e-79
Skud_15.5157.44ON6265626771e-79
ZYRO0D03762g1.244ON6004426742e-79
CAGL0K05753g1.50ON6604836782e-79
Kpol_543.791.244ON6054826742e-79
TBLA0G031203.284ON6734856782e-79
Ecym_26643.285ON5755006713e-79
KLLA0A11770g5.158ON5814786704e-79
NDAI0E038007.44ON6214886734e-79
Skud_11.2751.244ON6024816724e-79
Suva_2.6881.50ON6614716755e-79
SAKL0C01650g1.50ON6134926725e-79
YDR508C (GNP1)1.50ON6634716731e-78
CAGL0B03773g5.158ON6055466681e-78
Smik_11.3021.244ON5535636633e-78
YKR039W (GAP1)1.244ON6024816663e-78
AFR156W7.44ON5585286623e-78
Skud_2.1913.284ON6094546663e-78
TBLA0A051801.50ON6766026704e-78
NCAS0A071105.158ON5925236635e-78
CAGL0H08393g3.284ON6124896631e-77
Kpol_543.78singletonON6054956621e-77
NDAI0A006401.50ON6414836641e-77
NDAI0A056203.284ON5715196591e-77
Kwal_23.4026singletonON5344626561e-77
Smik_13.1singletonON5234886552e-77
KAFR0D00520na 2ON5984796602e-77
Suva_2.2033.284ON6045636602e-77
Ecym_80357.44ON5634786572e-77
Ecym_10561.50ON6064756584e-77
NCAS0E022607.44ON5934896575e-77
YDR046C (BAP3)3.284ON6044926575e-77
NCAS0B085801.50ON6275646596e-77
Kwal_33.132041.50ON6074816577e-77
TPHA0E036601.50ON6475786598e-77
KAFR0D04120na 2ON6484696598e-77
KAFR0C051607.44ON5845266548e-77
AFR698C1.50ON6094776561e-76
YFL055W (AGP3)na 4ON5585146511e-76
KNAG0G009005.158ON6134896551e-76
CAGL0L03267g1.244ON5974836541e-76
NCAS0J00140na 4ON5584896502e-76
TDEL0F02830na 5ON5614876502e-76
KAFR0E018505.158ON5604836502e-76
Skud_6.2na 4ON5585146492e-76
Smik_16.1155.158ON6035356532e-76
NDAI0D021605.158ON5874906513e-76
Smik_4.2843.284ON6044756514e-76
NCAS0I015303.284ON5954856505e-76
KLTH0C05170g3.284ON5984776506e-76
TBLA0B077605.158ON6585236521e-75
Kpol_367.77.44ON5844946471e-75
Suva_7.4855.158ON6034956462e-75
AGR039Cna 6ON5864946452e-75
KLTH0F01606gna 2ON6044846462e-75
KAFR0D005001.50ON6174976463e-75
KAFR0D00510na 7ON6174766454e-75
Suva_11.2731.244ON6014876444e-75
Kpol_2000.921.50ON6375736464e-75
SAKL0B10956g7.44ON5724876424e-75
NDAI0A074903.284ON5964876436e-75
CAGL0M00154gsingletonON5505086396e-75
NCAS0B079001.244ON6194836446e-75
Skud_7.5255.158ON6035206427e-75
SAKL0D02970g3.284ON6015756411e-74
YGR191W (HIP1)5.158ON6034886401e-74
Skud_4.3003.284ON6045636392e-74
KNAG0H011503.284ON6174696402e-74
Kwal_33.14276na 3ON5964816383e-74
KLLA0F27093gsingletonON5634726336e-74
TPHA0A047005.158ON5694786337e-74
Ecym_2663na 6ON5894846347e-74
TPHA0A002405.158ON6034856358e-74
Kpol_1010.325.158ON5995156359e-74
ZYRO0G07172gna 5ON5674756321e-73
KLTH0F01584g1.50ON5964936331e-73
SAKL0D02948gna 6ON5944876332e-73
NDAI0G060301.368ON5995616332e-73
NCAS0D018705.158ON5954976322e-73
AGR038C3.284ON5804976303e-73
KLLA0A06886gsingletonON5875676303e-73
NCAS0A004201.50ON6794836355e-73
KAFR0D04130na 7ON6445636325e-73
KNAG0J022003.284ON6074596296e-73
KLTH0B00154gna 8ON5564816267e-73
ZYRO0F17446g1.50ON6334816301e-72
TBLA0C01240singletonON6294906291e-72
SAKL0D04664g1.244ON5934756271e-72
Kwal_27.105383.284ON6025786271e-72
Kwal_8.590na 8ON6295896282e-72
Kwal_26.9612singletonON5434546212e-72
TDEL0E05750singletonON5484806212e-72
KNAG0F002701.50ON6344826272e-72
KAFR0D041401.50ON6375356263e-72
SAKL0A09724gna 9ON5514856195e-72
KLLA0C01606g1.50ON6204816221e-71
SAKL0C13992gsingletonON5524616161e-71
NDAI0C029505.158ON6094876202e-71
NDAI0A01340singletonON5544896162e-71
Kpol_2002.441.50ON6274776202e-71
KLLA0F23419g7.44ON5734836144e-71
Ecym_26623.284ON5895076154e-71
Smik_2.2023.285ON6175816158e-71
Suva_4.3083.285ON6184886131e-70
KNAG0L00110na 4ON5714916102e-70
YOL020W (TAT2)1.368ON5924836112e-70
AGR040C3.285ON5734836092e-70
TBLA0I020103.285ON6284916123e-70
Skud_2.1923.285ON6194886114e-70
Smik_6.482na 10ON5585026064e-70
SAKL0D02926g3.285ON5835026085e-70
Skud_15.1381.368ON5924846077e-70
AFR230C1.244ON6044836061e-69
TPHA0M012003.284ON6074836061e-69
Ecym_8297na 11ON5694986032e-69
AEL030W1.368ON5824846032e-69
ZYRO0A00308gsingletonON5644755996e-69
KAFR0F02250singletonON5545155952e-68
KLLA0A06930g1.244ON5875675972e-68
KLTH0H13398g1.368ON5874455962e-68
KAFR0C004003.284ON5824805962e-68
ADL272Wna 11ON5644785943e-68
KLTH0F04048gsingletonON5835215963e-68
KNAG0C005901.50ON6344825974e-68
Suva_15.1481.368ON5924835954e-68
Suva_13.517singletonON5474825925e-68
Kwal_33.13215na 2ON5984845955e-68
Smik_15.1461.368ON5934835945e-68
NDAI0F043901.50ON6674795987e-68
Ecym_27161.368ON5925755938e-68
NCAS0A089201.368ON5994835939e-68
KLLA0B14685gna 12ON5714825901e-67
Skud_16.2na 10ON4964615842e-67
Kwal_23.2817na 12ON5805035892e-67
SAKL0F16544gsingletonON5674855873e-67
KLTH0A00308gsingletonON5414805853e-67
KNAG0J022103.285ON5815015875e-67
Kpol_1065.133.284ON5964895842e-66
SAKL0H08184gna 11ON5984895842e-66
CAGL0D02178g1.368ON5774825795e-66
ZYRO0C18502g7.44ON5754825796e-66
ZYRO0G12342g3.284ON6204835809e-66
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A05450
         (606 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...  1093   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   741   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   732   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   731   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   731   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   724   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              707   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   707   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            700   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   697   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   696   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   674   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   674   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   672   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   660   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   645   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   642   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   640   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   638   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   634   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   633   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   632   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   631   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   629   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            627   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            627   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   626   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   620   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   624   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              624   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   620   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   619   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   617   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   614   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   612   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   611   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   607   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   606   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   605   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                603   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   601   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   601   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   598   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   596   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   592   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   581   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   581   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   553   0.0  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   548   0.0  
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   328   e-104
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   322   e-101
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   318   e-100
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   312   5e-98
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     313   6e-98
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   306   5e-96
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   307   1e-95
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   305   6e-95
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   303   2e-94
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   303   3e-94
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   302   7e-94
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             302   1e-93
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   301   1e-93
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              300   2e-93
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   300   4e-93
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   298   2e-92
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   296   3e-92
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             293   8e-91
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   280   2e-86
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   280   1e-85
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   277   6e-85
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   279   8e-85
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   276   5e-84
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   275   6e-84
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   275   6e-84
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   274   2e-83
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   274   4e-83
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   273   4e-83
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            271   5e-83
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   274   7e-83
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   272   1e-82
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   273   2e-82
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   272   2e-82
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   273   4e-82
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   272   4e-82
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   271   4e-82
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   271   4e-82
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   270   1e-81
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   270   1e-81
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   270   1e-81
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   270   1e-81
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   270   1e-81
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   270   2e-81
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   269   2e-81
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   268   3e-81
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   268   4e-81
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   268   5e-81
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   270   5e-81
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   266   8e-81
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   266   1e-80
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   266   1e-80
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   267   2e-80
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   267   2e-80
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   268   2e-80
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   266   4e-80
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   266   4e-80
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   265   5e-80
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   265   7e-80
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   265   7e-80
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   265   1e-79
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   265   1e-79
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   264   2e-79
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   265   2e-79
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   264   2e-79
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              265   2e-79
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   263   3e-79
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   262   4e-79
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     263   4e-79
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   263   4e-79
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   264   5e-79
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   263   5e-79
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   263   1e-78
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   261   1e-78
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   259   3e-78
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   261   3e-78
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   259   3e-78
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   261   3e-78
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   262   4e-78
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   259   5e-78
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   259   1e-77
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   259   1e-77
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   260   1e-77
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            258   1e-77
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   257   1e-77
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    256   2e-77
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   258   2e-77
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   258   2e-77
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   257   2e-77
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   258   4e-77
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     257   5e-77
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   257   5e-77
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   258   6e-77
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   257   7e-77
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   258   8e-77
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   258   8e-77
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   256   8e-77
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   257   1e-76
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   255   1e-76
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   256   1e-76
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   256   1e-76
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      254   2e-76
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   254   2e-76
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   254   2e-76
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      254   2e-76
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   256   2e-76
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    255   3e-76
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   255   4e-76
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              254   5e-76
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   254   6e-76
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   255   1e-75
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   253   1e-75
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   253   2e-75
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   253   2e-75
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   253   2e-75
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      253   3e-75
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      253   4e-75
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   252   4e-75
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   253   4e-75
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   251   4e-75
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   252   6e-75
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   250   6e-75
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   252   6e-75
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   251   7e-75
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   251   1e-74
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   251   1e-74
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   250   2e-74
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              251   2e-74
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   250   3e-74
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   248   6e-74
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   248   7e-74
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   248   7e-74
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   249   8e-74
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   249   9e-74
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   248   1e-73
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   248   1e-73
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   248   2e-73
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   248   2e-73
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   248   2e-73
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   247   3e-73
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   247   3e-73
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   249   5e-73
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              248   5e-73
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   246   6e-73
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   245   7e-73
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   247   1e-72
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   246   1e-72
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   246   1e-72
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   246   1e-72
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   246   2e-72
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   243   2e-72
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            243   2e-72
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   246   2e-72
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              245   3e-72
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   243   5e-72
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   244   1e-71
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   241   1e-71
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    243   2e-71
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              241   2e-71
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   243   2e-71
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   241   4e-71
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   241   4e-71
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   241   8e-71
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   240   1e-70
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   239   2e-70
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   239   2e-70
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   239   2e-70
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   240   3e-70
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   239   4e-70
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   238   4e-70
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   238   5e-70
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   238   7e-70
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   238   1e-69
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   238   1e-69
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   236   2e-69
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   236   2e-69
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   235   6e-69
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              233   2e-68
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   234   2e-68
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   234   2e-68
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                234   2e-68
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   233   3e-68
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   234   3e-68
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   234   4e-68
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   233   4e-68
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   232   5e-68
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   233   5e-68
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   233   5e-68
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   234   7e-68
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   233   8e-68
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   233   9e-68
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   231   1e-67
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   229   2e-67
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   231   2e-67
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   230   3e-67
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   229   3e-67
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   230   5e-67
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   229   2e-66
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   229   2e-66
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   227   5e-66
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   227   6e-66
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   228   9e-66
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   225   2e-65
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   225   3e-65
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   226   4e-65
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              225   6e-65
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   223   5e-64
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   222   8e-64
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   220   9e-64
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   219   1e-63
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   221   1e-63
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   219   1e-63
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   221   2e-63
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                217   4e-62
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   219   4e-62
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   217   6e-62
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   215   8e-62
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              216   2e-61
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   215   2e-61
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   214   7e-61
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   213   2e-60
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   209   1e-59
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   207   2e-58
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              207   2e-58
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   206   2e-58
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   206   3e-58
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   205   8e-58
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   210   8e-58
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      205   8e-58
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   205   8e-58
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   204   2e-57
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   203   3e-57
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   207   5e-57
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   203   6e-57
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   202   1e-56
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   202   1e-56
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   201   3e-56
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    201   3e-56
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   200   5e-56
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   200   6e-56
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   199   1e-55
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   199   3e-55
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   199   3e-55
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                198   3e-55
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   198   3e-55
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   197   6e-55
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   201   7e-55
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   201   9e-55
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   197   1e-54
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   197   1e-54
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   200   2e-54
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   193   4e-54
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   194   8e-54
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   198   8e-54
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   193   2e-53
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   193   2e-53
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   193   2e-53
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   192   3e-53
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   193   3e-53
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   194   2e-52
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   194   2e-52
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   190   3e-52
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   189   1e-51
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   188   1e-51
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   192   1e-51
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   186   3e-51
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   191   4e-51
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                186   6e-51
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   189   7e-51
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   186   9e-51
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   189   1e-50
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   185   2e-50
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   184   2e-50
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   185   2e-50
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   184   4e-50
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   184   4e-50
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   187   5e-50
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   187   8e-50
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   183   8e-50
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   186   1e-49
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   186   2e-49
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   184   5e-49
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   179   3e-48
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   180   1e-47
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   174   2e-46
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   173   2e-45
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     160   1e-43
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     160   2e-43
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   167   5e-43
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         117   3e-28
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   110   6e-27
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      92   4e-20
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     91   3e-19
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          88   3e-19
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    79   3e-16
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      72   7e-15
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          70   3e-13
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    62   5e-10
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      49   5e-06
Smik_6.7 Chr6 (9124..9204,9208..9294,9405..9470,9474..9617,9624....    39   0.044
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    33   3.0  
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    32   3.6  
KLTH0F19404g Chr6 complement(1571210..1573618) [2409 bp, 802 aa]...    32   5.2  
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    32   5.8  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...    32   6.7  
KLTH0D17732g Chr4 complement(1473689..1475344) [1656 bp, 551 aa]...    32   7.5  

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score = 1093 bits (2827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/606 (89%), Positives = 544/606 (89%)

Query: 1   MDNKDNASIELHSYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKS 60
           MDNKDNASIELHSYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKS
Sbjct: 1   MDNKDNASIELHSYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKS 60

Query: 61  DEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXX 120
           DEDATLTKASKRHVR            EEDIDATGVVEEAQVKRELKPRH          
Sbjct: 61  DEDATLTKASKRHVRASSVSTASSSIAEEDIDATGVVEEAQVKRELKPRHIGMIALGGTI 120

Query: 121 XXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVS 180
                     PIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVS
Sbjct: 121 GTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVS 180

Query: 181 DPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKV 240
           DPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKV
Sbjct: 181 DPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKV 240

Query: 241 YGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPGPWGPGIISKDKNEAR 300
           YGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPGPWGPGIISKDKNEAR
Sbjct: 241 YGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPGPWGPGIISKDKNEAR 300

Query: 301 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXX 360
           FLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVR               
Sbjct: 301 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRILLFYILSLFFIGLL 360

Query: 361 VPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILY 420
           VPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILY
Sbjct: 361 VPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILY 420

Query: 421 GLSSAKLAPKFFQKTRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFA 480
           GLSSAKLAPKFFQKTRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFA
Sbjct: 421 GLSSAKLAPKFFQKTRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFA 480

Query: 481 WLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFD 540
           WLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFD
Sbjct: 481 WLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFD 540

Query: 541 STAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXXXXXXXXXXXXXXIWEEGPQTFWDK 600
           STAFLTAYISCFLFLFIYIVAQCYFRTRLWRTL               IWEEGPQTFWDK
Sbjct: 541 STAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLDDVDIDTDRRDIDTVIWEEGPQTFWDK 600

Query: 601 FWAVIA 606
           FWAVIA
Sbjct: 601 FWAVIA 606

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/618 (63%), Positives = 443/618 (71%), Gaps = 43/618 (6%)

Query: 2   DNKDNASIE-LHSYHESLETQ----EASSWDKK-----LKDKVRNEWARDRRFLHRHRGS 51
           ++K++A IE  H Y+E + T     EAS    +     LKD+   E    R F  R  G 
Sbjct: 3   NSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGE 62

Query: 52  EG-EVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRH 110
           +   +E    DED                               G V+ A+VKRELK RH
Sbjct: 63  DTFSMEDGIGDEDE------------------------------GEVQNAEVKRELKQRH 92

Query: 111 XXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSS 170
                               P+ NAGPVG+LI+Y+FMG+L +SVTQSLGEMATFIPVTSS
Sbjct: 93  IGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSS 152

Query: 171 FTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLI 230
           FTVF+ RF+S  FGAA GYMYWFSWAITFALELSVVGQVI+FWT+KVPLAAWISIFWV+I
Sbjct: 153 FTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVII 212

Query: 231 VIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPGPWGPG 290
            IMN FPVK YGEFEFWVASIKV+AIIGF+IYC CMVCGAG+TGPVGFRYWR+PG WGPG
Sbjct: 213 TIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPG 272

Query: 291 IISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXX 350
           IISKDKNE RFLGWVSSLINAAFT+QGTELVGITAGEAANPRKSVPRAIKKV  R     
Sbjct: 273 IISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFY 332

Query: 351 XXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANS 410
                     VPYNDPKL+ + SYVS SPFIIAI+NSGTKVLPHIFNAVILTTIISAANS
Sbjct: 333 IGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANS 392

Query: 411 NVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWL 469
           N+YVGSRIL+GLS  KLAPKF  + T+ GVP+IAV  TAAFGALAYMETS GG   F WL
Sbjct: 393 NIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWL 452

Query: 470 LNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILI 529
           LNITGVAGFFAWL ISISHIRFMQ LK+RG+SRD+LP+KA LMPGLAYY A F+T+II+I
Sbjct: 453 LNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIII 512

Query: 530 QGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXXXXXXXXXXXXXXI 589
           QGFTAFAPKF+  +F  AYIS FLFL ++I+ QC FR R    +               +
Sbjct: 513 QGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDVDIDSDRRDIEAIV 572

Query: 590 WEEG-PQTFWDKFWAVIA 606
           WE+  P+TFWDKFW V+A
Sbjct: 573 WEDHEPKTFWDKFWNVVA 590

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/612 (63%), Positives = 436/612 (71%), Gaps = 31/612 (5%)

Query: 2   DNKDNASIE-LHSYHESLETQ----EASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVE 56
           D K N  IE  H Y+E + T     EAS                     HR RGS   ++
Sbjct: 3   DPKQNTEIEEKHMYNEPVTTLFHDVEASQ-------------------THRRRGSL-PLK 42

Query: 57  YAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXX 116
             K+ E   L   S R V             +ED    G V  A+VKRELK RH      
Sbjct: 43  DEKNKELYPLHSFSTR-VDGEDTFSMGDVIRDED---QGEVRNAEVKRELKQRHIGMIAL 98

Query: 117 XXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFAS 176
                         P+ NAGPVG+LI+Y+FMG+L +SVTQSLGEMATFIPVTSSFTVF+ 
Sbjct: 99  GGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQ 158

Query: 177 RFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFF 236
           RF+S  FGAA GYMYWFSWAITFALELSVVGQVIEFWT KVPLAAWISIFWV+I IMN F
Sbjct: 159 RFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTNKVPLAAWISIFWVIITIMNLF 218

Query: 237 PVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPGPWGPGIISKDK 296
           PVK YGEFEFWVASIKV+AIIGF+IYC CMVCGAG+TGPVGFRYWR+PG WGPGIISKDK
Sbjct: 219 PVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDK 278

Query: 297 NEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXX 356
           NE RFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VPRAIKKV  R           
Sbjct: 279 NEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLF 338

Query: 357 XXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGS 416
               VPYNDPKL++  SYVS SPFIIAI+NSGTKVLPHIFNAVILTTIISAANSN+YVGS
Sbjct: 339 IGLLVPYNDPKLTTATSYVSVSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGS 398

Query: 417 RILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGV 475
           RIL+GLS  KLAPKF  + T+ GVP+IAV  TA FGALAYMETS GG   F WLLNITGV
Sbjct: 399 RILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGALAYMETSTGGDKVFEWLLNITGV 458

Query: 476 AGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAF 535
           AGFFAWL ISISHIRFMQ LK+RG+SRD+LP+KA LMPGLAY+ A F+ +IILIQGFTAF
Sbjct: 459 AGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMPGLAYFAATFMIIIILIQGFTAF 518

Query: 536 APKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXXXXXXXXXXXXXXIWEEG-P 594
           APKFD   FL AYIS FLFL I+I+ +  FR R    +               +WE+  P
Sbjct: 519 APKFDGIDFLAAYISIFLFLAIWILFEIIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEP 578

Query: 595 QTFWDKFWAVIA 606
           +TFWDKFW V+A
Sbjct: 579 KTFWDKFWNVVA 590

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/521 (69%), Positives = 417/521 (80%), Gaps = 3/521 (0%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           EE+I A G + EA+VKRELK RH                    P+ NAGPVG+LIAY+FM
Sbjct: 46  EEEI-ANGQIREAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFM 104

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           GTLV+SVTQSLGEMATFIPVTSSFTVF+ RF+S  FGAA GYMYWFSWAITFALELSVVG
Sbjct: 105 GTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVG 164

Query: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
           Q+I+FWT  VP+ AWISIFWVL+V MN FPV+ YGEFEFWVASIKV+AI+GF+IYCLCMV
Sbjct: 165 QIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMV 224

Query: 268 CGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGE 327
           CGAG+TGPVGFRYWR+PGP GPGII+K+ NEA+FLGWVSSLINAAFTYQGTELVGITAGE
Sbjct: 225 CGAGVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGE 284

Query: 328 AANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNS 387
           AANPRKSVPRAIKKV  R               VPYNDPKL+S DSYV+ASPFII+IQNS
Sbjct: 285 AANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNS 344

Query: 388 GTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLF 446
           GT +LPHIFNAVIL+TIISAANSNVYVGSRI++GLS +KLAP+   +T +NGVP+++V+F
Sbjct: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404

Query: 447 TAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLP 506
           T  FGALAYMETS GG+ AFNWLLNITGVAGFF+WL ISISH+RFMQ L++RG+SRDDLP
Sbjct: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464

Query: 507 YKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
           +KA  MPGLAYY  FF+TLII+IQGFT+F P FD   FL AYISCFLF+ I+IV Q +FR
Sbjct: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFR 524

Query: 567 TRLWRTLXXXXXXXXXXXXXXXIWEEGPQ-TFWDKFWAVIA 606
            RL   +               +WE+ P  TFWDKFW V+A
Sbjct: 525 CRLIWKIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/563 (67%), Positives = 426/563 (75%), Gaps = 7/563 (1%)

Query: 46  HRHRGSEGEVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRE 105
           HR RGS   ++  KS E   L ++    V             +ED    G V+ A+VKRE
Sbjct: 33  HRRRGSL-SLKDEKSKELYPL-RSFPTGVNGQDTFSMEENLQDED---EGEVQNAEVKRE 87

Query: 106 LKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFI 165
           LK RH                    P+ NAGPVG+LIAY+FMG+L FSVTQSLGEMATFI
Sbjct: 88  LKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFSVTQSLGEMATFI 147

Query: 166 PVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISI 225
           PVTSSFTVF+ RF+S  FGAA GYMYWFSWAITFALELSVVGQVI+FWT KVPLAAWISI
Sbjct: 148 PVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWISI 207

Query: 226 FWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPG 285
           FWVLI IMN FPVK YGEFEFWVASIKVIAIIGF+IYC CMVCGAG+TGPVGFRYWR+PG
Sbjct: 208 FWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPG 267

Query: 286 PWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVR 345
            WGPGIISK+KNE RFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VPRAIKKV  R
Sbjct: 268 AWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFR 327

Query: 346 XXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTII 405
                          VPYNDPKL+   SYVS SPFI+AIQNSGTKVLPHIFNAVILTTII
Sbjct: 328 ILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQNSGTKVLPHIFNAVILTTII 387

Query: 406 SAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQN 464
           SAANSN+YVGSRIL+GLS  KLAPKF  +T + GVP+IAV  TA FGALAYMETS GG  
Sbjct: 388 SAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETSTGGDK 447

Query: 465 AFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVT 524
            F WLLNITGVAGFFAWL ISISHIRFMQ LK+RG+SRD+LP+KA LMPGLAYY +FF+ 
Sbjct: 448 VFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSSFFMI 507

Query: 525 LIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXXXXXXXXXX 584
           +II+IQGFTAFAPKF+ ++FL AYIS FLF+ ++I+ +C FR R    +           
Sbjct: 508 IIIIIQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFIWKIEDVDIDSDRRD 567

Query: 585 XXXXIWEEG-PQTFWDKFWAVIA 606
               +WE+  P+TFWDKFW V+A
Sbjct: 568 IEAIVWEDHEPKTFWDKFWNVVA 590

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/523 (69%), Positives = 409/523 (78%), Gaps = 4/523 (0%)

Query: 88  EEDI--DATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYI 145
           EEDI  +  G V+ A+VKRELK RH                    P+ NAGPVG+LI+Y+
Sbjct: 68  EEDIQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYL 127

Query: 146 FMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSV 205
           FMG+L +SVTQSLGEMATFIPVTSSFTVF+ RF+S  FGAA GYMYWFSWA+TFALELSV
Sbjct: 128 FMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSV 187

Query: 206 VGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLC 265
           VGQVI+FWT+ VPLAAWISIFWV+I  MN FPVK YGEFEFWVASIKVIAIIGF+IYC C
Sbjct: 188 VGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247

Query: 266 MVCGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITA 325
           MVCGAG+TGPVGFRYWR+PG WGPGIISK+KNEARFLGWVSSLINAAFT+QGTELVGITA
Sbjct: 248 MVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITA 307

Query: 326 GEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQ 385
           GEAANPRK+VPRAIKKV  R               VPYNDPKL+S  SYVS SPFIIAI+
Sbjct: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIE 367

Query: 386 NSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAV 444
           NSGTKVLPHIFNAVILTTIISAANSN+YVGSR+L+GLS +KLAPKFF K T+ GVP+IAV
Sbjct: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAV 427

Query: 445 LFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDD 504
             T+ FGALAYMETS GG   F WLLNITGVAGFFAWL IS+SHIRFMQ LK+RG+SRD+
Sbjct: 428 FATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDE 487

Query: 505 LPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCY 564
           LP+KA LMPGLAYY  FF+ +IILIQGFT+F P F+   FL AYIS FLFL I+I+ +  
Sbjct: 488 LPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELI 547

Query: 565 FRTRLWRTLXXXXXXXXXXXXXXXIWEE-GPQTFWDKFWAVIA 606
           FR R    +               +WEE  P+T WDKFW V+ 
Sbjct: 548 FRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/562 (63%), Positives = 412/562 (73%), Gaps = 2/562 (0%)

Query: 47  RHRGSEGEVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKREL 106
           RHR    E+   K     + T   +                 E  + TG V +A+VKREL
Sbjct: 18  RHRKKAEEMRETKLAAVTSYTSLGESRADIRHRMSFESGEDGESEEQTGYVHDAEVKREL 77

Query: 107 KPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIP 166
           K RH                    P++ AGPVG+LI+YIFMGTLV+SVTQSLGEMATFIP
Sbjct: 78  KQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQSLGEMATFIP 137

Query: 167 VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIF 226
           VTSSFTVFA RF+S   GAA GYMYWFSWA+TFALELSV+GQVI++WT+ VPLAAWISIF
Sbjct: 138 VTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYAVPLAAWISIF 197

Query: 227 WVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPGP 286
           WV+I   N FPVK YGE EFW+A IKVIAI+GF++YCLCMVCGAG+TGPVGFRYWR+PGP
Sbjct: 198 WVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTGPVGFRYWRNPGP 257

Query: 287 WGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRX 346
           WGPGIISKDKNEARFLGWVSSLIN AFTYQGTELVGI+AGEAANPRK+VPRAIKKV  R 
Sbjct: 258 WGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVPRAIKKVVFRI 317

Query: 347 XXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIIS 406
                         VPYND  L++TDSYV++SPFIIAI+NSGT VLPHIFNAVI  TI+S
Sbjct: 318 LFFYIGSLFFIGLLVPYNDDALNNTDSYVASSPFIIAIKNSGTPVLPHIFNAVIACTIVS 377

Query: 407 AANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNA 465
           A NSNVYVGSRIL+GLS  KLAPK   + T+ GVP+IAVL T+  GALAYMETS GGQNA
Sbjct: 378 AGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGALAYMETSTGGQNA 437

Query: 466 FNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTL 525
           FNWLLNIT VAGFF WL IS+SHIRFMQ LK+RG+SRDDLP+KAALMPGLAYY +F + +
Sbjct: 438 FNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMPGLAYYASFLMFV 497

Query: 526 IILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXXXXXXXXXXX 585
           II+IQGFTAFAPKF  + F  AYIS FLF+ I+ + Q  FR R    +            
Sbjct: 498 IIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKVEDVDIDTDRRDI 557

Query: 586 XXXIWEEG-PQTFWDKFWAVIA 606
              +WE+  P+T WDKFW +IA
Sbjct: 558 EAVVWEDAEPKTVWDKFWNIIA 579

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/608 (60%), Positives = 444/608 (73%), Gaps = 7/608 (1%)

Query: 1   MDNKDNASIELHSYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKS 60
           M  KD +  EL SY  S     AS  +K    K + +       L + +     +  +++
Sbjct: 1   MSQKDLSQYELQSY-TSNNRSSASEMNKGSDAKEKVDVISSSGSLSKRK----RINRSRA 55

Query: 61  DEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXX 120
           + ++ L  ++                 ++     GVV+EA+VKR+LK RH          
Sbjct: 56  NSNSDLEGSAADGTARARDIDNADVDDDDYYMDEGVVKEAEVKRQLKQRHIGMIALGGTI 115

Query: 121 XXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVS 180
                     P+ NAGPVG+LIAY+FM T+VFSVTQSLGEMATFIPVTSSFTVF+SRF+S
Sbjct: 116 GTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRFLS 175

Query: 181 DPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKV 240
              GAA GYMYWFSWA+TFALELSVVGQ+I+FWT  VPL+AWI I+WV++ IMN FPVK 
Sbjct: 176 PAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHAVPLSAWIVIWWVILTIMNLFPVKF 235

Query: 241 YGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPGPWGPGIISKDKNEAR 300
           YGEFEFWVASIKV+AIIGF+IYCLCMVCGAG+TGPVGFRYWR+PGPWGPGIISKD NE R
Sbjct: 236 YGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISKDVNEGR 295

Query: 301 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXX 360
           FLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPRAIKKV+ R               
Sbjct: 296 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVTFRILIFYILSLFFIGLL 355

Query: 361 VPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILY 420
           VPY+D KL+STDSY+SASPFIIAI+NSGTK+LPHIFNAVIL+TIISA NSNVYVGSRIL+
Sbjct: 356 VPYDDEKLTSTDSYISASPFIIAIENSGTKILPHIFNAVILSTIISAGNSNVYVGSRILF 415

Query: 421 GLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFF 479
           GL+  KLAPK+F  T R GVP+ +V FT++FGALA++E S+GG  AFNWLLNI  VAGFF
Sbjct: 416 GLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGALAFLEVSSGGAKAFNWLLNIISVAGFF 475

Query: 480 AWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKF 539
           AWL ISI+H+RFMQ LKHRG+SRDDLP+KA  MP LAYY  FF+T+II+IQGFTAFAP F
Sbjct: 476 AWLLISIAHVRFMQALKHRGISRDDLPFKARFMPHLAYYSIFFMTIIIIIQGFTAFAPTF 535

Query: 540 DSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXXXXXXXXXXXXXXIWEE-GPQTFW 598
           + + F+ AYIS FLF F+++  Q YFR++L  T+               IWE+ GP+TFW
Sbjct: 536 NGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWTVEEVDIDTDRRDVDAIIWEDSGPKTFW 595

Query: 599 DKFWAVIA 606
           DKFW V+A
Sbjct: 596 DKFWDVVA 603

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/522 (68%), Positives = 406/522 (77%), Gaps = 4/522 (0%)

Query: 88  EEDIDATGV-VEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIF 146
           +E+I    V VE   V+RELK RH                    P+ NAGPVG+LIAY+F
Sbjct: 12  KEEIREISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLF 71

Query: 147 MGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVV 206
           M TL +SVTQSLGEMATFIPVTSSFTVF+ RFVS  FGAA GYMYWFSW ITFALELSVV
Sbjct: 72  MATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVV 131

Query: 207 GQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM 266
           GQVI+FWTF VPLAAWISIFWVL+  MN FPVK YGEFEFWVA +KV+AI+GF+IYC CM
Sbjct: 132 GQVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCM 191

Query: 267 VCGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAG 326
           VCGAG+TGPVGFRYWRHPG +GPGII+KDKN+ARFLGWVSSLINAAFT+QGTELVGITAG
Sbjct: 192 VCGAGVTGPVGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAG 251

Query: 327 EAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQN 386
           EAANPRK+VPRAIKKV  R               VPY+D KL+STDSYVSASPFIIAI+N
Sbjct: 252 EAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYVSASPFIIAIEN 311

Query: 387 SGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVL 445
           SGT VLPHIFNAVI+ TIISA NSN+YVGSRI+YGLS+++LAP    + T++GVP++AVL
Sbjct: 312 SGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVL 371

Query: 446 FTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDL 505
            T+ FGALAYMETS GGQ AFNWLLNITGVAGFF WL IS+SHIRFMQ L+ RG+SRDDL
Sbjct: 372 VTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDL 431

Query: 506 PYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYF 565
           P+KA  MPGLAYYG FF+TLII+IQGFT+F P ++   FLTAYIS F+F+ I+I  Q +F
Sbjct: 432 PFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWF 490

Query: 566 RTRL-WRTLXXXXXXXXXXXXXXXIWEEGPQTFWDKFWAVIA 606
           R RL WR                   E+ P+ FWDKFW V+A
Sbjct: 491 RCRLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/514 (69%), Positives = 400/514 (77%), Gaps = 2/514 (0%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G V EA+VKR LK RH                    P+ NAGPVG LIAY+FM TLV+SV
Sbjct: 70  GQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYSV 129

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
            QSLGEMATFIPVTS+FTVF+SRF+S  FGAA GYMYWFSWAITFALELSVVGQ+IEFWT
Sbjct: 130 VQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWT 189

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG 274
             VP+AAWI+IFWVL+ + N FPVK YGEFEFW+A IKVIA++GFIIYCLCMVCGAGITG
Sbjct: 190 TAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITG 249

Query: 275 PVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 334
           PVGFRYWR+PG WGPGIISKDKNE RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS
Sbjct: 250 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 309

Query: 335 VPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPH 394
           VPRAIKKV  R               VPYNDPKL+S+DSYVS+SPFIIAI+NSGTKVLPH
Sbjct: 310 VPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPH 369

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTR-NGVPFIAVLFTAAFGAL 453
           IFNAV+LTTIISA NSNVYVGSRI+YGL+  KLAP FF +T   GVP+ AV FT+AFGAL
Sbjct: 370 IFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGAL 429

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           AYME S GG +AFNWLLNITGVAGFF W+ IS  HIRFMQ LK+RG+SRDDLP+KA  MP
Sbjct: 430 AYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMP 489

Query: 514 GLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTL 573
            LAYY  FF+ +IILIQGFTAFAP F    F  AY+S FLF+ I++ AQ +FR R++  L
Sbjct: 490 WLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRL 549

Query: 574 XXXXXXXXXXXXXXXIW-EEGPQTFWDKFWAVIA 606
                          +W +E P+T WDKFW ++A
Sbjct: 550 DEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/550 (65%), Positives = 425/550 (77%), Gaps = 2/550 (0%)

Query: 59  KSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXX 118
           ++   + +   S RH+             +E     GVV++A+VKRELK RH        
Sbjct: 46  ETGSSSIVVDGSSRHLHGSHGSHSVSGDEDEPYVDQGVVQDAEVKRELKQRHIGMIALGG 105

Query: 119 XXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRF 178
                       P++NAGPVGSLIAY+FM T+VFSVTQSLGEMATFIPVTSSFTVF+SRF
Sbjct: 106 TIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRF 165

Query: 179 VSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPV 238
           +S   GAA GYMYWFSWAITFALELSVVGQ+I+FWT  VPL+AWI I+W ++ IMN FPV
Sbjct: 166 ISPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPV 225

Query: 239 KVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPGPWGPGIISKDKNE 298
           K YGEFEFWVASIKVIAI+GF+IYCLCMVCGAG+TGPVGFRYWR+PGPWGPGIIS    E
Sbjct: 226 KFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAE 285

Query: 299 ARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXX 358
            RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPRAIKKVS R             
Sbjct: 286 GRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSFRILIFYILSLFFIG 345

Query: 359 XXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRI 418
             VP++DPKLSS DSYVS+SPFIIAIQNSGTKVLPHIFNAVIL+TIISA NSN+YVGSR+
Sbjct: 346 LLVPFDDPKLSSDDSYVSSSPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRV 405

Query: 419 LYGLSSAKLAPKFFQ-KTRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAG 477
           ++GL+  KLAP++F   T++GVP+IAVLFT+AFGALA++E S+GG  AFNWLLNI GVAG
Sbjct: 406 MFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAG 465

Query: 478 FFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP 537
           FFAWL ISI+H+RF+QTL+HRG+SRDDLP+KAALMP LAYY  FF+ +II+IQGFTAFAP
Sbjct: 466 FFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTAFAP 525

Query: 538 KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXXXXXXXXXXXXXXIWEE-GPQT 596
            F+ + F+ AYIS FLF F+++  Q YFR +L+ +L               IWE+  P+T
Sbjct: 526 TFNGSDFVAAYISVFLFFFLWVSFQLYFRCKLYWSLDEVDIDTDRRDIDAIIWEDSAPKT 585

Query: 597 FWDKFWAVIA 606
           FWD+FW V+A
Sbjct: 586 FWDRFWDVVA 595

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/513 (65%), Positives = 387/513 (75%), Gaps = 2/513 (0%)

Query: 96  VVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVT 155
           ++E   VKR LK RH                    P+ NAGPVG+L+AY+FMGT+VFSVT
Sbjct: 60  LLEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVT 119

Query: 156 QSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTF 215
           QSLGEMATFIPVTSSF+VFA RF+S   GAA GYMY+ SW  TFALELSVVGQ+I+FWTF
Sbjct: 120 QSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF 179

Query: 216 KVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP 275
           KVPLAAWISIFWVL+   N FPVK YGEFEFW+ASIKV+A++GF+IY LC+VCGAG TGP
Sbjct: 180 KVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP 239

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +GFRYWR+PG  GPGIIS +  EARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+V
Sbjct: 240 IGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAV 299

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHI 395
           PRAI+KV +R               VPYNDPKL+STDSYVS+SPFII IQN+GT+VLPHI
Sbjct: 300 PRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHI 359

Query: 396 FNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTR-NGVPFIAVLFTAAFGALA 454
           FNAVILTTIISA NSNVYVGSRIL+ ++   LAPKF  KT   GVP+++VL  +AFG+L+
Sbjct: 360 FNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLS 419

Query: 455 YMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPG 514
           YME S GG  AFNWLLNITGVAGFFAWL IS SH+RFMQ LKHRG+SRDDLPYKA  MP 
Sbjct: 420 YMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPW 479

Query: 515 LAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLX 574
           LAYY  FF+ +IILIQGFT+FAP F    F+ AYIS  LFL  +   Q YFR R+   L 
Sbjct: 480 LAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLE 539

Query: 575 XXXXXXXXXXXXXXIWE-EGPQTFWDKFWAVIA 606
                         +WE + P+T WDKFW  +A
Sbjct: 540 DVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/567 (60%), Positives = 400/567 (70%), Gaps = 6/567 (1%)

Query: 46  HRHRGSEGEVEYAKSD----EDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQ 101
             +  + GE   A  +    +D   T    R V               D    G V++A+
Sbjct: 22  QEYNNAMGESSTASEEPFGCKDTKSTDEKTRVVSQVSPMRTGSPNVSIDYMDEGNVQDAE 81

Query: 102 VKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEM 161
           VKR LKPRH                    P+ +AGPVG+LIAY+FMGT+ + VTQSLGEM
Sbjct: 82  VKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQSLGEM 141

Query: 162 ATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAA 221
           ATFIPVTSSFTVF  RF+S  FG A GY+YWFSW ITFALELSVVGQ+I+FWTF VPL A
Sbjct: 142 ATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFWTFAVPLGA 201

Query: 222 WISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYW 281
           WI+IFWV++   N FPVK YGE EFW+A IKV+AI+GFIIY   MVCGAG TGPVGFRYW
Sbjct: 202 WIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYW 261

Query: 282 RHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKK 341
           R+PGPWGPGIISKD NE RFLGWVSSLINAAFTYQGTELVGITAGE+ NPR++VPRAI K
Sbjct: 262 RNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKNPRRTVPRAINK 321

Query: 342 VSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVIL 401
           V  R               VP+NDPKL S DSY+S+SPF+IAI+NSGTKVLPHIFNAVIL
Sbjct: 322 VFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVIL 381

Query: 402 TTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSA 460
           +TIISA NSN+YVGSR+LYGL+  KLAPK F + T++GVP+I+VL TAAFG LAY+  S 
Sbjct: 382 STIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAAFGFLAYLNLSN 441

Query: 461 GGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGA 520
             Q  F+WLLNIT +AGFFAWL IS++HIRFMQ LK R MSR+DLP+KA  MP  AYY A
Sbjct: 442 SAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPWGAYYSA 501

Query: 521 FFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXXXXXX 580
           FF++LII+IQGFTAFAPKF+ + F  AYIS FLFL I++V Q  FRTR   T        
Sbjct: 502 FFISLIIIIQGFTAFAPKFNVSNFFAAYISVFLFLAIWVVFQIRFRTRFILTKNDVDIDT 561

Query: 581 XXXXXXXXIW-EEGPQTFWDKFWAVIA 606
                   +W EE P+  WDKFWA +A
Sbjct: 562 DRRDIDCIVWEEETPKNAWDKFWAAMA 588

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/519 (65%), Positives = 387/519 (74%), Gaps = 4/519 (0%)

Query: 92  DATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLV 151
           D  G + +A+VKR LKPRH                    P+ NAGPVGSLIA++ +GTL 
Sbjct: 63  DPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLA 122

Query: 152 FSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIE 211
           +SVTQSLGEMATFIPVTSSFTVF+ RF+S   GAA GYMYWFSWAITFALELS+VGQ+I+
Sbjct: 123 YSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQ 182

Query: 212 FWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAG 271
           +WT  VPL AWI+IFWVL+V  N FPVK YGEFEFWVASIKVIAIIGF+IY LCMVCGAG
Sbjct: 183 YWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAG 242

Query: 272 ITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 331
             GP+GFRYWR PGPWG GII+K+ N+ARFLGWVSSLI+AAFTYQGTELVGITAGE  NP
Sbjct: 243 PEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNP 302

Query: 332 RKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTD--SYVSASPFIIAIQNSGT 389
           RK+VPRAI KV  R               VPYNDPKL  +D  SY++ SPF+IAI N  T
Sbjct: 303 RKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRT 362

Query: 390 KVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTA 448
            VLPHIFNAVILTTIISA NSNVYVGSRIL+GLS   LAPKFF K T++GVPFIAVL TA
Sbjct: 363 PVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITA 422

Query: 449 AFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYK 508
            FG LAY+  S   Q  F+WLLNIT +AGF  WL ISISHIRFMQTLKHRG+SRDDLPYK
Sbjct: 423 VFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYK 482

Query: 509 AALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568
           A  MP  AYY AFF+T+II+IQGFTAFAP F+ + F  AYIS FLF  ++ + Q  +RT+
Sbjct: 483 AKFMPYAAYYAAFFITVIIIIQGFTAFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTK 542

Query: 569 LWRTLXXXXXXXXXXXXXXXIW-EEGPQTFWDKFWAVIA 606
           L+RTL               IW EE P+  W+KFWAV A
Sbjct: 543 LFRTLDEVDIDSDRRDIDVIIWEEEEPKNLWEKFWAVAA 581

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/519 (63%), Positives = 384/519 (73%), Gaps = 2/519 (0%)

Query: 90  DIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGT 149
            +++ G V+E QVKR LKPRH                    P+ NAGPVG+LIAY+F+GT
Sbjct: 30  SMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGT 89

Query: 150 LVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQV 209
           L +SVTQSLGEMATFIPVTSSFTVF  RF+S   G+A GY+YW SWAITFALELSVVGQ+
Sbjct: 90  LAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQI 149

Query: 210 IEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG 269
           I+FWT  VPL AWI+IFWV++ I N FPVK YGE EFW+A IKV+AI+GFIIY   MVCG
Sbjct: 150 IQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG 209

Query: 270 AGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAA 329
           AG TGPVGFRYWR+PGPWGPGIISKD NE RFLGWVSSLI+AAFTYQGTELVGITAGEAA
Sbjct: 210 AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269

Query: 330 NPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGT 389
           NPRK+VPRAI KV  R               VP+NDPKL S DSY+S+SPF+IAI+NSGT
Sbjct: 270 NPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGT 329

Query: 390 KVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQ-KTRNGVPFIAVLFTA 448
           KVLPHIFNAVIL+TIISA NSNVYVGSRI Y ++   LAPK+    T++G+P+ AVL T+
Sbjct: 330 KVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTS 389

Query: 449 AFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYK 508
             G LAY+E+S+G    FNWLLNIT VAGFF W+ ISISHIRFMQ LKH+G+SRDDLP+K
Sbjct: 390 VLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFK 449

Query: 509 AALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568
           A  MP  AYY AFF+ +II+IQGFTAFAPKF  + F TAYIS  LF   +I  Q +FR  
Sbjct: 450 AKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGP 509

Query: 569 LWRTLXXXXXXXXXXXXXXXIWEE-GPQTFWDKFWAVIA 606
           L+                  +WEE  P+  W+KFWA IA
Sbjct: 510 LFIKTEDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/507 (62%), Positives = 381/507 (75%), Gaps = 2/507 (0%)

Query: 102 VKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEM 161
           V+R+LKPRH                    P++NAGPVG+LI+Y+FMG++ + VTQSLGEM
Sbjct: 53  VQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEM 112

Query: 162 ATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAA 221
           ATFIPVTSSFTVF  RF+S P GAA GYMY FSW++T+ALELS+VGQ+IE+WT  VP AA
Sbjct: 113 ATFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAA 172

Query: 222 WISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYW 281
           WI+IFWV I + N  PVK YGEF+FW+A IKV+AIIGF++YCLCMVCGAG TGPVGFRYW
Sbjct: 173 WIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGPVGFRYW 232

Query: 282 RHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKK 341
           R+PGPWG GIIS D +E RFLGWVSSL+NAAFTYQGTELVGI+AGE+ANPRK+VP+AI K
Sbjct: 233 RNPGPWGDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINK 292

Query: 342 VSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVIL 401
           V  R               VP+ND KL+S+DSY + SPFIIAIQNSGTK+LP IFNAVIL
Sbjct: 293 VFFRILLFYVGSLFFIGLLVPFNDEKLTSSDSYSAGSPFIIAIQNSGTKILPDIFNAVIL 352

Query: 402 TTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSA 460
            TIISAANSNVYVGSR+LYGL+  +LAP+FF +T R+GVP +AVLF A FG L Y+  S 
Sbjct: 353 ATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSN 412

Query: 461 GGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGA 520
           G   AF+WLLNIT +AGFF+WL IS+ H+RFMQ LK +G+SRDDLP+KA LMP  AYY A
Sbjct: 413 GASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSA 472

Query: 521 FFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXXXXXX 580
           FF+TLII+IQGFT+ AP F+ + F  AYIS F+FL I+ V QC++RTR+   +       
Sbjct: 473 FFITLIIIIQGFTSLAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDS 532

Query: 581 XXXXXXXXIWEEG-PQTFWDKFWAVIA 606
                    W+   P T W KFWA +A
Sbjct: 533 DRREVDAQQWDNTEPTTLWGKFWAAMA 559

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/514 (63%), Positives = 384/514 (74%), Gaps = 5/514 (0%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           ++  VKRELK RH                    P+  AGP+G+LIAY+FMGT+VFSVTQS
Sbjct: 31  KQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFSVTQS 90

Query: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217
           LGEM TFIPVT+SFTVFA RF+S  FGAA GYMYWFSWA+TFALELSVVGQ+I+FWT  V
Sbjct: 91  LGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAV 150

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVG 277
           PLAAWISI WVL+ I N FPV++YGE EFW+AS+KV+AI+GFIIY +C++CGAG+TGPVG
Sbjct: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGICIICGAGVTGPVG 210

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
           FRYW++PGPWG GIIS + NEARF GWVSSLINAAFT+QGTELVGITAGE   PRK+VP+
Sbjct: 211 FRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPK 270

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFN 397
           AIKKV  R               VPYNDPKL S DSYVS+SPFII IQN+GTK+LPHIFN
Sbjct: 271 AIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFN 330

Query: 398 AVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYM 456
           AVIL TIISA NSNVY+GSRILYGL+  K APKFF  T + GVP++ VLFT+ FG+LAYM
Sbjct: 331 AVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYM 390

Query: 457 ETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLA 516
           ET+ GG  AF WLLNI GVAGFFAWL IS SHIRFM+ LK RG+SR+DLPYKA LMP LA
Sbjct: 391 ETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLA 450

Query: 517 YYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXX 576
           YY  FF+ +II+IQGFT+FAPKF    F  AYIS FLF+  ++  Q +F+ RL   L   
Sbjct: 451 YYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDV 510

Query: 577 XXXXXXXXXXXXIW----EEGPQTFWDKFWAVIA 606
                       +W    E+  + +WD+FW  +A
Sbjct: 511 DLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/519 (61%), Positives = 381/519 (73%), Gaps = 2/519 (0%)

Query: 90  DIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGT 149
            +++ G V+E QVKR LKPRH                    P+ NAGPVG+LIAY+F+GT
Sbjct: 30  SLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGT 89

Query: 150 LVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQV 209
           L + V+QSLGEMATFIPVTSSF VF  RF+S   GAA GYMY+ SW+ITFALELSVVGQV
Sbjct: 90  LAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQV 149

Query: 210 IEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG 269
           I+FWT  VPL AWI I WV++V  N  PVK YGE EFW+A IKV+AI+GFIIY   MVCG
Sbjct: 150 IQFWTDAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG 209

Query: 270 AGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAA 329
           AG TGPVGFRYWR+PGPWGPGIISKD NE RFLGWVSSLI+AAFTYQGTELVGITAGEAA
Sbjct: 210 AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAA 269

Query: 330 NPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGT 389
           NPRK+VPRAI KV  R               VP+NDPKL S DSY+S+SPF+IAI+NSGT
Sbjct: 270 NPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGT 329

Query: 390 KVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQ-KTRNGVPFIAVLFTA 448
           KVLPHIFNAVIL+TIISA NS+VY+ SR+LY +    LAPK+    T++G+P+ AVL T+
Sbjct: 330 KVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTS 389

Query: 449 AFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYK 508
             G LAY+E+S G    F+WLLNIT VAGFFAW+ IS++HIRFMQ LKH+G+SRDDLP+K
Sbjct: 390 LVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFK 449

Query: 509 AALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568
           A  MP  AYY AFF+ +II+IQGFTAFAPKF+ + F TAY+S  LF  ++I  Q +FR  
Sbjct: 450 AKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGP 509

Query: 569 LWRTLXXXXXXXXXXXXXXXIWEEG-PQTFWDKFWAVIA 606
           L++                 +WEE  P+  W+KFW+ +A
Sbjct: 510 LFKKTEDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/527 (62%), Positives = 397/527 (75%), Gaps = 8/527 (1%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           +E++  +G V +A+VKRELK RH                    P++++GPVGSLIAYIF+
Sbjct: 48  DEEMLNSGSVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFV 107

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           GTL ++VTQSLGEMATFIPVTSSFTVFASRF+S   GAA GYMYWFSWA+TFALELSVVG
Sbjct: 108 GTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVG 167

Query: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
           Q++++WTF VP+AAWISIFWV++  +N FPVK YGE EFWVA++KV+AI+GF+IYCLCMV
Sbjct: 168 QIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMV 227

Query: 268 CGAGITGPVGFRYWRHPGPWGPGI------ISKDKNEARFLGWVSSLINAAFTYQGTELV 321
           CGAG+TGPVGFRYWR+PGPWG G+      ISK+KN  RFLGW +SLINAAFTYQGTELV
Sbjct: 228 CGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELV 287

Query: 322 GITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFI 381
           GITAGEAANPRK+VPRAIKKV  R               VP++DPKLSS DSYVS+SPFI
Sbjct: 288 GITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDDSYVSSSPFI 347

Query: 382 IAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVP 440
           IAI+NSGTK+LP IFNA+IL TIISA NSN+YVGSRIL+ L+   LAPK   + T+ GVP
Sbjct: 348 IAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVP 407

Query: 441 FIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGM 500
           +++VL TA FG LAYMET+ GGQ  F+WL+NIT +AGF+AWL I ISHIRFMQ LK RG+
Sbjct: 408 WVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGI 467

Query: 501 SRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIV 560
           SRDDLP+KA LMPGLAYY  F + +II+ QGFTAF P FD + F  AYIS  LF  I+  
Sbjct: 468 SRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGA 527

Query: 561 AQCYFRTRLWRTLXXXXXXXXXXXXXXXIWEE-GPQTFWDKFWAVIA 606
            Q +F+ R    L               IWE+  P+TFWDKFW V+A
Sbjct: 528 FQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/526 (60%), Positives = 387/526 (73%), Gaps = 7/526 (1%)

Query: 88  EEDIDAT-----GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLI 142
           E D+D +     G V   +VKR LKPRH                    P+QNAGPVG LI
Sbjct: 55  EYDVDDSVDGEKGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLI 114

Query: 143 AYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALE 202
           AY+FM T+ FSV QSLGEMAT+IPVTS+F+VF+ RF+S  FGAA GYMYWFSW+ITFALE
Sbjct: 115 AYLFMATIAFSVMQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALE 174

Query: 203 LSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIY 262
           LSV+GQ++++WTFKVP+AAWISIFWVLI  +NF PVK YGEFEFW+A IKV+AI+GFIIY
Sbjct: 175 LSVIGQIVQYWTFKVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIY 234

Query: 263 CLCMVCGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVG 322
           C  MVCGAG TGPVGFRYWRH   +G GIISK+KNEARFLGWVSSLINAAFTYQGTELVG
Sbjct: 235 CFIMVCGAGKTGPVGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVG 294

Query: 323 ITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFII 382
           ITAGEAANPRK+VP++IK+   R               VP+ND  L  + SY ++SPFI+
Sbjct: 295 ITAGEAANPRKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAASSPFIL 354

Query: 383 AIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPF 441
           AI+NSGTK LP IFNAVILTT+ISAANS+VYVGSR++Y ++  +LAP    K ++ GVP+
Sbjct: 355 AIKNSGTKALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPY 414

Query: 442 IAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMS 501
            AVLFT+A GALAY+ETS+ G N FNWL+NITGVAGFF+W  IS SH+RFM+ LK RG+S
Sbjct: 415 AAVLFTSAIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGIS 474

Query: 502 RDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVA 561
           R+DLP+KA+ MP +A Y  FF+TLIIL+QGFT F P F ++ F+ +YIS  LF  I+ V 
Sbjct: 475 RNDLPFKASFMPWIAIYSFFFMTLIILVQGFTCFTPHFQASDFVASYISVGLFFVIWAVF 534

Query: 562 QCYFRTRLWRTLXXXXXXXXXXXXXXXIWE-EGPQTFWDKFWAVIA 606
           Q +FR  L   +               +WE E P+T WDKFW ++A
Sbjct: 535 QIWFRCPLLVPIAEIDIDTDRRDVDAEVWEDEPPKTLWDKFWNIVA 580

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/511 (61%), Positives = 375/511 (73%), Gaps = 3/511 (0%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
             +V+R+LK RH                    P+ +AGPVG+LI+Y+FMGT+++SVTQSL
Sbjct: 63  RGEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSL 122

Query: 159 GEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVP 218
           GEMATFIPVTSSF+VFA RF+S   GA  GYMYW SW  TFALELSV+GQ+I++WT  VP
Sbjct: 123 GEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVP 182

Query: 219 LAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGI-TGPVG 277
           LAAWI IFW L+ +MN FPVK YGEFEF +ASIKVI ++GFII+  C+VCGAG   GP+G
Sbjct: 183 LAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIG 242

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
           FRYWR+PG WGPGIIS +KNE RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 243 FRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPR 302

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFN 397
           AIKKV +R               VPYNDPKL S  ++VSASPF+I+I+NSGTKVLP IFN
Sbjct: 303 AIKKVVIRILVFYILSLFFIGLLVPYNDPKLDSDGTFVSASPFMISIENSGTKVLPDIFN 362

Query: 398 AVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYM 456
           AV+L TI SA NSNVY+GSR+LY LS   LAPK     TR GVP++AVL T+ FG LA++
Sbjct: 363 AVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFL 422

Query: 457 ETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLA 516
           ETSAG   AFNWLLNITGVAGFFAWL IS SHIRFMQ +K RG+SRDDLPYKA +MP LA
Sbjct: 423 ETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLA 482

Query: 517 YYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXX 576
           YY +FF+ LI+LIQGFTAFAP F    F+ AYIS FLF  I++  Q +F+ RL   L   
Sbjct: 483 YYASFFIALIVLIQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDI 542

Query: 577 XXXXXXXXXXXXIW-EEGPQTFWDKFWAVIA 606
                       +W E   +T W + W +++
Sbjct: 543 DIDSDRREIEEQVWIEPECKTRWQRVWDILS 573

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/512 (61%), Positives = 376/512 (73%), Gaps = 3/512 (0%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           E  +VKR+LK RH                    P+ +AGPVG+LI+Y+FMGT+++SVTQS
Sbjct: 62  ERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQS 121

Query: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217
           LGEM TFIPVTSSF+VFA RF+S   GA  GYMYW SW  TFALELSV+G+VI++WT  V
Sbjct: 122 LGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAV 181

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT-GPV 276
           PLAAWI IFW L+  MN FPVK YGEFEF +ASIKVIA++GFII+  C+VCGAG + GP+
Sbjct: 182 PLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPI 241

Query: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336
           GFRYWR+PG WGPGIIS DKNE RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK++P
Sbjct: 242 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALP 301

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIF 396
           RAIKKV VR               VPYNDPKL S   +VS+SPF+I+I+NSGTKVLP IF
Sbjct: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIF 361

Query: 397 NAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAY 455
           NAV+L TI+SA NSNVY+GSR+LY LS   LAP+F    TR GVP+ +VL T+ FG LA+
Sbjct: 362 NAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAF 421

Query: 456 METSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGL 515
           +E SAG   AFNWLLNITGVAGFFAWL IS SHIRFMQ ++ RG+SRDDLPYKA +MP L
Sbjct: 422 LEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFL 481

Query: 516 AYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXX 575
           AYY +FF+ LI+LIQGFTAFAP F    F+ AYIS FLFL I++  Q +F+ RL   L  
Sbjct: 482 AYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQD 541

Query: 576 XXXXXXXXXXXXXIW-EEGPQTFWDKFWAVIA 606
                        +W E   +T W + W V++
Sbjct: 542 IDIDSDRRQIEELVWIEPECKTRWQRVWDVLS 573

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/510 (61%), Positives = 378/510 (74%), Gaps = 3/510 (0%)

Query: 100 AQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLG 159
            +VKR+LK RH                    P+ +AGPVG+LI+Y+FMGT+++SVTQSLG
Sbjct: 64  GEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLG 123

Query: 160 EMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPL 219
           EMATFIPVTSSF+VFA RF+S   GA  GYMYW SW  TFALELSV+GQ+I++WT  VPL
Sbjct: 124 EMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDAVPL 183

Query: 220 AAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT-GPVGF 278
            AWI IFW L+ +MN FPVK YGEFEF +ASIKVIA++GFI +  C+VCGAG + GP+GF
Sbjct: 184 VAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPIGF 243

Query: 279 RYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 338
           RYWR+PG WGPGIISK+KNE RFLGWVSSLINAAFTYQGTELVGITAGEAANPR++VPRA
Sbjct: 244 RYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVPRA 303

Query: 339 IKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNA 398
           IKKV VR               VPYNDPKL S  ++VS+SPF+I+I+NSGTKVLP IFNA
Sbjct: 304 IKKVVVRILVFYILSLFFIGLLVPYNDPKLDSEGTFVSSSPFMISIENSGTKVLPDIFNA 363

Query: 399 VILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYME 457
           V+L TI+SA NSNVY+GSR+LY LS   LAP+F    T+ GVP+ AVL T+AFG LA++E
Sbjct: 364 VVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAFLE 423

Query: 458 TSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAY 517
           TSAG    FNWLLNITGVAGFFAWL IS+SHIRFMQ +K RG+SRDDLPY+A +MP LAY
Sbjct: 424 TSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFLAY 483

Query: 518 YGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXXX 577
           Y +FF+ LI+LIQGFTAFAP F    F+ AYIS FLF+ I+++ Q +F+ R    L    
Sbjct: 484 YASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQDVD 543

Query: 578 XXXXXXXXXXXIW-EEGPQTFWDKFWAVIA 606
                      +W E   +T W   W +++
Sbjct: 544 IDSDRRDIEEQVWIEPECKTRWQHVWDILS 573

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/521 (60%), Positives = 381/521 (73%), Gaps = 3/521 (0%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           EED +  G   + +VKR LK RH                    P+ NAGPVGSLIAY+FM
Sbjct: 54  EEDAEEAGY-HDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFM 112

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           G++V+ +TQSLGEMATFIPVTSS TVF+ RF+S  FG A GYMYWF+WAIT+A+E+SV+G
Sbjct: 113 GSIVYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIG 172

Query: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
           QVI+FWT  VPLAAWI+IFWV + ++NFFPVKVYGE EFWVASIKVIAI+G++IY L +V
Sbjct: 173 QVIQFWTSAVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIV 232

Query: 268 CGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGE 327
           CG    GP+GFRYWR+PGPWGPGIIS DKNE RFLGWVSSLINAAFTYQGTELVGITAGE
Sbjct: 233 CGGSSQGPIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 292

Query: 328 AANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNS 387
           AANPRKSVPRAI KV  R               VP+NDP+L+S  + +++SPF+I+IQN+
Sbjct: 293 AANPRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRLASNVAVIASSPFVISIQNA 352

Query: 388 GTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLF 446
           GT+VLPHIFNAV++ TIISAANSNVYVGSR+LY LS    APK F   TR+GVP++ V+ 
Sbjct: 353 GTRVLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIA 412

Query: 447 TAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLP 506
           T+  G LA++  +     AFNWL+NI+ +AG  AWL IS+SHIRFMQ LK RG+SRDDLP
Sbjct: 413 TSLLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLP 472

Query: 507 YKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
           +KA LMP  AYY AFFVT+II IQGF AF+PKFD + F TAYIS  + + + I  Q Y+R
Sbjct: 473 FKAKLMPWGAYYAAFFVTVIIFIQGFEAFSPKFDVSGFFTAYISLIILVVLLIGCQLYYR 532

Query: 567 TR-LWRTLXXXXXXXXXXXXXXXIWEEGPQTFWDKFWAVIA 606
            R LW+                   EE PQ  W+KFW+++A
Sbjct: 533 CRFLWKLEDIDIDTDRREIECIIWEEEEPQNLWEKFWSIMA 573

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/521 (59%), Positives = 375/521 (71%), Gaps = 2/521 (0%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           +E++      E  +VKR+L  RH                    P+  +GPVGSLIAY+F+
Sbjct: 46  KENVSENEKDEYHEVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFL 105

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           GT+V+SVTQSLGEMATFIPVT+SFT+F+ RF+S   GAA GYMYWFSWA+TFALELSVVG
Sbjct: 106 GTVVYSVTQSLGEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVG 165

Query: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
           Q+I+FWTF VPL AWISIFWV++ I N FPV++YGE EFW+A +KV AI+GFIIYC C+V
Sbjct: 166 QIIQFWTFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIV 225

Query: 268 CGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGE 327
           CGAG TGPVGFRYWR+PGPWG GIIS +  EARFLGW SSLINAAFT+QGTELVGITAGE
Sbjct: 226 CGAGKTGPVGFRYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGE 285

Query: 328 AANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNS 387
           AANPR++VP+AI+KV  R               VPY+D KL S +SYVS+SPFIIAI+NS
Sbjct: 286 AANPRQTVPKAIRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENS 345

Query: 388 GTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLF 446
           GTK+LPHIFN VIL TIISA NSNVY+GSR+L+GL+     PK F K T++GVP  AV+F
Sbjct: 346 GTKILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVF 405

Query: 447 TAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLP 506
           T+ FGALA+METS GG  AF WLLN+ GVAGFF+WL IS +HIRFMQ L+ RG+SR+DLP
Sbjct: 406 TSLFGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLP 465

Query: 507 YKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
           +KA  MP LAYY    + +II  QGFTAFAPKFD   F  +YIS FLF   +   Q +F+
Sbjct: 466 FKAKFMPYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFK 525

Query: 567 TRLWRTLXXXXXXXXXXXXXXXIWEE-GPQTFWDKFWAVIA 606
            R    L               +W++  P   W KFW  +A
Sbjct: 526 CRYVWKLVDIDIDKDRREIEDRVWQDTTPANLWGKFWDFVA 566

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/512 (60%), Positives = 382/512 (74%), Gaps = 2/512 (0%)

Query: 97  VEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQ 156
           V+   VKR LKPRH                    P++NAGPVG+LIAYIF+GT++FSVTQ
Sbjct: 88  VKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVTQ 147

Query: 157 SLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
           SLGEM TFIPVTSSFTVF+ RF+S  FGAA GYMYWFSWA+TFA+ELSV+G+VI+FWT  
Sbjct: 148 SLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTTA 207

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPV 276
           VPLAAWI IFW L+ + N FPVK YGE EFW+A +KV++++GF+I+CLC+  GAG  GP 
Sbjct: 208 VPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGPHGPF 267

Query: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336
           GFRYWR PG WGPGII++D++EARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VP
Sbjct: 268 GFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 327

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIF 396
           +AIKKV +R               VP+NDPKL+S  S+VS+SPFIIAIQNSG  +LP IF
Sbjct: 328 KAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSATSFVSSSPFIIAIQNSGVSLLPSIF 387

Query: 397 NAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAY 455
           N VIL TIISA NSNVYVGSRIL+GL+ + LAP+FF + T+ GVPF+AVLFT+ FG+LA+
Sbjct: 388 NGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLFGSLAF 447

Query: 456 METSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGL 515
           +E +  G   FNWLL+I  +AGFFAWL IS+SHIRFM+ L++RG+SR+ LP+KA  MP L
Sbjct: 448 LELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAIFMPWL 507

Query: 516 AYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXX 575
           AYY   F+ LIILIQGFTAFAP+F+ + F+ +YIS  LF+ I+ V Q   + R++  +  
Sbjct: 508 AYYATAFIILIILIQGFTAFAPRFNVSDFVASYISLLLFVIIWGVFQAMKKCRIFWKVED 567

Query: 576 XXXXXXXXXXXXXIWE-EGPQTFWDKFWAVIA 606
                         WE + P+TFW K W  +A
Sbjct: 568 IDLDSDRKDIEDIRWEDDSPKTFWTKVWQTLA 599

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/511 (60%), Positives = 377/511 (73%), Gaps = 2/511 (0%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
            + QVKR LK RH                    P+ N+GPVGSLIAY+FMG++++ +TQS
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217
           LGEMATFIPVTSS TVF+ RF+S  FG A GYMYWF+WAITFA+E+SVVGQVIE+WT KV
Sbjct: 149 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDKV 208

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVG 277
           PLAAWI+IFWVLI ++NFFPVKVYGE EFW+A IKV+AI+G+++Y L +VCG    GP+G
Sbjct: 209 PLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGSSQGPIG 268

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
           FRYWR+PGPWGPGIISKD N  RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 269 FRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 328

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFN 397
           AI KV  R               VPYND +L+ST + +++SPF+I+IQN+GTKVLP IFN
Sbjct: 329 AINKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASSPFVISIQNAGTKVLPDIFN 388

Query: 398 AVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQ-KTRNGVPFIAVLFTAAFGALAYM 456
           A+++ TIISAANSNVYVGSR+LY L+ +  APK F   TR GVP++ V+ T+A G LA++
Sbjct: 389 AIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLLAFL 448

Query: 457 ETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLA 516
             +     AFNWL+NI+ +AG  AWL ISISHIRFMQ LK RG+SRDDLP+KA LMP  A
Sbjct: 449 VVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMPFGA 508

Query: 517 YYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXX 576
           YY  FFVT+II IQGF AF+P +D+TAF T+YIS  +   ++I  Q ++R R +  +   
Sbjct: 509 YYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFFWRVEDI 568

Query: 577 XXXXXXXXXXXXIWEEG-PQTFWDKFWAVIA 606
                       IWE+  P+T WDKFWA +A
Sbjct: 569 DIDSDRREIEAVIWEDDEPKTLWDKFWAAVA 599

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/479 (65%), Positives = 365/479 (76%), Gaps = 3/479 (0%)

Query: 131 PIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYM 190
           P+ +AGPVG+LI+YIFMGT+++SVTQSLGEMATFIPVTSSF+VFA RF+S   GA  GYM
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 191 YWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVAS 250
           YW SW  TFALELSV+GQ+I++WT  VPL+AWI IFW L+ +MN FPVK YGEFEF +AS
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 251 IKVIAIIGFIIYCLCMVCGAG-ITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLI 309
           IKVIA++GFIIY  CMVCGAG   GP+GFRYWR+PG WGPGIIS DKNE RFLGWVSSLI
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 310 NAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLS 369
           NAAFTYQGTELVGITAGEAANPRK+VPRAIKKV VR               VPYNDPKL 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 370 STDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAP 429
           S  S+VSASPF+I+I+NSGTKVLP IFNAV+L TI+SA NSNVY+GSR+LY LS   LAP
Sbjct: 259 SDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAP 318

Query: 430 KFFQ-KTRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISH 488
           +F    T+ GVP+ AVL T+ FG LA++ETSAG   AFNWLLNITGVAGFFAWL IS SH
Sbjct: 319 RFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSH 378

Query: 489 IRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAY 548
           IRFMQ +  RG+SR+DLPYKA +MP LAYY +FF+ LI+LIQGFTAFAP F    F+ AY
Sbjct: 379 IRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVAAY 438

Query: 549 ISCFLFLFIYIVAQCYFRTRLWRTLXXXXXXXXXXXXXXXIW-EEGPQTFWDKFWAVIA 606
           IS FLF+ I+   Q +F+  +   L               +W E   +T W   W V+A
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQVWIEPLRKTKWQCVWDVLA 497

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/511 (59%), Positives = 376/511 (73%), Gaps = 2/511 (0%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           ++ +VKR LKPRH                    P+Q +GPVGSLIAYIFMGT+V+ VTQ+
Sbjct: 98  KDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQA 157

Query: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217
           LGEMATFIPVTSS TVF+SRF+S  FG + GY+YWF+WAIT+A+E+SVVGQVIEFWT KV
Sbjct: 158 LGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTKV 217

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVG 277
           PLAAWISIFWVL+  +NFFPV VYGE EFWVAS+KV+AI+G++IY L +VCG    GP+G
Sbjct: 218 PLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGSKQGPIG 277

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
           FRYWRH    G G+ISKDKNEARFLGWV+SLINAAFTYQGTELVGITAGEAANPRKSVPR
Sbjct: 278 FRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSVPR 337

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFN 397
           AI KV  R               VPYNDPKL+S  SY+++SPF+I+I+N+GT+ LPHIFN
Sbjct: 338 AINKVVFRIVIFYILSLFFIGLLVPYNDPKLNSATSYIASSPFVISIENAGTRALPHIFN 397

Query: 398 AVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYM 456
           A+I+ TIISAANSNVYV SR+LY L+ +  APK F + T  GVPF+ V+ TA  G LA++
Sbjct: 398 AIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLLAFL 457

Query: 457 ETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLA 516
             +     AFNWL+NI+ +AG  AWL IS+SH+RFM+ LK+RG+SRDDLP+KA  MP  +
Sbjct: 458 VVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPYGS 517

Query: 517 YYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXX 576
           YY  FF+T+II IQGFTAF+PKFD  +F TAYIS  L   ++I  Q Y+R R +  +   
Sbjct: 518 YYACFFITVIIFIQGFTAFSPKFDVASFFTAYISLILLAVLFIGCQLYYRCRFFWKVEDI 577

Query: 577 XXXXXXXXXXXXIWEEG-PQTFWDKFWAVIA 606
                       +WE+  P+T WDKFWA +A
Sbjct: 578 DIDTDRREIDEIVWEDDEPKTAWDKFWAAVA 608

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/606 (53%), Positives = 406/606 (66%), Gaps = 15/606 (2%)

Query: 3   NKDNASIELHSYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKSDE 62
           NK ++   +   H S E ++ S  D  + + ++NE     +    H        ++ +D 
Sbjct: 15  NKHDSEKHVTEIHTSTEDEQTSPDDHSI-EIIKNEILEKDKKKIAHTNQFSSDIHSITD- 72

Query: 63  DATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXX 122
             +L ++   H+               D          +VKR LK RH            
Sbjct: 73  --SLARSRLPHLGDDDDEEDAEEAQYHD---------TEVKRALKQRHIGMIALGGTIGT 121

Query: 123 XXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDP 182
                   P+ N+GPVGSLIAY+FMG++++S+TQSLGEMATFIPVTSS TVF+ RF+S  
Sbjct: 122 GLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQSLGEMATFIPVTSSITVFSKRFLSPA 181

Query: 183 FGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYG 242
           FG A GYMYWF+WAIT+A+E+SVVGQVIE+WT KVPLAAWI+IFWV + +MNFFPVKVYG
Sbjct: 182 FGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKVPLAAWIAIFWVFVTLMNFFPVKVYG 241

Query: 243 EFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFL 302
           E EFW+A +KV+AI G+++Y L +VCG    GP+GFRYWR+PGPWG GIISKDKN +RFL
Sbjct: 242 EIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGPIGFRYWRNPGPWGAGIISKDKNTSRFL 301

Query: 303 GWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVP 362
           GWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI KV  R               VP
Sbjct: 302 GWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVP 361

Query: 363 YNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGL 422
           Y+DP+LSS  + V++SPF+I+IQN+GTK+LP IFNA+++ T+ISAANSNVYVGSR+LY L
Sbjct: 362 YDDPRLSSDSAVVASSPFVISIQNAGTKILPDIFNAIVMITVISAANSNVYVGSRVLYAL 421

Query: 423 SSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAW 481
           +    APK F   TR+GVP++ VL TAA G LA++  +     AFNWL+NI+ +AG  AW
Sbjct: 422 AQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAW 481

Query: 482 LSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDS 541
           L ISISHIRFMQ LK RG+SRDDLP+KA  MP  AYY  FFVT+II IQGF AF+P FD 
Sbjct: 482 LFISISHIRFMQALKFRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGFQAFSPHFDV 541

Query: 542 TAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXXXXXXXXXXXXXXIWEEG-PQTFWDK 600
           TAF TAYIS  +   ++I  Q Y+R R +  L               IWE+  P+T+WDK
Sbjct: 542 TAFFTAYISLIILAVLFIGCQIYYRCRFFWKLEDIDIDTDRREIEEVIWEDDEPKTYWDK 601

Query: 601 FWAVIA 606
           FWA +A
Sbjct: 602 FWAAVA 607

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/520 (59%), Positives = 376/520 (72%), Gaps = 3/520 (0%)

Query: 89  EDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMG 148
            D +  G V++ +VKR LK RH                    P+ NAGPVG+LIAYIFMG
Sbjct: 81  SDTEEAGHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMG 140

Query: 149 TLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQ 208
           ++++ +TQSLGEMATFIPVTSS TVF+ RF+S  FG   GYMYWF+WAIT+A+E+SVVGQ
Sbjct: 141 SIIYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQ 200

Query: 209 VIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC 268
           VI++WT  VPLAAWI+IFWV + ++NFFPVKVYGE EFWVASIKV+AIIG++IY L +VC
Sbjct: 201 VIQYWTDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVC 260

Query: 269 GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEA 328
           G    GP+GFRYWR+PGPWGPGIISKD NE RFLGWVSSLINAAFTYQGTELVGITAGEA
Sbjct: 261 GGSSQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 320

Query: 329 ANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSG 388
           ANPRKSVPRAI KV  R               VPYND  LSS DSY+++SPF+I+IQN+G
Sbjct: 321 ANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTLSSGDSYIASSPFVISIQNAG 380

Query: 389 TKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFT 447
           T  LP IFNAV++ TIISAANSNVYVGSR+LY L+    APK F   T++GVP++ V+ T
Sbjct: 381 TYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVT 440

Query: 448 AAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPY 507
           A+ G LA++  +     AFNWL+NI+ +AG  AW  I++SHIRFMQ LK+RG+SRDDLP+
Sbjct: 441 ASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPF 500

Query: 508 KAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRT 567
           KA LMP  AYY AFFV +II IQGF AF P +D+T F T+YIS  L + ++I  Q Y+R 
Sbjct: 501 KAKLMPWGAYYSAFFVFVIIFIQGFEAFTP-WDTTTFFTSYISLILLVVVFIGCQLYYRC 559

Query: 568 RLWRTLXXXXXXXXXXXXXXXIWEEG-PQTFWDKFWAVIA 606
           R    +               IWE+  P+  W+KFWA +A
Sbjct: 560 RFLLKVEDIDIDTDRREIEAIIWEDDEPKNLWEKFWAWVA 599

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/512 (60%), Positives = 375/512 (73%), Gaps = 2/512 (0%)

Query: 97  VEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQ 156
           V + +VKR LK RH                    P+ N+GPVG+LIAYIFMGT+++ VTQ
Sbjct: 86  VHDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQ 145

Query: 157 SLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
           SLGEMATFIPVTSS TVF+ RF+S  FG A GYMYWF+WAIT+A+E+SV+GQVI++WTFK
Sbjct: 146 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK 205

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPV 276
           VPLAAWI IFWVLI +MNFFPVK+YGEFEFWVASIKVIAI+G++IY L +VCG    GP+
Sbjct: 206 VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPI 265

Query: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336
           GFRYWR+PG  G GIIS D  EARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP
Sbjct: 266 GFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 325

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIF 396
           RAI KV  R               VPYNDP+LS++ + +++SPF+I+IQN+GTKVLP IF
Sbjct: 326 RAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVLPDIF 385

Query: 397 NAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAY 455
           NAV+L T+ISAANSNVYVGSR+LY L+ +  APK F   TR+GVP++ V+ TA  G LA+
Sbjct: 386 NAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAF 445

Query: 456 METSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGL 515
           +  +     AFNWL+NI+ +AG  AWL IS++HIRFMQ LK RG+SRDDLP+KA  MP  
Sbjct: 446 LVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWG 505

Query: 516 AYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXX 575
           AYY +FFVT+II IQGF AFAPKFD + F TAYIS  L + ++   Q Y+R R    L  
Sbjct: 506 AYYASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLED 565

Query: 576 XXXXXXXXXXXXXIWEEG-PQTFWDKFWAVIA 606
                        +WE+  PQ  W+KFWA +A
Sbjct: 566 IDIDSDRREIDAIVWEDDEPQNLWEKFWAAVA 597

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/521 (58%), Positives = 373/521 (71%), Gaps = 2/521 (0%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           EE        ++ +VKR LK RH                    P+ NAGPVGSLIAYIFM
Sbjct: 90  EESDTEEAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFM 149

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           G++V+ VTQSLGEMATFIPVTSS TVF+ RF+S  FG A GYMYWF+WAIT+A+E+SV+G
Sbjct: 150 GSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIG 209

Query: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
           QVI++WT  VPLAAWI IFWV++ +MNFFPVKVYGEFEFW+ASIKV+AI+G++IY L +V
Sbjct: 210 QVIQYWTKAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIV 269

Query: 268 CGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGE 327
           CG    GP+GFRYWR+PGPWGPGIIS    EARFLGWVSSLINAAFTYQGTELVGITAGE
Sbjct: 270 CGGSHQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGE 329

Query: 328 AANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNS 387
           AANPRKSVPRAI KV  R               VP+ND +L++  + +++SPF+I+IQN+
Sbjct: 330 AANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRLANDSAVIASSPFVISIQNA 389

Query: 388 GTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLF 446
           GT+ LP IFNAV+L TIISAANSNVYVGSR+LY L+    APK F   T+ GVP++ V+ 
Sbjct: 390 GTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVIC 449

Query: 447 TAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLP 506
           TAA G LA++  +     AFNWL+NI+ +AG  AWL IS+SHIRFMQ LK+RG+SRDDLP
Sbjct: 450 TAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLP 509

Query: 507 YKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
           +KA LMP  AYY +FFVT+II IQGF AF PKFD + F T+YIS  L   ++   Q Y+R
Sbjct: 510 FKAKLMPWGAYYASFFVTVIIFIQGFQAFTPKFDVSTFFTSYISLILLAVLFSGCQLYYR 569

Query: 567 TRLWRTLXXXXXXXXXXXXXXXIWEEG-PQTFWDKFWAVIA 606
            R    +               IWEE  P+  W+KFWA +A
Sbjct: 570 CRFIWKVEDIDIDSDRREIEAIIWEEDEPKNLWEKFWAWVA 610

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/521 (60%), Positives = 381/521 (73%), Gaps = 3/521 (0%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           +  ID T   +E  ++R LKPRH                    P+++AGPVGSLI+Y+FM
Sbjct: 36  QSQID-TASSQERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFM 94

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           G+L F VTQSLGEMATFIPV SSFTVF  RF+S   GAA GYMY FSW ITFALELS+VG
Sbjct: 95  GSLAFFVTQSLGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVG 154

Query: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
           ++I++WT  VP AAWI IFWV I + N   VK YGEF+FW+A IKVIAI+GF+IYCLCMV
Sbjct: 155 EIIQYWTLGVPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMV 214

Query: 268 CGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGE 327
           CGAG TGPVGFRYWR+PGPWG GIISK K+E RFLGWVSSL+NAAFTYQGTELVG++AGE
Sbjct: 215 CGAGKTGPVGFRYWRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGE 274

Query: 328 AANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNS 387
           +ANPRK+VP+AI+KV +R               VP+NDPKL ST +Y ++SPFIIAIQNS
Sbjct: 275 SANPRKTVPKAIRKVFLRILLFYVGSLFFIGLLVPFNDPKLDSTANYSASSPFIIAIQNS 334

Query: 388 GTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLF 446
           GT+ LP IFNAVILTTIISAANSNVYVGSR+LYGL+   LAPK   +  R+GVP+I V  
Sbjct: 335 GTRALPDIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGI 394

Query: 447 TAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLP 506
            + FG L Y+  S+G   AF+WLLNIT +AGFFAWL IS+ HIRFMQ LK++G+SRDDLP
Sbjct: 395 VSLFGFLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLP 454

Query: 507 YKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
           +KA LMP  AYY AFF+ LII+IQGFTAFAPKF+ + F  AY+S FLF+ ++++ Q  F+
Sbjct: 455 FKAKLMPWGAYYAAFFILLIIIIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVIFK 514

Query: 567 TRLWRTLXXXXXXXXXXXXXXXIWEEG-PQTFWDKFWAVIA 606
           +RL   +               +WE+  P   W KFWA +A
Sbjct: 515 SRLIHKVEDVDIDSDRREIEAEVWEDDEPTNLWGKFWAAMA 555

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/508 (59%), Positives = 371/508 (73%), Gaps = 3/508 (0%)

Query: 101 QVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160
            VKR LK RH                    P+ NAGPVGSLIAYIFMGT+++ +TQSLGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 161 MATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLA 220
           MATFIPVTSS TVF+ RF+S  FG + GYMYWF+WAIT+A+E+SV+GQVI++WT KVPLA
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLA 224

Query: 221 AWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRY 280
           AWI+IFWVLI +MNFFPVKVYGEFEFWVAS+KV+AI+G++IY L +VCG    GP+GFRY
Sbjct: 225 AWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSHQGPIGFRY 284

Query: 281 WRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIK 340
           WR+PG WGPGIISK+K+E RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPRAI 
Sbjct: 285 WRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIN 344

Query: 341 KVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVI 400
           KV  R               VPYN+P+LS + + +++SPF+I+IQN+GT  LP IFNAV+
Sbjct: 345 KVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSSAVIASSPFVISIQNAGTYALPDIFNAVV 404

Query: 401 LTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETS 459
           L T+ISAANSNVYVGSR+LY L+ +  APK F   T+ GVP++ VL TAA G LA++  +
Sbjct: 405 LITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLVVN 464

Query: 460 AGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYG 519
                AFNWL++I+ +AG  AWL IS++HIRFMQ LK RG+SRDDLP+KA LMP  AYY 
Sbjct: 465 NNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAYYA 524

Query: 520 AFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXXXXX 579
           +FFVT+II IQGF AF P F  + F T+YIS  L   ++I  Q Y++ R    L      
Sbjct: 525 SFFVTIIIFIQGFQAFCP-FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDIDID 583

Query: 580 XXXXXXXXXIWEEG-PQTFWDKFWAVIA 606
                    IWE+  P+  W+KFWA +A
Sbjct: 584 SDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/511 (60%), Positives = 372/511 (72%), Gaps = 3/511 (0%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           E+  VKR LK RH                    P+ NAGPVGSLIAYIFMGT+V+ VTQS
Sbjct: 102 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQS 161

Query: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217
           LGEMATFIPVTSS TVF+ RF+S  FG + GYMYWF+WAIT+A+E+SV+GQVIE+WT KV
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDKV 221

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVG 277
           PLAAWI+IFWV+I +MNFFPVKVYGEFEFWVAS+KV+AI+G++IY L +VCG    GP+G
Sbjct: 222 PLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGSHQGPIG 281

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
           FRYWR+PG WGPGIIS DK+E RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 282 FRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFN 397
           AI KV  R               VPYND +LS++ + +++SPF+I+IQN+GT  LP IFN
Sbjct: 342 AINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFN 401

Query: 398 AVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYM 456
           AV+L T++SAANSNVYVGSR+LY L+    APK F   TR GVP++ V+ TAA G LA++
Sbjct: 402 AVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLAFL 461

Query: 457 ETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLA 516
             +     AFNWL+NI+ +AG  AWL IS++HIRFMQ LKHRG+SRDDLP+KA LMP  A
Sbjct: 462 VVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLMPYGA 521

Query: 517 YYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXX 576
           YY AFFVT+II IQGF AF P F  + F T+YIS  L   ++I  Q Y++ R    L   
Sbjct: 522 YYAAFFVTVIIFIQGFQAFCP-FKVSEFFTSYISLILLAVVFIGCQIYYKCRFIWKLEDI 580

Query: 577 XXXXXXXXXXXXIWEEG-PQTFWDKFWAVIA 606
                       IWE+  P+  W+KFWA +A
Sbjct: 581 DIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/514 (58%), Positives = 374/514 (72%), Gaps = 2/514 (0%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G   E +VKR LKPRH                    P+  +GPVG+LIAYIF+G++V+ V
Sbjct: 49  GDCRETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYFV 108

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
           TQSLGEMATFIPVTSS TVF+ RF+S  FG A GYMYWF+WAIT+A+E++VVGQVI++WT
Sbjct: 109 TQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYWT 168

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG 274
             VPLAAWI+IFWVL+ + NFFPVK YGE EFWVAS+KVIAI+G++IY L +VCG    G
Sbjct: 169 DAVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGSHQG 228

Query: 275 PVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 334
           P+GFRYWR+PGPWGPGIISKD NE RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+
Sbjct: 229 PIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 288

Query: 335 VPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPH 394
           VPRAI KV  R               VPY+D +LS+T + +++SPF+I+IQN+GTKVLPH
Sbjct: 289 VPRAINKVFFRILFFYILSLFFIGLLVPYDDLRLSNTTAVIASSPFVISIQNAGTKVLPH 348

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGAL 453
           IFNA+++ TIISAANSNVYVGSR+LY L+ +  APK F   T+ GVP++ V+ TA  G L
Sbjct: 349 IFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLL 408

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           A++  +     AFNWL+NI+ +AG  AWL IS+SH+RFMQ LKHRG+SR+DLP+KA LMP
Sbjct: 409 AFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLMP 468

Query: 514 GLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTL 573
             AYY AFF+ +II+IQGF AF PKF  + F T+YIS  L   +++  Q ++R R   +L
Sbjct: 469 WGAYYAAFFIGVIIIIQGFKAFTPKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFIWSL 528

Query: 574 XXXXXXXXXXXXXXXIWEEG-PQTFWDKFWAVIA 606
                          +WE+  P+  W+KFW  +A
Sbjct: 529 DDIDIDSDRREIDAIVWEDDEPKNLWEKFWVAVA 562

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/514 (58%), Positives = 367/514 (71%), Gaps = 2/514 (0%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G ++E +VKR LKPRH                    P+  +GPVG+LIAYIFMGT+V+ V
Sbjct: 108 GDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYFV 167

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
           TQS+GEMATFIPVTSS TVF+SRF+S  FG A GYMYWF+WAITFA+ELSV GQVIE+WT
Sbjct: 168 TQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEYWT 227

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG 274
             VP AAWI+IFWVL+ + NFFPV+ YGE EFWVASIKV+AI+G++IY L +VCG    G
Sbjct: 228 EAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGSKQG 287

Query: 275 PVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 334
           P+GFRYWR+PGPWG GIISKDK+E RFLGWV+SLINA+FTYQGTELVGITAGEAANPR++
Sbjct: 288 PIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAANPRRT 347

Query: 335 VPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPH 394
           VPRAI KV  R               VPYN   L  T + +++SPF+I+IQN+GT+ LP 
Sbjct: 348 VPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTVIASSPFVISIQNAGTRALPD 407

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGAL 453
           IFNAV+L TIISAANSNVYVGSR+L+ L+   +APK F   T  GVPF+ V+ T+  G L
Sbjct: 408 IFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTSLLGLL 467

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           A++  +     AFNWL+NI+ +AG  AWL ISISHIRFMQ LK RG+SRDDLP+K+ LMP
Sbjct: 468 AFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMP 527

Query: 514 GLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTL 573
             AYY AF+VT+II +QGF AF+P F  T F T+YIS  L + ++  AQ ++R R +  L
Sbjct: 528 YGAYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLMLLVVVFCGAQLFYRCRFFNRL 587

Query: 574 XXXXXXXXXXXXXXXIWEEG-PQTFWDKFWAVIA 606
                          IWE+  P T W KFW  +A
Sbjct: 588 EDIDIDSDRREADALIWEDDEPTTLWGKFWTAVA 621

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/511 (59%), Positives = 369/511 (72%), Gaps = 3/511 (0%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           E+  VKR LK RH                    P+  AGPVGSLI+YIFMGT+V+ +TQS
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217
           LGEMATFIPVTSS TVF+ RF+S  FG A GYMYWF+WAIT+A+E+SV+GQVI++WT KV
Sbjct: 163 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKV 222

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVG 277
           PLA WI+IFWVLI +MNFFPVKVYGEFEFWVAS+KV+AI+G++IY L +VCG    GP+G
Sbjct: 223 PLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSHQGPIG 282

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
           FRYWR+PG WGPGIIS DKNE RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 283 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 342

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFN 397
           AI KV  R               VPYN+P+LS++ + +++SPF+I+IQN+GT  LP IFN
Sbjct: 343 AINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASSPFVISIQNAGTYALPDIFN 402

Query: 398 AVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYM 456
           AV+L T+ISAANSNVYVGSR+LY L+    APK F   T+ GVP++ VL TAA G LA++
Sbjct: 403 AVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 462

Query: 457 ETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLA 516
             +     AFNWL+NI+ +AG  AWL IS++HIRFMQ L+ RG+SRDDLP+KA LMP  A
Sbjct: 463 VVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYGA 522

Query: 517 YYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXX 576
           YY AFFVT+II IQGF AF P F  + F T+YIS  L   ++   Q Y++ R    L   
Sbjct: 523 YYAAFFVTVIIFIQGFQAFCP-FKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDI 581

Query: 577 XXXXXXXXXXXXIWEEG-PQTFWDKFWAVIA 606
                       IWE+  P+  W+KFWA +A
Sbjct: 582 DIDTDRREIEAIIWEDDEPKNLWEKFWAAVA 612

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/600 (51%), Positives = 405/600 (67%), Gaps = 18/600 (3%)

Query: 9   IELHSYHESLETQEASSWDK---KLKDKVRNEWARDRRFLHRHRGSEGEVEYAKSDEDAT 65
           I+  +  +S +T+  +S D    +++D V +E  R ++   +H  ++ +V         +
Sbjct: 8   IKARAVGDSDDTRSQTSGDGSPYEMEDIVPDEKIRLQKL--KHVSTQADVH--------S 57

Query: 66  LTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXX 125
           +T +  R                ++++A   V E +VKR LK RH               
Sbjct: 58  VTGSLTRSRLNSRVDDGAESDGSDELEAE--VHETKVKRALKQRHIGMIALGGTIGTGLF 115

Query: 126 XXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGA 185
                P+  AGPVGSLIAYIFMGT+++ VTQSLGEMATFIPVTSS TVF+ RF+S  FG 
Sbjct: 116 VGISTPLSVAGPVGSLIAYIFMGTIIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGV 175

Query: 186 ACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFE 245
           A GYMYWF+WAIT+A+E+SV+GQVI++WT  VPLAAWI+IFWVL+ +MNFFPVKVYGE E
Sbjct: 176 ANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVE 235

Query: 246 FWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWV 305
           FW+A +KV+AI+G++IY L +VCG    GP+GFRYWRHPG +GPGIISK+KN  +FLGWV
Sbjct: 236 FWIAFVKVLAIVGYLIYALVIVCGGSHQGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWV 295

Query: 306 SSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYND 365
           +SLINAAFTYQGTELVGITAGEAANPRK+VPRAI KV  R               +PYND
Sbjct: 296 ASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYND 355

Query: 366 PKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSA 425
            +LS+ D+ +++SPF+I+I+N+ TKVLP IFNAV++ T++SAANSNVYVGSR+LY L+  
Sbjct: 356 KRLSAQDAVIASSPFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALT 415

Query: 426 KLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSI 484
             APK F   TR GVP++ V+ TA+ G LA++  +     AFNWL+NI+ +AG  AWL I
Sbjct: 416 GNAPKQFSYVTRYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFI 475

Query: 485 SISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAF 544
           S++HIRFMQ LK RG+SRDDLP+KA LMP  AYY AFFVT+II IQG+ AF P +D + F
Sbjct: 476 SLAHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFCP-WDVSTF 534

Query: 545 LTAYISCFLFLFIYIVAQCYFRTRLWRTLXXXXXXXXXXXXXXXIWEEG-PQTFWDKFWA 603
            T+YIS  L   + +  Q Y+R R    L               +WE+  P+T WDKFWA
Sbjct: 535 FTSYISLILLAVLVVGCQLYYRGRFLLKLEDIDIDTDRREIESIVWEDDEPKTLWDKFWA 594

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/517 (57%), Positives = 364/517 (70%), Gaps = 2/517 (0%)

Query: 92  DATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLV 151
           D  G ++E QVKR LKPRH                    P+ +AGPVG+LIAYIFMG++V
Sbjct: 44  DDEGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIV 103

Query: 152 FSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIE 211
           + VTQS+GEMATFIPVTSS TVF++RF+S  FG A GYMYWF+WAIT+A+E+SV+GQVI+
Sbjct: 104 YFVTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQ 163

Query: 212 FWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAG 271
           +WT  VPLAAWI IFWV I + NFFPV+ YGE EFWVASIKVIAI+G+++Y L +VCG  
Sbjct: 164 YWTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGS 223

Query: 272 ITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 331
             GP+GFRYWR+PGPWG GIIS DK++ RFLGWV+SLINA+FTYQGTELVGITAGEAANP
Sbjct: 224 KQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANP 283

Query: 332 RKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKV 391
           RK+VP+AI KV  R               VPYN P L    S +++SPF+I+IQ++GT++
Sbjct: 284 RKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGLDKHTSVIASSPFVISIQSAGTRI 343

Query: 392 LPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFIAVLFTAAF 450
           LP IFNAV+L TIISAANSNVYVGSRIL+ L+   +APK F    N GVP++ V+ TA  
Sbjct: 344 LPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALL 403

Query: 451 GALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAA 510
           G LA++         FNWL+NI+ +AG  AWL ISISHIRFMQ LK RG+SRDDLP+K+ 
Sbjct: 404 GLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSK 463

Query: 511 LMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLW 570
           LMP  AYY AF+V +II +QGF AF PKF    F T YIS  L   ++ +AQ Y+R R +
Sbjct: 464 LMPYGAYYAAFWVAVIIFVQGFQAFCPKFKVAEFFTGYISLILLAVVFCLAQLYYRCRFF 523

Query: 571 RTLXXXXXXXXXXXXXXXIW-EEGPQTFWDKFWAVIA 606
             L               IW EE P T W KFW  +A
Sbjct: 524 NRLEDIDIDSDRREIDALIWEEEEPTTLWGKFWVAVA 560

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/511 (58%), Positives = 365/511 (71%), Gaps = 3/511 (0%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           E+  V+R LK RH                    P+ NAGPVGSLIAYIFMGT+V+ VTQS
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217
           LGEMATFIPVTSS TVF+ RF+S  FG + GYMYWF+WAIT+A+E+SV+GQVIE+WT KV
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKV 221

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVG 277
           PL  WI+IFWVLI +MNFFPVKVYGEFEFWVAS+KV+AI+G++IY L +VCG    GP+G
Sbjct: 222 PLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSKQGPIG 281

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
           FRYWR+PG WGPGIIS DKNE RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 282 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFN 397
           AI KV  R               VPY DP+LS++ + +++SPF+I+IQN+GT  LP IFN
Sbjct: 342 AINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASSPFVISIQNAGTYALPDIFN 401

Query: 398 AVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYM 456
           A++L T+ISAANSNVYVGSR+LY L+    APK F   T+ GVP++ VL TAA G LA++
Sbjct: 402 AIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 461

Query: 457 ETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLA 516
             +     AFNWL+NI+ +AG  AWL IS+SHIRFMQ L  RG+SRDDLP+KA  MP  A
Sbjct: 462 VVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPYGA 521

Query: 517 YYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXX 576
           YY +FFVT+II IQGF +F P F    F T+YIS  L   ++   Q Y++ R    L   
Sbjct: 522 YYASFFVTVIIFIQGFQSFCP-FRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDI 580

Query: 577 XXXXXXXXXXXXIWEEG-PQTFWDKFWAVIA 606
                       IWE+  P+  W+KFWA +A
Sbjct: 581 DIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/614 (50%), Positives = 400/614 (65%), Gaps = 43/614 (7%)

Query: 2   DNKDNASIELHSYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKSD 61
           ++ D+++    ++ E +E Q   S D  +K K+ N  +      H +  S  E E+   D
Sbjct: 18  ESNDDSTTSYDNF-EIIEIQHNDSKDNSIKKKIPN--SELASLTHAYSRSRVEPEH---D 71

Query: 62  EDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXX 121
           EDA                        E+ D     E+ QVKRELK RH           
Sbjct: 72  EDA------------------------EEAD----YEDKQVKRELKQRHIGMIALGGTIG 103

Query: 122 XXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSD 181
                    P+ +AGPVG+LIAYIFMG++V+ VTQ+LGEMATFIPVTSS TVF+ RF+S 
Sbjct: 104 TGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQALGEMATFIPVTSSITVFSQRFLSP 163

Query: 182 PFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVY 241
            FG A GYMYWF+WAITFA+E+SVVGQVI++WT  VPLAAWI+IFWVL+ +MNFFPVKVY
Sbjct: 164 AFGVANGYMYWFNWAITFAVEISVVGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFPVKVY 223

Query: 242 GEFEFWVASIKVIAIIGFIIYCLCMVCGAG-ITGPVGFRYWRHPGPWGPGIISK------ 294
           GE EFWVA +KVIAI+G+++Y L +VCG     GP+GFRYWR+PG WG G+ S       
Sbjct: 224 GEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYS 283

Query: 295 DKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXX 354
            K E RFLGWV+SLINAAFTYQGTELVGITAGEAANPRK+VPRAI KV  R         
Sbjct: 284 SKYEGRFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSL 343

Query: 355 XXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYV 414
                 VP+ D +LS   + +++SPF+I+I+N+GTK+LP IFNA+++ T++SAANSNVYV
Sbjct: 344 FFIGLLVPFTDSRLSDDTTVIASSPFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYV 403

Query: 415 GSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNIT 473
           GSR+LY L+  K+APK F + TR GVPF+ V+ T+  G LA++        AFNWL++I+
Sbjct: 404 GSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDIS 463

Query: 474 GVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFT 533
            +AG  AWL IS++H+RFMQ LK RG+SRDDLP+KA  MP  +YY AF+V +II +QGF 
Sbjct: 464 TLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQ 523

Query: 534 AFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXXXXXXXXXXXXXXIWEEG 593
           AF+P FD T F T YIS  L   ++I AQ Y+R R    L               IWE+ 
Sbjct: 524 AFSPHFDVTTFFTDYISLILLAVVFIGAQLYYRCRFLWKLEDVDIDSDRREIEDAIWEDD 583

Query: 594 -PQTFWDKFWAVIA 606
            P+T WDKFWA IA
Sbjct: 584 EPKTIWDKFWAAIA 597

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/521 (55%), Positives = 370/521 (71%), Gaps = 3/521 (0%)

Query: 89  EDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMG 148
           E+ +  G   E +VKR LK RH                    P++ AGPVGSLIAYIFMG
Sbjct: 47  EEHEQEGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMG 106

Query: 149 TLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQ 208
           T+V+S+TQSLGEMATFIPVTSS TVF+ RF+S  FG A GYMYWF+WAITFA+ELSVVGQ
Sbjct: 107 TVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQ 166

Query: 209 VIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC 268
           +I +WT  VPL AWI+IFW+++ ++NFFPV+ YGE EFW+AS+KVI I+G++IY   +VC
Sbjct: 167 IINYWTSVVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVC 226

Query: 269 GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEA 328
           G    GP+GFR WR+PGPWG G+IS ++ EARFLGWVSSLI AAFTYQGTELVGITAGE+
Sbjct: 227 GGSSQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGES 286

Query: 329 ANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSST-DSYVSASPFIIAIQNS 387
            NPRK+VP+AI KV  R               VPYNDP++ +T D+ V+ASPF+I+I+N+
Sbjct: 287 KNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPFVISIRNA 346

Query: 388 GTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLF 446
           GTK+LP IFNAV+L T++SAANSNVY+GSR++Y L+ +  APK F    R+GVP + V+ 
Sbjct: 347 GTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMV 406

Query: 447 TAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLP 506
           TA  G +A++  +   + AFNWL+NI+ +AG  AWL IS++HIRFMQ LK RG+SRD LP
Sbjct: 407 TALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALP 466

Query: 507 YKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
           +KA  MP  AYY A FV +II IQG+TAF+PKFD T F TAYIS  L L ++I  Q Y++
Sbjct: 467 FKAKFMPWAAYYAASFVFVIIFIQGYTAFSPKFDVTQFFTAYISLMLMLVVFIGCQIYYK 526

Query: 567 TRLWRTLXXXXXXXXXXXXXXXIWEEG-PQTFWDKFWAVIA 606
            R    L               +WE+  P+  WDKFW+ IA
Sbjct: 527 CRFLWKLEDIDIDTNRREIDAIVWEDDEPKNLWDKFWSTIA 567

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  592 bits (1526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/601 (50%), Positives = 386/601 (64%), Gaps = 44/601 (7%)

Query: 8   SIELHSYHESLETQEASSWDKKLKDKV--RNEWARDRRFLHRHRGSEGEVEYAKSDEDAT 65
           ++EL +Y    +  + S+   +  D +  R E   +  F+++   SE E  Y   D D  
Sbjct: 4   NVELETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMSEVESLYGNDDPD-- 61

Query: 66  LTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXX 125
                                               VKR+LKPRH               
Sbjct: 62  ------------------------------------VKRDLKPRHMSMISLGGTIGTGLF 85

Query: 126 XXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGA 185
                PI+ AGPVGSL+AY+FMGT+ F VTQSLGEMATFIPVTSSFT++  RF+S   GA
Sbjct: 86  MGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGA 145

Query: 186 ACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFE 245
           A GY+YWFSW +TFALELS++GQ+I++WTF VPL+ WI +FW+L+   N  PV+ YGE E
Sbjct: 146 ANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPLSVWIVVFWILLTASNMIPVRFYGEIE 205

Query: 246 FWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWV 305
           FW+A++KV++I GF+IY L MVCG    G +GFRYW++PGPWG G+IS +K EARFLGWV
Sbjct: 206 FWIAALKVLSIFGFLIYALVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLGWV 265

Query: 306 SSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYND 365
           SSLI AAFTYQGTELVGITAGE+ NPRK+VP+AI KV  R               VPY D
Sbjct: 266 SSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYTD 325

Query: 366 PKLSST-DSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSS 424
           P+LS+T DS ++ SPF++AIQNSGTKVLP +FN VIL TI+SA NSN+Y+GSR+LYGLS 
Sbjct: 326 PRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLYGLSK 385

Query: 425 AKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLS 483
           + LAP  F+KT + GVPF AVL ++ FG LAY+  S   +  F+WLL IT VAGFFAWL 
Sbjct: 386 SGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFFAWLL 445

Query: 484 ISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTA 543
           IS+SHIRFMQ LK RG+SR+DLP+KA  MP  AYY AFF+T+IILIQGF +FAP+F  + 
Sbjct: 446 ISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEFVFSE 505

Query: 544 FLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXXXXXXXXXXXXXXIW--EEGPQTFWDKF 601
           F+  YIS FLF+  ++  Q  F+TRL                   +W  ++ P+T   K 
Sbjct: 506 FIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDALVWSDDDEPKTLLQKL 565

Query: 602 W 602
           W
Sbjct: 566 W 566

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/520 (57%), Positives = 369/520 (70%), Gaps = 2/520 (0%)

Query: 89  EDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMG 148
           E  +  G   E +VKR LKPRH                    P+  +GPVGSLIAYIFMG
Sbjct: 60  ESEEGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMG 119

Query: 149 TLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQ 208
           ++V+ VTQSLGEMATFIPVTSS TVF+ RF+S  FG A GYMYWF+WAIT+A+ELSV+GQ
Sbjct: 120 SVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQ 179

Query: 209 VIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC 268
           +I +WT  VPLAAWI+IFWVL+   NFFPVK YGEFEF VASIKVIAI+G+++Y L +VC
Sbjct: 180 IINYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVC 239

Query: 269 GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEA 328
           G    GP+GFRYWR+PGPWG G I+K+ N+ARFLGWV SL+NA+FTYQGTELVGITAGEA
Sbjct: 240 GGSSQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEA 299

Query: 329 ANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSG 388
           +NPRK+VP+AI KV  R               VPYN P+L S  + +++SPF+I+IQN+G
Sbjct: 300 SNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLESNSAVIASSPFVISIQNAG 359

Query: 389 TKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFT 447
           TKVLP IFNAV+L TI+SA NSNVYVGSR+LY L+ +  APK F   T+ GVP++ V+ T
Sbjct: 360 TKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICT 419

Query: 448 AAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPY 507
           A  G LA++ T+     AFNWL+NI+ +AG  AW  IS++HIRFMQ LK RG+SRD LP+
Sbjct: 420 ALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPF 479

Query: 508 KAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRT 567
           KA LMP  AYY AFFV LI+ IQGFTAFAP+FD + F TAYIS  L + ++I+ Q Y+R 
Sbjct: 480 KAKLMPWGAYYAAFFVGLIVFIQGFTAFAPRFDVSEFFTAYISLILLVVLFILCQLYYRC 539

Query: 568 RLWRTLXXXXXXXXXXXXXXXIWEEG-PQTFWDKFWAVIA 606
           R    +               IWE+  P+  W+KFW  +A
Sbjct: 540 RFLTKIEDIDIDSDRREIDAIIWEDDEPKNLWEKFWVALA 579

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/604 (49%), Positives = 386/604 (63%), Gaps = 27/604 (4%)

Query: 6   NASIELHSYHESLETQEASS-WDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKSDEDA 64
           +  + + S+ +S  +Q  S+ WD +   +  + W+ D  F H      G+ E      D 
Sbjct: 28  DDQVSVSSWAQSRWSQRRSNRWDNRWSGRWNHHWSNDEDFRH------GDEEDDILAYDD 81

Query: 65  TLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXX 124
              +                   E  + A G   + QVKR LKPRH              
Sbjct: 82  DDGECD-----------------ESGLPAKGKFHDTQVKRALKPRHLGMIALGGTIGTGL 124

Query: 125 XXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFG 184
                 P+  +GPVGSLIAYIFMG++V+ VTQSLGEMATFIPVTSS TVF  RF+S   G
Sbjct: 125 FVGISEPLSRSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFTKRFLSPALG 184

Query: 185 AACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEF 244
            + GYMYWF+WAITFA ELSV GQ+I++WT+KVPLAAWI IFWV++ ++NFFPVK+YGE 
Sbjct: 185 VSNGYMYWFNWAITFATELSVTGQIIQYWTYKVPLAAWIPIFWVIVAVLNFFPVKIYGEI 244

Query: 245 EFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGW 304
           EFWV+S+KV+AI+G++IY L +VCG    GP+GFRYWRH   +G G ISK+K+EARFLGW
Sbjct: 245 EFWVSSVKVLAIVGYLIYALVIVCGGSRQGPIGFRYWRHGYAFGDGYISKNKDEARFLGW 304

Query: 305 VSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYN 364
           VSSLINAAFTYQGTELVGI+AGEAANPRK+VPRAI KV  R               VPYN
Sbjct: 305 VSSLINAAFTYQGTELVGISAGEAANPRKTVPRAINKVIFRIALFYILSLFFIGLLVPYN 364

Query: 365 DPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSS 424
           D +LS   + +++SPF+I++ N+GT  LP IFNAVIL T++SAANS+VY+ SR+LY L+ 
Sbjct: 365 DKRLSDGSAIIASSPFVISMLNAGTSALPDIFNAVILITVLSAANSDVYIASRVLYALAG 424

Query: 425 AKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLS 483
              APK F    R GVP++ V  T   G LA++  S     AFNWL+NI+ +AG  AW  
Sbjct: 425 QGNAPKQFTYVNRYGVPYLGVFVTCLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFF 484

Query: 484 ISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTA 543
           I  +HIRFMQ LKH+G+SRDDLP+KA  MP  AYY AFFV LII IQG+ AF P +D+ +
Sbjct: 485 ICFAHIRFMQALKHKGISRDDLPFKARFMPWGAYYAAFFVGLIIFIQGYDAFTP-WDTKS 543

Query: 544 FLTAYISCFLFLFIYIVAQCYFRTRLWRTLXXXXXXXXXXXXXXXIWEE-GPQTFWDKFW 602
           F T+YIS  LF  +Y+    Y+R RL   +               +WEE  P+ +W+KFW
Sbjct: 544 FFTSYISLILFGVLYLGCLIYYRGRLLIKIEDIDIDTDRKEVEAYVWEEDAPRNWWEKFW 603

Query: 603 AVIA 606
           A +A
Sbjct: 604 AAVA 607

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/587 (49%), Positives = 377/587 (64%), Gaps = 38/587 (6%)

Query: 31  KDKVRNEWARDRRFLHRHRGSEGEVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEED 90
           KD   +E +   R++ + +  E ++E        ++T A+                  ED
Sbjct: 4   KDTAVSETSTRSRYIKKGKTLENDIELQ------SVTPATGEF--------------PED 43

Query: 91  IDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTL 150
               G  +E +VKR LK RH                    P++ AGPVGSL+AYIF+GT+
Sbjct: 44  HTEEGDYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTV 103

Query: 151 VFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVI 210
           V+S+TQSLGEMATFIPVTSS TVF+ RF+S  FG A GYMYWF+WAITFA+ELSVVGQ+I
Sbjct: 104 VYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQII 163

Query: 211 EFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGA 270
           ++WT +VP+AAWI IFWVL+ ++NFFPV+ YGE EFW+AS+KV+ I+G++IY   +VCG 
Sbjct: 164 QYWTDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGG 223

Query: 271 GITGPVGFRYWRHPGPWGPGIISK--------DKNEARFLGWVSSLINAAFTYQGTELVG 322
              GP+G        P   GI ++         +    FLGWVSSLI AAFTYQGTELVG
Sbjct: 224 SKQGPIGL-------PATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVG 276

Query: 323 ITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSY-VSASPFI 381
           ITAGE+ NPRK+VP+AI KV  R               VPY+DP+L+S  S  V+ASPF+
Sbjct: 277 ITAGESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFV 336

Query: 382 IAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQ-KTRNGVP 440
           I+I+N+GTK+LP IFNAV+L T+ISAANSNVY+GSR+ Y L+ A  APK     T+ GVP
Sbjct: 337 ISIKNAGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVP 396

Query: 441 FIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGM 500
           +  VL T+  G ++++  +     AF+WL+NI+ +AG  AWL IS++HIRFMQ LKHRG+
Sbjct: 397 YFGVLITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGI 456

Query: 501 SRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIV 560
           SRDDLP+KA  MP  AYY  FFVT+II IQG+TAF PKFD T F T+YIS FL L ++I 
Sbjct: 457 SRDDLPFKAKFMPWAAYYATFFVTVIIFIQGYTAFTPKFDVTTFFTSYISLFLMLLVFIG 516

Query: 561 AQCYFRTRLWRTLXXXXXXXXXXXXXXXIWEEG-PQTFWDKFWAVIA 606
            Q Y++ R    +               +WEE  P+  WDKFW+ +A
Sbjct: 517 CQIYYKCRFLWAVEDIDIDSDRREIDAIVWEEDEPKNIWDKFWSAVA 563

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/509 (54%), Positives = 353/509 (69%), Gaps = 5/509 (0%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
            ++ VKRELKPRH                    PI+NAGPVGSL+AYIF+ T+ + VTQS
Sbjct: 45  NQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQS 104

Query: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217
           LGEMATFIPVTSSFTVFASRFVS   GAA GY+YW SW ITFALE+SV+G++I +W+  V
Sbjct: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVG 277
           P+ AW++IFWVL+  +N  PVK YGEFEFW+AS+KVIAI+ F+ Y L +VCG    G +G
Sbjct: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
           FRYW+ PGPWG GI+S++ + A+FLGWVSSLI AAFT+QGTELVG+TAGE  NPR++VP+
Sbjct: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL--SSTDSYVSASPFIIAIQNSGTKVLPHI 395
           AI  V  R               V Y+DP+L    + +  +ASPF++AI  +GTKVLP I
Sbjct: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344

Query: 396 FNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFIAVLFTAAFGALA 454
            N VI+ TIISA NSN+YVGSR+LYGL  + LAP F  +T + GVP++AVL T+ FGAL 
Sbjct: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404

Query: 455 YMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPG 514
           Y+  S+   + F+WLL+IT V+GFF WL IS+SHIRFMQ LK RG+SRDDLP+KA  MP 
Sbjct: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464

Query: 515 LAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTL- 573
            AYY AFFV +IIL+QGFTAF P F +  F+  YIS F+F+ I+++ Q  F+ R + T+ 
Sbjct: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVD 523

Query: 574 XXXXXXXXXXXXXXXIWEEGPQTFWDKFW 602
                            ++ P T W K W
Sbjct: 524 EIDIDTDRRDIDAIIWDDDKPTTLWGKIW 552

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/492 (37%), Positives = 274/492 (55%), Gaps = 9/492 (1%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           ++D    G  E  +++++LK RH                     +  AGP+   IAY F+
Sbjct: 72  QDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYAFV 131

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           G LVF    +LGEMA++IP+   FT +ASR+     G A GY Y   + I    +L+   
Sbjct: 132 GVLVFFTMAALGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAA 190

Query: 208 QVIEFWTFK--VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLC 265
            VI++W  +  V    WI+IF V+IV MNF  VK +GEFEFW+++ KVI +IG II    
Sbjct: 191 LVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFV 250

Query: 266 MVCGAGITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGIT 324
           ++ G G T   +GFR++ HPG + P   S D ++ +F+ +V+ L+ A F Y G EL GI 
Sbjct: 251 IMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGIELTGIV 310

Query: 325 AGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDP---KLSSTDSYVSASPFI 381
           A EAANPRKS+P+AIK    R               V Y+DP   K  ++ +  +ASP++
Sbjct: 311 AAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAASPYV 370

Query: 382 IAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVP 440
           +AI NSG K LPHIFNA +L  + SA NS++YV SR LYGL+    APK F  T R GVP
Sbjct: 371 VAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVP 430

Query: 441 FIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGM 500
           + ++L ++ F  LAYM  S+G    FN+ +N+  + G  +W+SI I+++ F + +K + +
Sbjct: 431 YYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNV 490

Query: 501 SRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP-KFDSTAFLTAYISCFLFLFIYI 559
            R    Y+A   P  +Y+   F  LI  I+ FT F    FD   F+T YI   +F+  Y 
Sbjct: 491 DRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYF 550

Query: 560 VAQCYFRTRLWR 571
             +   +T++W+
Sbjct: 551 GYKFVKKTKIWK 562

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  322 bits (824), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/495 (37%), Positives = 269/495 (54%), Gaps = 12/495 (2%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           + DI   G  E  ++K+ LK RH                     +  AGP    I Y F+
Sbjct: 50  DRDIFDDGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFV 109

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           G LVF     LGEMA FIP+   FT +ASR+V    G A GY Y   + I  A +L+   
Sbjct: 110 GVLVFFTMSCLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGA 168

Query: 208 QVIEFWTFKVPL--AAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLC 265
            V+++W  +  L    +I+IF +LIV +N F VK++GEFEFW++S KV+ ++G I+    
Sbjct: 169 MVVQYWVDRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFI 228

Query: 266 MVCGAGITGP-VGFRYWRHPG---PWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELV 321
           ++ G G     +GFRYWR PG   P+   IIS   +  +F+ + S  + A F Y G EL 
Sbjct: 229 IMLGGGPNHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELT 288

Query: 322 GITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDP---KLSSTDSYVSAS 378
           GI A EA NPRK++P+AIK    R               V YNDP   K +   +  +AS
Sbjct: 289 GIVAAEAQNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAAS 348

Query: 379 PFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN- 437
           PF++AI+NSG  +LPHIFN  +L  ++SAANS++YV SR LY L+    APKFF KT   
Sbjct: 349 PFVVAIENSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKW 408

Query: 438 GVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKH 497
           G+P+ ++ F+ AF  LAYM  S+   N FN+ +N   + G  +W+ I +++I F +  K 
Sbjct: 409 GIPYWSLAFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKA 468

Query: 498 RGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLF 556
           +GM + +  Y A   P  AY+  FF  ++ L++ FT F   +FD   F+T YI   +F  
Sbjct: 469 QGMDKSNFTYVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFI 528

Query: 557 IYIVAQCYFRTRLWR 571
            ++  +  ++T+  R
Sbjct: 529 CFVGYKIVYKTKTHR 543

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  318 bits (815), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/493 (37%), Positives = 273/493 (55%), Gaps = 10/493 (2%)

Query: 88  EEDID--ATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYI 145
           E+D +  + G  +  ++K+ELK RH                     ++  GP   LIAY 
Sbjct: 34  EDDSNKISDGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYS 93

Query: 146 FMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSV 205
           F+G LVF V   LGEMAT+IP+   FT +A+R+     G A GY Y F + I    +L+ 
Sbjct: 94  FVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTA 152

Query: 206 VGQVIEFWTFK--VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYC 263
              VI++W  +  V    WI+IF V+IVI+N   V+ +GEFEFW++S K++ + G I++ 
Sbjct: 153 GALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFL 212

Query: 264 LCMVCGAGIT-GPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVG 322
             ++ G G     +GFRYW++PG + P   S   ++ +F+ +V+  + A F Y G EL G
Sbjct: 213 FIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTG 272

Query: 323 ITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASP 379
           I A EA NPR+++PRAIK    R               V YNDP+L   +   +  +ASP
Sbjct: 273 IVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASP 332

Query: 380 FIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNG 438
           F++AIQNSG + LPHIFN  +L  + SA NS++YVG+R LY L+    APK F KT R G
Sbjct: 333 FVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWG 392

Query: 439 VPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHR 498
           VP+ A+     F  LAYM  S+G    FN+ +N+  + G  +W+SI I++I F +    +
Sbjct: 393 VPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQ 452

Query: 499 GMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIY 558
            + R+   Y+A   P  AY   FF  LI  I+ FT F  +FD  +F+T YI   L++  Y
Sbjct: 453 NVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFY 512

Query: 559 IVAQCYFRTRLWR 571
              +  ++T+L +
Sbjct: 513 FGYKIIYKTKLVK 525

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  312 bits (799), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 184/492 (37%), Positives = 269/492 (54%), Gaps = 15/492 (3%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           E  ++  G  +  ++K+EL+ RH                     +  AGPV  LIAY F+
Sbjct: 41  ESHLNIDGKHDGIRLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFV 100

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           G LV+ V   LGEMAT+IP+   FT +ASR+     G A GY Y F + I    +L+   
Sbjct: 101 GFLVYIVMTCLGEMATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAA 159

Query: 208 QVIEFWTF--KVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLC 265
            V+++W    KV    WI+IF V+IV +N   VK +GEFEFW++S KV+ ++  I+    
Sbjct: 160 LVLQYWVSREKVNPGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFV 219

Query: 266 MVCGAGITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGIT 324
           ++ G G +   +GFR+++ PG + P   +   ++ +F+ +V+  + A F Y GTEL GI 
Sbjct: 220 IMLGGGPSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIV 279

Query: 325 AGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASPFI 381
           A E  NPR++VPRAIK    R               V YNDP L       +  +ASPF+
Sbjct: 280 AAECKNPRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFV 339

Query: 382 IAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVP 440
           +AI+N+G  VLPHIFNA +L  + SA NS++YV SR LYGL+    APK F KT   GVP
Sbjct: 340 VAIKNAGIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVP 399

Query: 441 FIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGM 500
           + +++    F  LAYM  S+G    FN+ +N+  + G  +W++I I++I F + L+ +G+
Sbjct: 400 YNSLILCILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGV 459

Query: 501 SRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYI 559
            +  L Y A L    AY+  FF  LI LI+ FT F   KFD   F+T YI   +F+    
Sbjct: 460 DKSTLAYAAPLASKGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFII--- 516

Query: 560 VAQCYFRTRLWR 571
              C+F  +  R
Sbjct: 517 ---CFFGYKYIR 525

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  313 bits (801), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 180/485 (37%), Positives = 270/485 (55%), Gaps = 12/485 (2%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G  +  ++K++LK RH                     ++ AGP   LIAY F+GTLVF  
Sbjct: 75  GKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFT 134

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
             +LGEMA +IP+   FT +ASR+     G A GY Y F + I    +L+    VI++W 
Sbjct: 135 MAALGEMAAYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWV 193

Query: 215 FK--VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGI 272
            +  V    WI+IF V+I+ +N   VK +GEFEFW++S K++ +IG +I+   ++ G G 
Sbjct: 194 DRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGP 253

Query: 273 TGP-VGFRYWRHPG---PWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEA 328
               +GFRYW+ PG   P+   +++ + +  +F+ +V+  + A F Y G EL GI A EA
Sbjct: 254 NHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEA 313

Query: 329 ANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASPFIIAIQ 385
            NPR+++PRAIK    R               V Y+DP L   ++  +  +ASPF++AIQ
Sbjct: 314 ENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQ 373

Query: 386 NSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAV 444
           NSG  VLPHIFN  +L  + SA NS++YVG+R LY L+    APK F KT R GVP+ A+
Sbjct: 374 NSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAM 433

Query: 445 LFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDD 504
                F  LAYM  S+G    FN+ +N+  + G  +W SI I+ I F + ++ +G+ R  
Sbjct: 434 GGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRST 493

Query: 505 LPYKAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQC 563
             Y A   P  +Y+  FF  L+ LI+ F+ F   +FD   F+T YI   ++ F +I  + 
Sbjct: 494 FAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYKL 553

Query: 564 YFRTR 568
           Y++T+
Sbjct: 554 YYKTK 558

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  306 bits (785), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 190/532 (35%), Positives = 284/532 (53%), Gaps = 21/532 (3%)

Query: 48  HRGSEGEVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELK 107
            + + G +   ++ E+  +T  S+  VR             E +D  G  E  ++K+EL+
Sbjct: 8   EKKNAGVLYSNETLEEGIVTLESEGQVRSV----------SEGVD--GKHEGIRLKKELE 55

Query: 108 PRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPV 167
            RH                     + +AGPV  LI+Y F+G LV++V   LGEMA FIP+
Sbjct: 56  ARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPL 115

Query: 168 TSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK--VPLAAWISI 225
              FT +ASR+V    G A GY Y F + I    +L+    V++FW  +  V    WI+I
Sbjct: 116 -DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITI 174

Query: 226 FWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT-GPVGFRYWRHP 284
           F  LIV++N   V+ +GEFEFW++S+KV+ ++G I+    ++ G G      GFR+WR P
Sbjct: 175 FLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDP 234

Query: 285 GPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSV 344
           G + P   +   ++ +F+ + S    A F Y GTEL GI A EA NPR+SVPRAIK    
Sbjct: 235 GAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLY 294

Query: 345 RXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASPFIIAIQNSGTKVLPHIFNAVIL 401
           R               V YNDP+L       +  +ASPF++AI+N+   VLPHIFN  +L
Sbjct: 295 RIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVL 354

Query: 402 TTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFIAVLFTAAFGALAYMETSA 460
             + SA NS++YV SR LYGL+    AP+ F  T   GVP+ ++  +  F  LAYM  S+
Sbjct: 355 VFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSS 414

Query: 461 GGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGA 520
           G    FN+ +N+  + G  +W++I I++IRF + ++ +   +  L Y AA  P   Y   
Sbjct: 415 GSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVAL 474

Query: 521 FFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571
           FF  LI LI+ +T F   KFD   F++ YI   ++L  Y+  +  +RT+L +
Sbjct: 475 FFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIK 526

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  307 bits (786), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 179/479 (37%), Positives = 261/479 (54%), Gaps = 9/479 (1%)

Query: 102 VKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEM 161
           +K+ L+ RH                     +  AGP    IAY F+G LVF    ++GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 162 ATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK--VPL 219
           A++IP+   FT +ASR+V    G A GY Y F + I    +L+    VI++W  +  V  
Sbjct: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217

Query: 220 AAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP-VGF 278
             WI+IF V+IVI+N   VK +GEFEFW++S KV+ ++G I+    ++ G G     +GF
Sbjct: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGF 277

Query: 279 RYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 338
           RYW+HPG + P   + D +  +F+ +VS  + A F Y G EL GI A EA NPRKSVPRA
Sbjct: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337

Query: 339 IKKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASPFIIAIQNSGTKVLPHI 395
           +K    R               V YNDP+L       +  +ASPF++AIQNSG +VLPHI
Sbjct: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHI 397

Query: 396 FNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFIAVLFTAAFGALA 454
           FNA +L  + SA NS++YVGSR LY L+    AP  F++T + G+P  ++     F  LA
Sbjct: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457

Query: 455 YMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPG 514
           YM  S+G    FN+ +N+  + G  +W+ I I++I FM+ +K +G+ R    Y A   P 
Sbjct: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517

Query: 515 LAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRT 572
             Y+   +   I  I+ FT F    FD   F+T YI   +F+  Y   +   +T++ ++
Sbjct: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKS 576

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  305 bits (780), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 183/486 (37%), Positives = 267/486 (54%), Gaps = 9/486 (1%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G  E  +++++LK RH                     +   GPV  LIAY F+G LVF  
Sbjct: 74  GKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFFT 133

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
              LGEMA++IP+   FT +ASR+V    G A GY Y F + I    +L+    VI++W 
Sbjct: 134 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWV 192

Query: 215 FK--VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGI 272
            +  V    WI+IF V+IV +N   VK +GEFEFW++S KV+ ++G I+    ++ G G 
Sbjct: 193 SRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGP 252

Query: 273 TGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 331
               +GFRYWR PG +     +    + +F+ +++  + + F+Y G EL GI   EA NP
Sbjct: 253 DHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNP 312

Query: 332 RKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYV---SASPFIIAIQNSG 388
           RKSVP+AIK    R               V YNDP+L ST       +ASPF++AIQNSG
Sbjct: 313 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNSG 372

Query: 389 TKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFIAVLFT 447
            KVLPHIFNA +L  + SA NS++YV SR LY L+    APK F KT   GVP+ A++F+
Sbjct: 373 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFS 432

Query: 448 AAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPY 507
             F  LAYM  SAG    FN+ +N+  + G  +W++I I +I F +  + +G+ +    Y
Sbjct: 433 VLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 492

Query: 508 KAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
            A      AY+   F   I LI+ FT F   KFD   F+T YI   +++F ++  +  ++
Sbjct: 493 VAPGQRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVYVFSWVGYKLIYK 552

Query: 567 TRLWRT 572
           T++ ++
Sbjct: 553 TKVIKS 558

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  303 bits (776), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 185/488 (37%), Positives = 265/488 (54%), Gaps = 9/488 (1%)

Query: 93  ATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVF 152
           A G  E  ++K+ELK RH                     +   GPV  LIAY F+G LVF
Sbjct: 71  ADGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVF 130

Query: 153 SVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEF 212
                LGEMA++IP+   FT +ASR+V    G A GY Y F + I    +L+    VI++
Sbjct: 131 FTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189

Query: 213 WTFK--VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGA 270
           W  +  V    WI+IF V+IV +N   VK +GEFEFW++S KV+ ++G I+    ++ G 
Sbjct: 190 WISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGG 249

Query: 271 GITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAA 329
           G     +GFRYWR PG +     +   +  +F  +V+  + + F+Y G EL GI   EA 
Sbjct: 250 GPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAE 309

Query: 330 NPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSY---VSASPFIIAIQN 386
           NPRKSVP+AIK    R               V YNDP+L ST       +ASPF++AIQN
Sbjct: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQN 369

Query: 387 SGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFIAVL 445
           SG KVLPHIFNA +L  + SA NS++YV SR LY L+    APK F KT   GVP+ A++
Sbjct: 370 SGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALI 429

Query: 446 FTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDL 505
            +  F  LAYM  S+G    FN+ +N+  + G  +W++I I +I F +  + +G+ +   
Sbjct: 430 LSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKF 489

Query: 506 PYKAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQCY 564
            Y A      AY+   F  LI LI+ FT F   KFD   F+T YI   +++  +   +  
Sbjct: 490 AYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLI 549

Query: 565 FRTRLWRT 572
           ++T++ ++
Sbjct: 550 YKTKVIKS 557

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  303 bits (776), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 183/486 (37%), Positives = 267/486 (54%), Gaps = 9/486 (1%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G  E  +++++LK RH                     +   GPV  LIAY F+G LVF  
Sbjct: 75  GKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFYT 134

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
              LGEMA++IP+   FT +ASR+V    G A GY Y F + I    +L+    VI++W 
Sbjct: 135 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193

Query: 215 FK--VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGI 272
            +  V    WI+IF V+IV +N   VK +GEFEFW++S KV+ ++G I+    ++ G G 
Sbjct: 194 SRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 253

Query: 273 TGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 331
               +GFRYWR PG +     +    + +F+ +V+  + + F+Y G EL GI   EA NP
Sbjct: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313

Query: 332 RKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSY---VSASPFIIAIQNSG 388
           RKSVP+AIK    R               V YNDP+L ST       +ASPF++AIQNSG
Sbjct: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373

Query: 389 TKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFT 447
            +VLPHIFNA +L  + SA NS++YV SR LY L+    APK F KT R GVP+ A++ +
Sbjct: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433

Query: 448 AAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPY 507
             F  LAYM  S+G    FN+ +N+  + G  +W++I I +I F +  + +G+ +    Y
Sbjct: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493

Query: 508 KAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
            A      AY+  FF  LI LI+ FT F   KFD   F+T YI   +++  +   +  ++
Sbjct: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553

Query: 567 TRLWRT 572
           T++ ++
Sbjct: 554 TKVIKS 559

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  302 bits (773), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 182/485 (37%), Positives = 265/485 (54%), Gaps = 9/485 (1%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G  E  +++++LK RH                     +   GPV  LIAY F+G LVF  
Sbjct: 73  GKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFFT 132

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
              LGEMA++IP+   FT +ASR+V    G A GY Y F + I    +L+    VI++W 
Sbjct: 133 MACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWV 191

Query: 215 FK--VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGI 272
            +  V    WI+IF V+IV +N   V+ +GEFEFW++S KV+ ++G I+    ++ G G 
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 273 TGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 331
               +GFRYWR PG +     +   ++ +F+ + S  + + F+Y G EL GI   EA NP
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNP 311

Query: 332 RKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYV---SASPFIIAIQNSG 388
           RKSVP+AIK    R               V YNDP+L ST       +ASPF++AIQNSG
Sbjct: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSG 371

Query: 389 TKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFIAVLFT 447
            KVLPHIFN  +L  + SA NS++YV SR LY L+    APK F KT   GVP+ A++ +
Sbjct: 372 IKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVS 431

Query: 448 AAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPY 507
             F  LAYM  SAG    FN+ +N+  + G  +W++I I +I F +  + +G+ +    Y
Sbjct: 432 VLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAY 491

Query: 508 KAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
            A      AY+  FF  LI LI+ FT F    FD   F+T YI   +++F ++  +  ++
Sbjct: 492 VAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYK 551

Query: 567 TRLWR 571
           T++ +
Sbjct: 552 TKVVK 556

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  302 bits (774), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 177/473 (37%), Positives = 259/473 (54%), Gaps = 14/473 (2%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G  E  ++K++LK RH                     ++ AGPV +LIAY F+G +VF  
Sbjct: 58  GKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFT 117

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
              LGEMATFIP+   FT +ASR+     G A GY Y   + I    +L+    V+++W 
Sbjct: 118 MACLGEMATFIPL-DGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWV 176

Query: 215 FK--VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIG-----FIIYCLCMV 267
            +  V    W+++ + +I ++N F V+ +GEFEFW++S+KV+ +IG     F+I    M+
Sbjct: 177 PRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVI----ML 232

Query: 268 CGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGE 327
            GAG    +GFRYW+HPG +         +  +F+ +V+ L+   F Y G EL GI A E
Sbjct: 233 GGAGSHDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAE 292

Query: 328 AANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSST-DSYVSASPFIIAIQN 386
           A+NPR+SVP+AIK    R               VPYND KL +T ++ ++ASPF IAI N
Sbjct: 293 ASNPRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAILN 352

Query: 387 SGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVL 445
           +G  VLP IFN  +L  + SAANS++YV SR LY L+    APK F  T R G+P+ ++ 
Sbjct: 353 AGITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLF 412

Query: 446 FTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDL 505
            +  F  LAYM  S+     F + +N+  +AG   W+SI I++I F + ++ + + +   
Sbjct: 413 VSCLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTF 472

Query: 506 PYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIY 558
            Y A   P  AY   FF  LI +I+ FT F   FD   F+T YI   +F+  Y
Sbjct: 473 AYVAPFQPYGAYVSLFFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCY 525

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  301 bits (770), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 170/485 (35%), Positives = 263/485 (54%), Gaps = 25/485 (5%)

Query: 101 QVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160
           ++K++L+ RH                     +  AGP+  LIAY  MG +VF+V   LGE
Sbjct: 57  RLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTVMSCLGE 116

Query: 161 MATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTF--KVP 218
           MA +IP+   FT +A+R+     G A GY Y F + +    +L+    V+++W    KV 
Sbjct: 117 MAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRGKVN 175

Query: 219 LAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT----- 273
              WI++F  +I+ +N   VK +GEFEFW++S KV+ +       LC++    +      
Sbjct: 176 PGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVM-------LCVMTLLLVLVLGGG 228

Query: 274 ---GPVGFRYWRHPGPWGP--GIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEA 328
                +GFRYW+ PG + P  G +S    + +F+ + S  + A F Y GTEL GI A E 
Sbjct: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288

Query: 329 ANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTD---SYVSASPFIIAIQ 385
            NPR++VPRAIK    R               V YNDP L  T    +  +ASP+++AI+
Sbjct: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIK 348

Query: 386 NSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFIAV 444
           N+G  VLPHIFNA +LT + SA NS++YVGSR LYGL+  K APK F KT + GVP+ ++
Sbjct: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408

Query: 445 LFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDD 504
                F  LAYM  S+  +  F++ +N+T + G  +W+SI I++I F +  + +G+ ++ 
Sbjct: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468

Query: 505 LPYKAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQC 563
           L Y+A   P  A+    F  ++ L++ FT F    FD   F+T YI   +++  ++  + 
Sbjct: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKI 528

Query: 564 YFRTR 568
             +T+
Sbjct: 529 VHKTK 533

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  300 bits (769), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 179/490 (36%), Positives = 265/490 (54%), Gaps = 9/490 (1%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
            +  +  G  E  ++K+ L+ R                      +  AGPV  LIAY F+
Sbjct: 57  NDSYNVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFV 116

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           G LVF    SLGEMA++IP+   FT +A+R+     G A GY Y F + I    +L+   
Sbjct: 117 GLLVFFTMASLGEMASYIPL-DGFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAA 175

Query: 208 QVIEFWT--FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLC 265
            VI++W    KV    WI+IF V+IV +N   V+ +GEFEFW++S KV+ +   II    
Sbjct: 176 LVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFI 235

Query: 266 MVCGAGITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGIT 324
           ++ G G     +GFR+W+HPG +     +   +  +F+ +VS  + A F Y GTELVGI 
Sbjct: 236 LMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIV 295

Query: 325 AGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASPFI 381
            GEA NPRKSVP+AIK    R               V Y+DP L    +  +  +ASPF+
Sbjct: 296 VGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFV 355

Query: 382 IAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVP 440
           +AI NSG KVLPHIFNA +L  + SA NS++YV SR LY L+    APK F +T R G+P
Sbjct: 356 VAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIP 415

Query: 441 FIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGM 500
           + ++  +  F  LAYM  S+G    FN+ +N+  + G  +W+ I ++++ F + ++ +G+
Sbjct: 416 YYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGI 475

Query: 501 SRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYI 559
            +    Y A      AY+  FF +LI LI+ FT F   +FD   F+T YI   +F   Y 
Sbjct: 476 DKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYKTFITGYIGIPVFFISYF 535

Query: 560 VAQCYFRTRL 569
             +  ++T++
Sbjct: 536 GYKLIYKTKI 545

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  300 bits (768), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 178/477 (37%), Positives = 262/477 (54%), Gaps = 9/477 (1%)

Query: 101 QVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160
           ++K+ L+ RH                     +  AGP   LIAY F+G LVF V   LGE
Sbjct: 78  RLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFVMSCLGE 137

Query: 161 MATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTF--KVP 218
           MA +IP+   FT +++R+     G A GY Y F + I    +L+    VI++W    KV 
Sbjct: 138 MAAYIPL-DGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVN 196

Query: 219 LAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPV-G 277
              WI+I  V I+ +NF  V+ +GE E++++++K+  ++G II  L + CG G    V G
Sbjct: 197 PGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGPNHEVLG 256

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
           F+YW++PG +     +    + RF+ + S  + A F Y GTEL GI   E  NPRK+VP+
Sbjct: 257 FKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPK 316

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDS---YVSASPFIIAIQNSGTKVLPH 394
           AIK    R               VP+NDP L S  S     SASPF++AI N+G  VLPH
Sbjct: 317 AIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAGIPVLPH 376

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGAL 453
           I NA IL  + SAANS++YV SR LYGL+    AP+ F KT + GVP+ ++L    F  L
Sbjct: 377 IMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALL 436

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           AYM  S+G    F + +N   + G  +W+SI I++IRF +  + +G+ +  L Y++ L P
Sbjct: 437 AYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQP 496

Query: 514 GLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRL 569
             A++  FF  LI LI+ F AF    FD  +F+T YI    ++  YI  + +++T++
Sbjct: 497 YGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYKTKI 553

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  298 bits (763), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 183/494 (37%), Positives = 267/494 (54%), Gaps = 9/494 (1%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
            +  +  G  E  ++K+ LK RH                     +  AGPV +LIAY F+
Sbjct: 54  NDSYNIDGKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFV 113

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           G LVF     LGEMAT+IP+   FT +ASR+     G A GY Y F + I    +L+   
Sbjct: 114 GLLVFFTMACLGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAA 172

Query: 208 QVIEFWTFK--VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLC 265
            VI++W  K  V    W++IF V+IV +N F V+ +GEFEFW++S KV+ ++G ++    
Sbjct: 173 LVIQYWVDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFI 232

Query: 266 MVCGAGITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGIT 324
           ++ G G     +GFRYWRHPG +     +   +  RF+ +VS  + A + Y G EL GI 
Sbjct: 233 LMLGGGPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIV 292

Query: 325 AGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDP---KLSSTDSYVSASPFI 381
           A EA NPRKS+P+AIK    R               V Y+DP   K  ++ +  +ASPF+
Sbjct: 293 AAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFV 352

Query: 382 IAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVP 440
           +AI NSG   LPHI NA +L  + SA NS++YV SR LY L+    APK F KT R G+P
Sbjct: 353 VAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIP 412

Query: 441 FIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGM 500
           + A+  +  F  LAYM  S+     FN+ +N+  + G  +W+SI I++I F + ++ +G+
Sbjct: 413 YYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGV 472

Query: 501 SRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP-KFDSTAFLTAYISCFLFLFIYI 559
            +    Y A   P  A++  FF  LI LI+ FT F   +FD   F+T YI   +F F Y 
Sbjct: 473 DKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYF 532

Query: 560 VAQCYFRTRLWRTL 573
             +  ++T++   L
Sbjct: 533 GYKFTYKTKVIDPL 546

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  296 bits (759), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 180/485 (37%), Positives = 263/485 (54%), Gaps = 9/485 (1%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G  E  ++K+ L+ RH                     + +AGP   LI+Y F+G LV++V
Sbjct: 44  GKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTV 103

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
              LGEMA FIP+   FT +ASR+V    G A GY Y F + I    +L+    V+++W 
Sbjct: 104 MACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162

Query: 215 F--KVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGI 272
              KV    WI+IF VLIV++N   V+ +GEFEFW++S+KV+ ++G I+    ++ G G 
Sbjct: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP 222

Query: 273 TGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 331
                GFRYWR PG + P   +   ++ +F+ + S    A F Y GTEL GI A EA NP
Sbjct: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNP 282

Query: 332 RKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDP---KLSSTDSYVSASPFIIAIQNSG 388
           R+SVPRAIK    R               V YNDP   K     +  +ASPF++AI+N+G
Sbjct: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAG 342

Query: 389 TKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFIAVLFT 447
             VLPHIFNA +L  + SA NS++YV SR LYGL+  + APK F KT   GVP+ ++  +
Sbjct: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402

Query: 448 AAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPY 507
             F  LAYM  S+G    FN+ +N+  + G  +W+SI I+++RF + +  +   +    Y
Sbjct: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462

Query: 508 KAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
            A   P   +   FF  LI LI+ +T F    FD   F++ YI   ++   Y+  +   R
Sbjct: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522

Query: 567 TRLWR 571
           ++L +
Sbjct: 523 SKLIK 527

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  293 bits (751), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 184/485 (37%), Positives = 261/485 (53%), Gaps = 9/485 (1%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G   + ++K++LK RH                     +  AGPV  LI+Y F+G LVF V
Sbjct: 55  GKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFV 114

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
              +GEMA +IP+   FT +ASR+     G A GY Y   + I    +L+    VI++W 
Sbjct: 115 MSCIGEMAAYIPL-DGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWI 173

Query: 215 --FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGI 272
              KV    WI+I  V+IV++N F VK +GEFEFW++S KVI ++G II    ++ G   
Sbjct: 174 PREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTP 233

Query: 273 TGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 331
           T   +GFRYW+HPG +     S   +  RF+ +VS  +   F Y G EL GI A EA NP
Sbjct: 234 THDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENP 293

Query: 332 RKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASPFIIAIQNSG 388
           RK++P+AIK    R               V  NDP L    +  +  +ASPF++AI NSG
Sbjct: 294 RKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSG 353

Query: 389 TKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFT 447
            + LPHIFNA +L  + SA NS++YV SR LY L+    APK F KT R G+P+ ++   
Sbjct: 354 IEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVA 413

Query: 448 AAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPY 507
             F  LAYM  S+G    FN+ +N+  + G   W+SI I++I F + ++ +G+ +    Y
Sbjct: 414 VLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAY 473

Query: 508 KAALMPGLAYYGAFFVTLIILIQGFTAFAP-KFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
            A L P  AY+  FF  L+ LI+ FT F   KFD   F+T YI   LF   Y   +   +
Sbjct: 474 VAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICYFGYKFVKK 533

Query: 567 TRLWR 571
           T++ +
Sbjct: 534 TKIRK 538

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  280 bits (715), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 161/489 (32%), Positives = 252/489 (51%), Gaps = 14/489 (2%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
            E+ID     +   + RELKPR                      +   GP+   IAY+F 
Sbjct: 22  SEEIDE----KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFT 77

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           G+L+  V  SL EMA+F P+   F+ + +R+V   FG A G+ Y+  +AI  +  L+  G
Sbjct: 78  GSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFG 137

Query: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
            VI +W   V +  W+++ +V +  +NF  VK +GE E  +   K++ ++   I CL + 
Sbjct: 138 LVIGYWRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIIT 197

Query: 268 CGAGIT-GPVGFRYWRHPG--PWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGIT 324
           CG        GFRYWR  G  P+  G         +FLGW + ++ + F + G+E++GI 
Sbjct: 198 CGGAPNHTTTGFRYWRESGALPYLVG-----GGTGKFLGWWACVVQSIFGFMGSEMIGIV 252

Query: 325 AGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXV-PYNDPKLSSTDSYVSASPFIIA 383
            GE ANP+K++P++   V  R               + P N   + +  +  +ASPF+IA
Sbjct: 253 YGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIA 312

Query: 384 IQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPK-FFQKTRNGVPFI 442
           I +SG KVLP+  NA +L  IIS+AN+++Y+ SR LYGL+    APK F    R  VP +
Sbjct: 313 ISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVV 372

Query: 443 AVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSR 502
             +  +  G LAYM T       F+++ +   V G   W  I I++I + + +K +G+S 
Sbjct: 373 GCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISI 432

Query: 503 DDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQ 562
           DD+P++    P  AY   FFVT+I    G+ AF  KF    F+T+YI  F  + + I  +
Sbjct: 433 DDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFIIKFHYKTFITSYIGVFANILMVIGYK 492

Query: 563 CYFRTRLWR 571
            YF+T+  +
Sbjct: 493 LYFKTKFVK 501

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  280 bits (715), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 180/568 (31%), Positives = 281/568 (49%), Gaps = 52/568 (9%)

Query: 27  DKKLKDKVRNEWARD--RRFLHRHRGSEGEVEYAKSDEDATLTKASKRHVRXXXXXXXXX 84
           D KL+ +V    ++   + F    R  E EV  + +  +  +    K++           
Sbjct: 3   DTKLESEVETSISKSWTKLFSSFKRMEEVEVVESLTKSNYDVQVMGKKY----------- 51

Query: 85  XXXEEDIDATGVVEEA---------QVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNA 135
               ED+D    VE+A          + R+L  RH                     +   
Sbjct: 52  ----EDMDD---VEKAIFNTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIG 104

Query: 136 GPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSW 195
           GP   +IA+  + T +F++  +LGE+A   PV   F V+ +R V    G A    Y   W
Sbjct: 105 GPASLVIAWTIISTCLFTIVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQW 164

Query: 196 AITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIA 255
           A+   LEL      I +W   V   AW+++F+V I + +   VK +GE EF ++ +K++A
Sbjct: 165 AVLLPLELVAASITIRYWNNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILA 224

Query: 256 IIGFIIYCLCMVCGAG-ITGPVGFRYWRHPGPW---GPGIISKDKNEARFLGWVSSLINA 311
           I GF I  + ++CG G   G +G +YW  PG +    PG        ++F G  S  + A
Sbjct: 225 IGGFTILGIVLICGGGPKNGYIGAKYWNDPGSFVGASPG--------SQFKGLCSVFVTA 276

Query: 312 AFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSST 371
           AF+Y GTELVG++A E+ANPR ++P+A K+                   V ++DPKL S 
Sbjct: 277 AFSYSGTELVGVSAAESANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSA 336

Query: 372 DSY--VSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAP 429
            S   V+ASP +IAI+N G + LP + NA+IL  IIS ANS+VY  SR +  ++     P
Sbjct: 337 SSSVDVAASPLVIAIENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLP 396

Query: 430 KFFQKTRN-GVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISH 488
           + F    N G P +A++FT  FG L+++  S   +  F WL  ++G++  F WL+I+ISH
Sbjct: 397 RIFTYIDNRGRPIVAIIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISH 456

Query: 489 IRFMQTLKHRGMSRDDLPYKAALMPGL--AYYGAFFVTLIILIQGFTAFAPKFDSTA--- 543
           IRF + L  +G S D+LPY +  M G+  ++YG   + L+++   +T+  P   S A   
Sbjct: 457 IRFRRALNTQGYSLDELPYLS--MTGVIGSWYGCVVIILVLIASFWTSLFPAGSSGADWE 514

Query: 544 -FLTAYISCFLFLFIYIVAQCYFRTRLW 570
            F   Y+S  +FLF ++  + Y R   W
Sbjct: 515 SFFKGYLSLPIFLFCFVGHKLYKRNWSW 542

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  277 bits (709), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 160/483 (33%), Positives = 258/483 (53%), Gaps = 16/483 (3%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           E   +K+ L+ RH                     +   GP G L +YI +  +++ V  +
Sbjct: 45  EPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNA 104

Query: 158 LGEMATFIPVTS-----SFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEF 212
           LGEM  ++P +      S +   SR+     G A G+ Y++ + I  A E +    V+ +
Sbjct: 105 LGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTY 164

Query: 213 WTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGI 272
           WT  VP AAWI+IF  ++ ++NF PVK YGE EFW A +K++ I+G +     +  G G 
Sbjct: 165 WTTVVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGGP 224

Query: 273 T-GPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-QGTELVGITAGEAAN 330
           +   +GFRYW+ PG +   I +   N  RFL   + +I   F +  G ELV +T+ EA +
Sbjct: 225 SHDRLGFRYWQKPGAFAYHITT--GNTGRFLDVWTGVIKGGFAFILGPELVAVTSSEAMD 282

Query: 331 PRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDP----KLSSTDSYVSASPFIIAIQN 386
            R+++ +A ++ + R               V  NDP     L+S  +  ++SPF+IAIQN
Sbjct: 283 QRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQN 342

Query: 387 SGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVL 445
           +  K+LPHI NA IL++  S+ NS ++  SR L  ++   +APK F+K  R GVP+ AV 
Sbjct: 343 AHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVA 402

Query: 446 FTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDL 505
            +AAF  LAY+  S+G   AF W  NI+ ++GF  W+ I ++++RF + +  RG+  D +
Sbjct: 403 VSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YDRV 461

Query: 506 PYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKF-DSTAFLTAYISCFLFLFIYIVAQCY 564
           P+K+   P   Y+    V++I L  G+  F P+F     F+ AYI+  +F+ +++  + Y
Sbjct: 462 PFKSPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLWVGHKIY 521

Query: 565 FRT 567
            RT
Sbjct: 522 TRT 524

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  279 bits (713), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 185/572 (32%), Positives = 279/572 (48%), Gaps = 41/572 (7%)

Query: 15  HESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKSDEDATLTKASKRHV 74
           H+SL ++  S      +   ++ W   R      R  EGE   + +D D  +    KR+ 
Sbjct: 34  HQSLSSEALSMGSLDARSPQKDVW-YTRLLNDFKRADEGETTRSVADSDMEVD--GKRY- 89

Query: 75  RXXXXXXXXXXXXEEDIDATGVVEEA-----QVKRELKPRHXXXXXXXXXXXXXXXXXXX 129
                        +E  D    V +A     Q+ + L  RH                   
Sbjct: 90  -------------KEMTDVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSG 136

Query: 130 XPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGY 189
             +   GP   LIA+  + T +F++  SLGE+A+  PV   F V+ +RFV   FG A   
Sbjct: 137 ASLNTGGPGSILIAWTLISTCLFTIVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNI 196

Query: 190 MYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVA 249
            Y   WA+   LEL+     I++W  K+   AW++IF+V I + N   VK +GE EF ++
Sbjct: 197 SYLAQWAVLLPLELAAASITIKYWNNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLS 256

Query: 250 SIKVIAIIGFIIYCLCMVCGAGITGPVGF-RYWRHPGPWGPGIISKDKNEARFLGWVSSL 308
            +K++AI GF I    ++CG G  G     +YW  PG +       D   A+F G  S  
Sbjct: 257 MVKILAIFGFAILGTVLICGGGPVGGFIGAKYWHDPGAF-----VGDTPGAQFKGLCSVF 311

Query: 309 INAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL 368
           + AAF+Y GTELVG++A E+ NPR ++PRA K+                   VP NDP+L
Sbjct: 312 VTAAFSYSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRL 371

Query: 369 ----SSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSS 424
               SS D  V+ASP +IAI+N G + +P + NA+IL  IIS ANS+VY  SR +  ++ 
Sbjct: 372 LNGMSSVD--VAASPLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQ 429

Query: 425 AKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLS 483
               PK F    R G P +A+L T  FG L+++  S   +  F WL  ++G++  F W +
Sbjct: 430 VGNLPKVFNYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFA 489

Query: 484 ISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDS-- 541
           I+ISHIRF + +  +  S D+LPY +      ++YGA  +  ++++  +T+  P   S  
Sbjct: 490 INISHIRFRRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGP 549

Query: 542 --TAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571
              +F   Y+S  +FL  YI  + Y R   WR
Sbjct: 550 SAESFFEGYLSFPIFLICYISHKLYKRD--WR 579

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  276 bits (705), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 174/548 (31%), Positives = 281/548 (51%), Gaps = 22/548 (4%)

Query: 41  DRRFLHRHRGSEGEVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATG----- 95
           D +  +     E  VE   S ED + +   K   +              D+D        
Sbjct: 15  DEKNKNYISNQENVVESGASQEDYSNSSYPKSGSKWKDFKDSFKRMDSVDLDPNLTDAQK 74

Query: 96  ---VVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVF 152
              +  ++ ++R+LK RH                     ++ AGP G LI +  M T++ 
Sbjct: 75  IAILTSQSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMIL 134

Query: 153 SVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEF 212
            +  SLGEMA   PV+  +T +A+RF+ + +G A    Y     +   LE+      +++
Sbjct: 135 CMCLSLGEMAVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDY 194

Query: 213 WTFKVPL-AAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAG 271
           W  K    AA++++FW+ IV +N F VK YGE EF  + IKV+ +IGFII  + +VCG G
Sbjct: 195 WGPKSQYRAAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGG 254

Query: 272 ITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 330
            T   +G ++W +PG +       D    +F G  S  + AAF++  TELVG+ A E  +
Sbjct: 255 PTHEYIGSKFWSNPGAF-----VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETED 309

Query: 331 PRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAIQNSGT 389
           PRKSVP+A K+V  R               VPY DP+L  S+    +ASPF++A++N G 
Sbjct: 310 PRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLALKNHGI 369

Query: 390 KVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTA 448
           K LP + N VILT ++S  NS+V+  SR L  LS     P  F    R G P ++++F++
Sbjct: 370 KGLPSVINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSS 429

Query: 449 AFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYK 508
           AFG L ++  S   Q  F+W+L+++G++  F WL+IS+ HIRF + L  +  S D+L + 
Sbjct: 430 AFGLLCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFA 489

Query: 509 AALMPGLAYYGAFFVTLIILIQGFTAFAP---KFDSTAFLTAYISCFLFLFIYIVAQCYF 565
           + +    +YY  F + +++++Q + A  P   K  ++ F  AY+S  + + +Y+  + Y 
Sbjct: 490 SPIGIWGSYYSVFLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIY- 548

Query: 566 RTRLWRTL 573
            T+ W+ L
Sbjct: 549 -TKNWKLL 555

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  275 bits (704), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 171/552 (30%), Positives = 276/552 (50%), Gaps = 23/552 (4%)

Query: 33  KVRNEWARDRRFLHRHRGSEGEVEYAKSDEDATLTKASK-RHVRXXXXXXXXXXXXEEDI 91
           KV++ W   +R L   + +E   + +++D     ++A   +                E  
Sbjct: 3   KVQSSW---QRMLDSFKPAETYKQSSRNDMSPLTSEAPDFKKADAASGNESWALENVEST 59

Query: 92  DATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLV 151
             T   E+++  ++L  RH                     +   GP   +I ++ + T +
Sbjct: 60  SGTSDAEDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCL 119

Query: 152 FSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIE 211
           F++  +LGE+++  PV   F V+ SRFV   FG A    Y   WA+   LEL      I 
Sbjct: 120 FTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIR 179

Query: 212 FWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GA 270
           +W   +   AW++IF+ +I + N   VK +GE EF ++ +K++AIIGF I  + + C G 
Sbjct: 180 YWNSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGG 239

Query: 271 GITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 330
              G +G +YW +PG +       + +  RF G  S  + AAF+Y GTEL+ ++A E+ N
Sbjct: 240 PEGGYIGGKYWSNPGAF-----VGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVN 294

Query: 331 PRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL--SSTDSYVSASPFIIAIQNSG 388
           PR ++P+A K+                   VP +DP+L   S+   V+ASP +IAI+N G
Sbjct: 295 PRITLPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGG 354

Query: 389 TKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFT 447
            K LP + NA+IL  ++S ANS VY  SR +  ++     PK F    R G P  A+L T
Sbjct: 355 IKGLPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILAT 414

Query: 448 AAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPY 507
             FG L+++  S   +  F WL  ++G++  F W +I++SHIRF  T+K RG S D+LP+
Sbjct: 415 LIFGLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPF 474

Query: 508 KAALMPGL--AYYGAFFVTLIILIQGFTAFAPKFDSTA----FLTAYISCFLFLFIYIVA 561
            +  M G+  +YYG   + +++++  +TA  P  +  A    F   Y+S  + L  YI  
Sbjct: 475 VS--MTGVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGH 532

Query: 562 QCYFRTRLWRTL 573
           + Y  T+ WR L
Sbjct: 533 KLY--TKSWRLL 542

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  275 bits (704), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 166/479 (34%), Positives = 254/479 (53%), Gaps = 12/479 (2%)

Query: 96  VVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVT 155
           +  ++ ++R LK RH                     ++  GP G LI +  +G +++ V 
Sbjct: 71  ITAQSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVV 130

Query: 156 QSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFW-T 214
            S+GE+A   PV+  FT +A+RFV + FG A  Y Y   W +   LE+      + FW T
Sbjct: 131 MSMGELAVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGT 190

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG 274
                  ++++F+++IVI+NFF V+ YGE EF  + IKVI +IGFII  + +VCG G  G
Sbjct: 191 PPKYRDGFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVG 250

Query: 275 PVGF-RYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
                +YW +PG +     S D   +RF G  S  + AAF++ GTELVG+ + E ANPRK
Sbjct: 251 GYIGGKYWHNPGAF-----SGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRK 305

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSY-VSASPFIIAIQNSGTKVL 392
           ++PRA K+V  R               VP+   +L  T S   +ASPF++AIQ  G K L
Sbjct: 306 ALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQTHGIKGL 365

Query: 393 PHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFG 451
           P + N VIL +++S  NS VY  SR +  L+     P  F    R G P +A++ T  FG
Sbjct: 366 PSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFG 425

Query: 452 ALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAAL 511
            L+++  S    + FNWLL ++G++  F+W +I I HIRF + L  +G S D+L + +  
Sbjct: 426 LLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYA 485

Query: 512 MPGLAYYGAFFVTLIILIQGFTAFAP---KFDSTAFLTAYISCFLFLFIYIVAQCYFRT 567
               +Y+G   V L+++ Q + A  P     ++  F +AY+S  + L  YI  + + R 
Sbjct: 486 GIAGSYFGVILVLLVLIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYIFHKIWKRN 544

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  274 bits (701), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 163/499 (32%), Positives = 261/499 (52%), Gaps = 24/499 (4%)

Query: 92  DATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLV 151
           D TG     ++K+ LK RH                     +   GP G  I+Y  + +++
Sbjct: 69  DMTG----HELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVI 124

Query: 152 FSVTQSLGEMATFIPVTSS----FTVF-ASRFVSDPFGAACGYMYWFSWAITFALELSVV 206
           + + Q +GEM  ++P + S    F  +   ++V +  G A  + Y++ + I  A E +  
Sbjct: 125 YPIMQGIGEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAA 184

Query: 207 GQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM 266
             V+E+WT  VP AAWI+IF   +VI+NF  VK YGE EFW ASIK++ I+G II    +
Sbjct: 185 SGVVEYWTTSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFIL 244

Query: 267 VCGAGITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-QGTELVGIT 324
             G G     +GFRYW++PG +   I  +  +   FL   + +I   F +  G E++ +T
Sbjct: 245 FWGGGPNHDRLGFRYWQNPGGFAHHI--RGGSFGSFLDIYTGIIKGGFAFILGPEMIAMT 302

Query: 325 AGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDP----KLSSTDSYVSASPF 380
           + E  + R+++ +A ++   R               V YNDP     L+       +SPF
Sbjct: 303 SSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPF 362

Query: 381 IIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGV 439
           +I IQN+G KVLPHI NA IL++  SA N+ ++  SR L  ++    AP+ F K  R GV
Sbjct: 363 VIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGV 422

Query: 440 PFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRG 499
           P+ AV  ++A   LAY+  S+   + FNW  NI+ ++GF  W+ + I++IRF + +   G
Sbjct: 423 PYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHG 482

Query: 500 MSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKF-DSTAFLTAYISCFLFLFIY 558
           M +  LPY A  MP L Y+    +++I L  G+  F P+F D+  F+ AYI+  +F  ++
Sbjct: 483 M-QSRLPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLW 541

Query: 559 IVAQCY----FRTRLWRTL 573
           I  + Y    F  + W+++
Sbjct: 542 IGHRVYRRKIFTLKWWKSI 560

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  274 bits (700), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 162/492 (32%), Positives = 258/492 (52%), Gaps = 19/492 (3%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           +ED    G   + ++K+ +K RH                     ++N GP G +I Y  M
Sbjct: 82  KEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIM 141

Query: 148 GTLVFSVTQSLGEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVV 206
           G+ ++ + Q+ GE+A  +  ++  F  + S  +    G +  ++Y   W     LEL   
Sbjct: 142 GSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTA 201

Query: 207 GQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM 266
              I++WT  V    +++IF+V+I+ +N F  + Y E EF+  + KV+ I GF+I  + +
Sbjct: 202 SITIKYWTTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIV 261

Query: 267 VCG-AGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITA 325
            CG AG  G +G +YW  PG +     S DK    F G VS+L+ AAF +  TE + +TA
Sbjct: 262 NCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTA 316

Query: 326 GEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAI 384
            E ANPRKS+P A KK+  R               VP+N  +L  S  S   ASP++IAI
Sbjct: 317 AEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASPYVIAI 376

Query: 385 QNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIA 443
            + G KV+PH+ NAVIL ++IS  NS  Y  SR+L  L+    AP F +   R G P +A
Sbjct: 377 ASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTLA 436

Query: 444 VLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRD 503
           ++ ++ FG ++++  S   +  F WLL I+G++  F W +I +SHIRF + +K +G S  
Sbjct: 437 MVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLG 496

Query: 504 DLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYI 559
           +L +K+ +    +YY    + LI++ Q +TA AP    K D+ AF   Y++      + I
Sbjct: 497 ELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLA------MPI 550

Query: 560 VAQCYFRTRLWR 571
           +   YF  ++W+
Sbjct: 551 LIALYFGYKVWK 562

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  273 bits (699), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 167/482 (34%), Positives = 251/482 (52%), Gaps = 21/482 (4%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
            + ++  LK RH                     ++ AGP G LI +   GT+++S+  +L
Sbjct: 78  NSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAL 137

Query: 159 GEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFW-TFKV 217
           GE+A   PV+  FT +A+RF+ + +G A    Y   W +   LE+      + +W T   
Sbjct: 138 GELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGTNPR 197

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAG-ITGPV 276
               ++++FW+ I I+N F VK YGE EF  + IKVI ++GFII  + + CG G + G +
Sbjct: 198 YRDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPVKGYI 257

Query: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336
           G RYW HP     G    D   ARF G  S  + AAF++ G+ELVG+ + E ANPRKSVP
Sbjct: 258 GGRYWHHP----YGAFVGDSAGARFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSVP 313

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASPFIIAIQNSGTKVLP 393
           +A K+V  R               VPY + +L   SS D+  +ASPF+IAI   G + LP
Sbjct: 314 KAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDA--AASPFVIAITTHGIRGLP 371

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGA 452
            + N VIL  ++S  NS +Y  SR L  L+     PKFF    R+G P  ++L T+ FG 
Sbjct: 372 SVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVTSGFGL 431

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           +A++  S      FNWLL ++G++  F W  I + HIRF + L  +G   D+L + +   
Sbjct: 432 VAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSFVSPAG 491

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAP---KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRL 569
              +Y+G F + L+ + Q + A  P   K ++ AF  AY+S        IV  CY   ++
Sbjct: 492 VYGSYWGLFMIILMFIAQFYVALFPPGAKPNAKAFFEAYLS------FPIVIACYLGHKI 545

Query: 570 WR 571
           ++
Sbjct: 546 YK 547

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  271 bits (692), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 152/482 (31%), Positives = 253/482 (52%), Gaps = 10/482 (2%)

Query: 92  DATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLV 151
           D  G   EA + REL P                       +   GP+   +AY+F G+++
Sbjct: 23  DEGGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALARGGPISIFLAYLFTGSIL 82

Query: 152 FSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIE 211
             V  SL EMA F P+   F+ + +++V   FG A G+ Y+  +AI  +  L+  G VI 
Sbjct: 83  AVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIG 142

Query: 212 FWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAG 271
           +W   + +A W+++ +    ++NF  V+ +G+ E ++   K+  ++   I CL + CG G
Sbjct: 143 YWRPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLLIFIVCLVITCGGG 202

Query: 272 IT-GPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 330
                +GFRYWR  G + P ++    N  +FLGW + +I + F + G+E++GI  GE AN
Sbjct: 203 PDHTTIGFRYWRESG-FLPYLV--KGNTGKFLGWWACVIQSIFGFMGSEMIGIIYGETAN 259

Query: 331 PRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASPFIIAIQNS 387
           PRK++P+A + V +R               V  ++ KL    STD+  +ASPF+IAI  S
Sbjct: 260 PRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHAHSTDA--NASPFVIAISTS 317

Query: 388 GTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLF 446
           G KVLP   NA +L  I S+A +++Y+ SR LYGL+    APK F +  ++ +P +  + 
Sbjct: 318 GIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLRLNKHKIPMVGCVV 377

Query: 447 TAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLP 506
            +  G LAYM T       F ++ +   V G   W  I +++I + + +K  G+  D++P
Sbjct: 378 GSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDRVVKSHGVRLDEIP 437

Query: 507 YKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
           ++    P  AY   FFV++I    G++AF  KF+   F+T+YI  F  + + +  + Y++
Sbjct: 438 FRMPFQPYAAYIALFFVSVITFFNGYSAFILKFNYKLFITSYIGIFANVLLVLGYKLYYK 497

Query: 567 TR 568
           T+
Sbjct: 498 TK 499

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  274 bits (700), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 162/473 (34%), Positives = 249/473 (52%), Gaps = 13/473 (2%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G  +E  +K+ +KPRH                     + +AGP G  I Y  MG+ ++ +
Sbjct: 118 GKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYCI 177

Query: 155 TQSLGEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFW 213
            Q+ GEMA T+  +   F  + S  VS   G A  ++YW  WA    LEL      I++W
Sbjct: 178 IQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKYW 237

Query: 214 TFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGI 272
           T KV    ++ IF+ LI+++N F  + Y E EF+    KV+ I GF I  + + C GAG 
Sbjct: 238 TTKVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGGAGN 297

Query: 273 TGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 332
            G +G +YW  PG +       DK   RF G  ++L+ AAF + G+E + +TA E +NPR
Sbjct: 298 DGYIGGKYWHDPGAF-----RGDKAIDRFKGVAATLVTAAFAFGGSEFIALTASEQSNPR 352

Query: 333 KSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTD-SYVSASPFIIAIQNSGTKV 391
           K++P A KK+  R               VP+N  +L  +D S   ASP++IAI + G +V
Sbjct: 353 KAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISSHGVRV 412

Query: 392 LPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAF 450
           +PH  NAVIL +++S  NS  Y  SRIL  LS    APKFF    R G P  A++  A F
Sbjct: 413 VPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGALF 472

Query: 451 GALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAA 510
             +A+   S+  ++ F WLL I+G++  F W +I +SHIRF + +  +G S  ++ +K+ 
Sbjct: 473 AVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKSE 532

Query: 511 LMPGLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYI 559
           L    +YY A  + L+++ Q +   AP    K D+ +F  +Y++  + +  Y+
Sbjct: 533 LGVWGSYYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYV 585

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  272 bits (695), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 163/500 (32%), Positives = 254/500 (50%), Gaps = 19/500 (3%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           + D DA     E  +++ LK RH                     +   GP G  I+YI +
Sbjct: 63  DGDGDADPFANEGSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIII 122

Query: 148 GTLVFSVTQSLGEMATFIP-----VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALE 202
            ++V+ +    GEM  ++P      + S     +R+V    G A  + Y++ + I  A E
Sbjct: 123 SSVVYPIMCGFGEMVCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAE 182

Query: 203 LSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIY 262
            +    V+E+WT  VP   WI IF  ++VI+NF PVK YGE EFW ASIK++ I+G II 
Sbjct: 183 CTAASGVVEYWTVAVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIIL 242

Query: 263 CLCMVCGAGITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-QGTEL 320
              +  G G     +GFRYW+ PG +   I+       RFL   S +I   F +  G EL
Sbjct: 243 SFILFWGGGPNHDRLGFRYWQRPGAFTEHIMK--GGFGRFLDIYSGVIKGGFAFILGPEL 300

Query: 321 VGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPK----LSSTDSYVS 376
           V +T+ E  + R+++ +A ++   R               V YNDP     L+S      
Sbjct: 301 VCLTSAECEDQRRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAG 360

Query: 377 ASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-T 435
           +SPF+I IQN+G +VLPHI NA IL++  SA N+ ++  +R L  ++    AP+ F K  
Sbjct: 361 SSPFVIGIQNAGIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKIN 420

Query: 436 RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTL 495
           R GVP++A+  +     LA++  S+   + FNW  NI+ ++GF  W+   +++IRF + +
Sbjct: 421 RFGVPYVAISLSGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAI 480

Query: 496 KHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPK-FDSTAFLTAYISCFLF 554
              GM  D LP+K    P   YY  F ++LI L  G+  F PK +  + F+ AYI+  +F
Sbjct: 481 FFNGM-YDRLPFKTWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIF 539

Query: 555 LFIYIVAQCYFRT---RLWR 571
           + +++  + + RT   R WR
Sbjct: 540 VVLWVGHKLWTRTFTKRWWR 559

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  273 bits (698), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 173/581 (29%), Positives = 287/581 (49%), Gaps = 26/581 (4%)

Query: 4   KDNASIELHSYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKSDED 63
           K+NASIE  +  E  E     + +  ++ K  ++ +   RF+   R +EG   +  S + 
Sbjct: 41  KENASIERENEVEYFENTMEKTMEN-MEYKGDHQRSYFHRFIDSFRRAEGS--HPNSPDS 97

Query: 64  ATLTKASKRHVRXXXXXXXXXXXXEED-IDATGVVEEAQ--------VKRELKPRHXXXX 114
             L  ++    +            +   I   G+ + +Q        +K+ +KPRH    
Sbjct: 98  TNLNGSTPISTKDSSSRLDNELNPKSSYITVDGIKQSSQEQEPKQENLKKSIKPRHTVMM 157

Query: 115 XXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMAT-FIPVTSSFTV 173
                            + NAGP G +I Y  MG+ V+ + Q+ GE+A  +  +   F  
Sbjct: 158 SLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNT 217

Query: 174 FASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIM 233
           + S  V    G +  +++   W     LEL      I++WT KV    ++ IF+VLI+++
Sbjct: 218 YPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVNADVFVIIFYVLILVI 277

Query: 234 NFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGPVGFRYWRHPGPWGPGII 292
           N F  K Y E +F+    K++ I GF I  + + CG AG  G +G RYWR PG +     
Sbjct: 278 NIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIGSRYWRDPGAF----- 332

Query: 293 SKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXX 352
             D +  RF G V++ + AAF +  +E + +TA E +NPRK++P A KK+  R       
Sbjct: 333 RGDTSIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLA 392

Query: 353 XXXXXXXXVPY-NDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSN 411
                   VPY +D  L +  S   ASP++IA+ + G +V+PH  NAVIL +++S ANS 
Sbjct: 393 SLALVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVLSVANSA 452

Query: 412 VYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLL 470
            Y  SRIL  L+    APK F    R G P +A++ +A FG +A+  +S   ++ F WLL
Sbjct: 453 FYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIAFCASSKKEEDVFTWLL 512

Query: 471 NITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQ 530
            I+G++  F W++I +SHIRF + +K +G S  ++ YK+ +    + Y    + L ++ Q
Sbjct: 513 AISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGVWGSAYAVVLMVLALIGQ 572

Query: 531 GFTAFAP-----KFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
            + A +P     K  + +F   Y++  + + +YI  + + R
Sbjct: 573 FWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYKVWKR 613

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  272 bits (696), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 178/577 (30%), Positives = 285/577 (49%), Gaps = 28/577 (4%)

Query: 1   MDNKDNASIELHSYHESLETQ-------EASSWDKKLKDKVRNEWARDR---RFLHRHRG 50
           + +  N+S E+H+  +  E +       + SS    L  +  N  A  R    F    + 
Sbjct: 10  LKDLKNSSTEIHATEQDNEVEYFETDSNDPSSSQPPLGYEQHNTSALRRFFDSFKKADQS 69

Query: 51  SEGEVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRH 110
           +E  VE A+ ++ A+    S R  +             ++I A    +   +K+ ++PRH
Sbjct: 70  AEERVETAQMNDLASAISPSSRQRQELEKNES-----SDNIGARTGNKSDSLKKTIQPRH 124

Query: 111 XXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMA-TFIPVTS 169
                                + +AGP G LI Y  MG++++ + Q+ GEMA  +  +T 
Sbjct: 125 VLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQACGEMALVYSNLTG 184

Query: 170 SFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVL 229
            +  + S  V D FG A  ++Y   W     LEL      I++WT  V    ++ IF+VL
Sbjct: 185 GYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVL 244

Query: 230 IVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM-VCGAGITGPVGFRYWRHPGPWG 288
           ++ +N F  + Y E EF+    K++ + GF I  + + V GAG  G +G +YW  PG + 
Sbjct: 245 VITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAFN 304

Query: 289 PGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXX 348
            G  S D    RF G V++L+ AAF + G+E + IT  E ANPRK+VP A K++  R   
Sbjct: 305 -GKHSID----RFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAVPGAAKQMIYRILF 359

Query: 349 XXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISA 407
                       VPYN  +L  S+     ASP++IA+ + G +V+PH  NAVIL +++S 
Sbjct: 360 LFLATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSM 419

Query: 408 ANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAF 466
           ANS+ Y  +RIL  LS    AP+ F    + G P IA+  +A FG +A+   S      F
Sbjct: 420 ANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIAFCAASPKEDQVF 479

Query: 467 NWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLI 526
            WLL I+G++  F W +I +SHIRF + +K +G S  +L +++      + Y    + LI
Sbjct: 480 TWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGSTYACIMMILI 539

Query: 527 ILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYI 559
           ++ Q + A AP    K D+ AF   Y++  + + +Y+
Sbjct: 540 LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYV 576

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  273 bits (698), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 168/531 (31%), Positives = 265/531 (49%), Gaps = 16/531 (3%)

Query: 50  GSEGEVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPR 109
           GS      A+ D+   + K SK                E+   A G     ++K+ L+ R
Sbjct: 110 GSRTHHYEAEKDDAIRMEKISKNQSASSNGTVREELDLEKSPSADGDAGPHRLKQGLQSR 169

Query: 110 HXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTS 169
           H                     +   GP G  I+YI +  +++ +  +LGEM  F+P   
Sbjct: 170 HVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDG 229

Query: 170 SFTVFAS-----RFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWIS 224
           S +  +S     R+V    G A G+ Y++ + I  A E +    V+E+WT  VP   WI+
Sbjct: 230 SDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWTTAVPKGVWIT 289

Query: 225 IFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP-VGFRYWRH 283
           IF  ++V++NF  VKVYGE EFW ASIK++ I+G II    +  G G     +GFRYW+H
Sbjct: 290 IFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQH 349

Query: 284 PGPWGPGIISKDKNEARFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKSVPRAIKKV 342
           PG +   +     +   F    + +I  AF +  G ELV +T+ E A+ R+++ +A ++ 
Sbjct: 350 PGSFAHHL--AGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRF 407

Query: 343 SVRXXXXXXXXXXXXXXXVPYNDPK----LSSTDSYVSASPFIIAIQNSGTKVLPHIFNA 398
             R               VPYNDP     L+       +SP++I IQN+G KVLPHI N 
Sbjct: 408 VWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAGIKVLPHIING 467

Query: 399 VILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYME 457
            ILT+  SAAN+ ++  +R L  ++    APK   K  R GVP++AV  +     LAY+ 
Sbjct: 468 CILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVSFLCSCLAYLN 527

Query: 458 TSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAY 517
            S+   + FNW  NI+ ++GF  W+   I+++RF + +   G+  D LP+K    P   +
Sbjct: 528 VSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YDRLPFKTWGQPYTVW 586

Query: 518 YGAFFVTLIILIQGFTAFAPKFDSTA-FLTAYISCFLFLFIYIVAQCYFRT 567
           +    V++I +  G+  F PK+ + A F+ AYI+  +FL +++  + Y RT
Sbjct: 587 FSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYTRT 637

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  272 bits (695), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 179/581 (30%), Positives = 286/581 (49%), Gaps = 36/581 (6%)

Query: 1   MDNKDNASIELHSYHESLETQ--EASSWDKKLK----DKVRNEWARDRRFLHR----HRG 50
           + +  N+S E+H+  +  E +  E  S D+  +    D  ++  +  RRFL       + 
Sbjct: 10  LKDLKNSSTEVHAAEQENEIEYFETDSNDRPSQQPHLDYEQHNTSAVRRFLDSFKRADQD 69

Query: 51  SEGEVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDA----TGVVEEAQVKREL 106
            E E E A+ ++  +    S R               +E  D     TG   ++ +K+ +
Sbjct: 70  QEQEAEVAQMNDLTSAISPSSRQAHELEK--------DETTDKIAPHTGHKSDS-LKKTI 120

Query: 107 KPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMA-TFI 165
           +PRH                     + +AGP G LI Y  MG++++ + Q+ GEMA  + 
Sbjct: 121 QPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYS 180

Query: 166 PVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISI 225
            +T  +  + S  V D FG A  ++Y   W     LEL      I++WT  V    ++ I
Sbjct: 181 NLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVII 240

Query: 226 FWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM-VCGAGITGPVGFRYWRHP 284
           F+VL++ +N F  + Y E EF+    K++ + GF I  + + V GAG  G +G +YW  P
Sbjct: 241 FYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGYIGGKYWHEP 300

Query: 285 GPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSV 344
           G +  G+ + D    RF G V++L+ AAF + G+E + IT  E +NPRK++P A K++  
Sbjct: 301 GAFN-GVHAID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIY 355

Query: 345 RXXXXXXXXXXXXXXXVPYN-DPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTT 403
           R               VPYN D  L S+     ASP++IAI + G +V PH  NAVIL +
Sbjct: 356 RILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKASPYVIAIASHGVRVAPHFVNAVILLS 415

Query: 404 IISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGG 462
           ++S ANS+ Y  +R+   LS    APK F    R G P IA+  +A F  +A+   S   
Sbjct: 416 VLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCAASPKE 475

Query: 463 QNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFF 522
              F WLL I+G++  F W +I +SHIRF + +K +G S  +L +K+      + Y    
Sbjct: 476 DQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSIYSCIM 535

Query: 523 VTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYI 559
           + LI++ Q + A AP    K D+ AF   Y++  + + +Y+
Sbjct: 536 MILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYV 576

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  271 bits (693), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 155/482 (32%), Positives = 247/482 (51%), Gaps = 15/482 (3%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
            ++++ ++L  RH                     +   GP   ++A++ + T +F++  +
Sbjct: 84  NDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNA 143

Query: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217
           LGE+A   PV   F V+ +RFV   FG A    Y   WA+   LEL      I +W   +
Sbjct: 144 LGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYWNNTI 203

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP-V 276
              AW++IF+  I + N   VK +GE EF ++ IK++AIIGF I  + + CG G +G  +
Sbjct: 204 NSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGEYI 263

Query: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336
           G RYW  PG +       D    RF G  +  + AAF+Y GTELV ++A E+ NPR ++P
Sbjct: 264 GGRYWNDPGAF-----VGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLP 318

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYV--SASPFIIAIQNSGTKVLPH 394
           +A K+                   VPYND +L + +S V  +ASP +IAI+N G K LP 
Sbjct: 319 KASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIENGGIKGLPS 378

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGAL 453
           + NA+IL  I+S ANS VY  SR +  ++     PK      + G P  A+  T  FG L
Sbjct: 379 LMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGLL 438

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           +++  S   +  F WL  ++G++  F W SI++SHIRF Q +K +  S ++LP+ +    
Sbjct: 439 SFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSITGV 498

Query: 514 GLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRL 569
             ++YG   + L+++   +T+  P      D+ +F   Y+S  +F+  Y+  + Y +   
Sbjct: 499 YGSWYGCIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKKD-- 556

Query: 570 WR 571
           WR
Sbjct: 557 WR 558

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  271 bits (694), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 171/561 (30%), Positives = 273/561 (48%), Gaps = 28/561 (4%)

Query: 28  KKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXX 87
           KK +D V+   +      + HR         + D+   + K SK                
Sbjct: 34  KKEEDVVQVTESPSSGSRNNHRSDN------EKDDAIRMEKISKNQSASSNGTIREDLIM 87

Query: 88  EEDIDAT----GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIA 143
           + D++ +    G  E  ++K+ L+ RH                     +   GP G  I+
Sbjct: 88  DVDLEKSPSVDGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFIS 147

Query: 144 YIFMGTLVFSVTQSLGEMATFIPVTSSFTV-----FASRFVSDPFGAACGYMYWFSWAIT 198
           YI +  +++ +  +LGEM  F+P   S +        +R+V    G A G+ Y++ + I 
Sbjct: 148 YIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVIL 207

Query: 199 FALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIG 258
            A E +    V+E+WT  VP   WI+IF  ++VI+NF  VKVYGE EFW ASIK++ I+G
Sbjct: 208 VAAECTAASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVG 267

Query: 259 FIIYCLCMVCGAGITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-Q 316
            II    +  G G     +GFRYW+HPG +   +     +   F    + +I  AF +  
Sbjct: 268 LIILSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTG--GSLGNFTDIYTGIIKGAFAFIL 325

Query: 317 GTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPK----LSSTD 372
           G ELV +T+ E A+ R+++ +A ++   R               VPYNDP     L+   
Sbjct: 326 GPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGK 385

Query: 373 SYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFF 432
               +SPF+I IQN+G KVLPHI N  ILT+  SAAN+ ++  +R L  ++    APK  
Sbjct: 386 PGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCL 445

Query: 433 QKTRN-GVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRF 491
            +    GVP++AV  +     LAY+  S+   + FNW  NI+ ++GF  W+   I+++RF
Sbjct: 446 GRINKWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRF 505

Query: 492 MQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTA-FLTAYIS 550
            + + + G+  D LP+K    P   ++    + +I +  G+  F PK+   A F+ AYI+
Sbjct: 506 RKAIFYNGL-YDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYIT 564

Query: 551 CFLFLFIYIVAQCYFRTRLWR 571
             +FL ++   + Y  TR WR
Sbjct: 565 LPIFLVLWFGHKLY--TRTWR 583

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  270 bits (691), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 179/575 (31%), Positives = 282/575 (49%), Gaps = 24/575 (4%)

Query: 2   DNKD--NASIELHSYHESLETQ--EASSWDK-----KLKDKVRNEWARDRRFLHRHRGSE 52
           + KD  N+S E+H+  +  E +  E  S D+      L  +  N  A  R F    R  +
Sbjct: 9   EQKDLKNSSTEIHATEQDNEIEYFETDSNDRPSSQPHLDYEQHNTSAVRRFFDSFKRADQ 68

Query: 53  GEVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXX 112
           G  + +++ +   LT A     R             + I+     +   +K+ ++PRH  
Sbjct: 69  GGQDESEAVQMNDLTSAISPSSRNAQGLEKNDST--DKINPPAGNKSGSLKKTIQPRHVL 126

Query: 113 XXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMA-TFIPVTSSF 171
                              + +AGP G LI Y  MG++++ + Q+ GE+A  +  +T  +
Sbjct: 127 MIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGELALVYSNLTGGY 186

Query: 172 TVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIV 231
             + S  V D FG A  ++Y   W     LEL      I++WT  V    ++ IF+VL++
Sbjct: 187 NAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVI 246

Query: 232 IMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM-VCGAGITGPVGFRYWRHPGPWGPG 290
            +N F  + Y E EF+    K++ + GF I  + + V GAG  G +G +YW  PG +  G
Sbjct: 247 TINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGFIGGKYWHDPGAFN-G 305

Query: 291 IISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXX 350
             S D    RF G V++L+ AAF + G+E + IT  E +NPRK++P A K++  R     
Sbjct: 306 KHSID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLF 361

Query: 351 XXXXXXXXXXVPYN-DPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAAN 409
                     VPYN D  L S      ASP++IAI + G +V+PH  NAVIL +++S AN
Sbjct: 362 LATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPHFVNAVILLSVLSMAN 421

Query: 410 SNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNW 468
           S+ Y  +R+   LS    APKFF    R G P IA+  +A F  +A+   S   +  F W
Sbjct: 422 SSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTW 481

Query: 469 LLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIIL 528
           LL I+G++  F W +I  SHIRF + +K +G S  +L +K+      + Y    + LI++
Sbjct: 482 LLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGVWGSMYACIMMLLILI 541

Query: 529 IQGFTAFAP----KFDSTAFLTAYISCFLFLFIYI 559
            Q + A AP    K D+ AF   Y++  + + +Y+
Sbjct: 542 GQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYV 576

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  270 bits (689), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 172/550 (31%), Positives = 269/550 (48%), Gaps = 48/550 (8%)

Query: 20  TQEASSWDKKL--KDKVRNEWARDRRFLHRHRGSEGEVEYAKSDEDATLTKASKRHVRXX 77
           +QE  S+D+      +  + W R +    R      E+E      D  LT+A +  ++  
Sbjct: 25  SQEPVSYDQSQGSSTEAHSRWGRFKESFKRAE----EMEL-----DPNLTEAERIAIK-- 73

Query: 78  XXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGP 137
                                ++ +K  LK RH                     ++ AGP
Sbjct: 74  -------------------TAQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGP 114

Query: 138 VGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAI 197
            G LI +   GT+++S+  ++GE+A   PV   FT +A+RFV + FG A  ++Y   W +
Sbjct: 115 AGILIGWGLTGTMIYSMVMAVGELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLV 174

Query: 198 TFALELSVVGQVIEFW-TFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAI 256
              LE+      + +W T       ++++F+V+IVI+N F VK YGE EF  + IKVI +
Sbjct: 175 VLPLEIVAASITVNYWGTDPKYRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITV 234

Query: 257 IGFIIYCLCMVCGAGITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY 315
           IGFII  + ++CG G     +G +YW +PG +       D    +F G+ +  + AAF++
Sbjct: 235 IGFIIMAIVLICGGGKDHKYIGAQYWYNPGAF-----VGDTAGQQFQGFCTVFVTAAFSF 289

Query: 316 QGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTD 372
            G+ELVG+   EA  PRKSVP A K+V  R               VP + P+L   SS D
Sbjct: 290 AGSELVGLAGSEAEEPRKSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVD 349

Query: 373 SYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFF 432
           +  +ASPF+IAI N G K LP + N VIL  ++S  NS +Y  SR L  L+     P   
Sbjct: 350 A--AASPFVIAIVNHGIKGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSIC 407

Query: 433 QK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRF 491
               R G P + +  +A FG +A++  S    + FNWL+ ++G++  F W  I + HIR+
Sbjct: 408 GYIDRGGRPLVGIAISAFFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRY 467

Query: 492 MQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP---KFDSTAFLTAY 548
              L  +G S D+LP++A      +Y+G F   L+ + Q +    P   K ++  F  AY
Sbjct: 468 RGALAAQGRSTDELPFQAPAGVWGSYWGFFMCILMFIAQFYVGLFPPGTKPNAYDFFLAY 527

Query: 549 ISCFLFLFIY 558
           +S  +F+ +Y
Sbjct: 528 LSFCIFIALY 537

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  270 bits (689), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 172/568 (30%), Positives = 274/568 (48%), Gaps = 36/568 (6%)

Query: 8   SIELHSYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKSDEDATLT 67
           SI + S+  ++   ++SS +K    +         RF+   + +EG   + K   + T  
Sbjct: 19  SISIRSF-SAVNNLQSSSSEKNYSGQTTRNNKLIHRFVDSFKRAEGSTTHTKQINENT-- 75

Query: 68  KASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXX 127
                               + + D      ++++K+ +K RH                 
Sbjct: 76  -------------------SDLEGDVNSFTSDSKLKKSMKSRHVVMMTLGTGIGTGLLVA 116

Query: 128 XXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAA 186
               +   GP   +I Y  +  + + + Q+ GEMA   P + ++F  ++S F+S PFG A
Sbjct: 117 NAKGLHYGGPAALVIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFA 176

Query: 187 CGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEF 246
             ++Y F W     LEL      I+FW   +    +I IF+V ++ ++FF VK YGE EF
Sbjct: 177 TVWVYCFQWLTVLPLELITAAMTIKFWNDTINPDIFILIFFVFLLFIHFFGVKGYGETEF 236

Query: 247 WVASIKVIAIIGFIIYCLCMVC-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWV 305
                K++ I GFII  + + C GAG  G +G +YWR+PG +     + D +  RF    
Sbjct: 237 IFNCCKILMIAGFIILSVVINCGGAGNDGYIGGKYWRNPGAF-----AGDTSAGRFKNVC 291

Query: 306 SSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYND 365
             L+ A F++ G EL  ++  E ANPRK+ P A K+   R               VPYND
Sbjct: 292 YILVTAYFSFGGMELFALSVQEQANPRKTTPVAAKRSIYRILVIYLLTMILIGFNVPYND 351

Query: 366 PKL-SSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSS 424
            +L  +  S   ASP+++A    G KV+PHI NAVIL ++IS ANS++Y G R++  L+ 
Sbjct: 352 DQLMGAGGSATHASPYVLAASIHGVKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQ 411

Query: 425 AKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLS 483
               PKF     R G P IA++  + FG + ++  S+  +  F WL  I G++  F W S
Sbjct: 412 QGYGPKFLDYVDREGRPLIALIVCSVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTS 471

Query: 484 ISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP-----K 538
           I +SH+RF Q +K +G S D+L YKA      + YG FF  L+ + Q + A AP     K
Sbjct: 472 IMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGK 531

Query: 539 FDSTAFLTAYISCFLFLFIYIVAQCYFR 566
             + +F  +Y++  +++  Y+    Y R
Sbjct: 532 CSAESFFQSYLAFPIWIAFYLGYMIYNR 559

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  270 bits (690), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 157/483 (32%), Positives = 258/483 (53%), Gaps = 18/483 (3%)

Query: 102 VKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEM 161
           +K+ L+ RH                     +   GP G L +YI +  +++ V  SLGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 162 ATFIPVTS-----SFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
             F+P ++     S +   +R+     G A G+ Y++ + I  A E +    V+ +WT  
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP- 275
           VP  AWI+IF  ++ ++NF PVK+YGE EFW A +K++ I+G +     +  G G T   
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKS 334
           +GFRYW+HPG +   I +   N  RFL   + +I   F +  G ELV IT+ EA + R++
Sbjct: 285 LGFRYWQHPGAFAYHITT--GNTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 335 VPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDP----KLSSTDSYVSASPFIIAIQNSGTK 390
           + +A ++ + R               V   DP     L+   +   +SPF+IAIQN+  K
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIK 402

Query: 391 VLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAA 449
           VLPHI NA IL++  S+ NS ++  SR L  ++    AP+   +  R GVP+ AV  +AA
Sbjct: 403 VLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAA 462

Query: 450 FGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKA 509
           F  LA++  S+G   AF W  NI+ ++GF  W+ I +++++F + +  RG+  + +P+K+
Sbjct: 463 FSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPFKS 521

Query: 510 ALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRL 569
            L P   Y+    V+LI L  G+ +F   ++++ F+ AYI+  +F+ +++  + Y  TR 
Sbjct: 522 PLQPYGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLWVGHKIY--TRT 578

Query: 570 WRT 572
           W T
Sbjct: 579 WST 581

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  270 bits (689), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 176/568 (30%), Positives = 276/568 (48%), Gaps = 36/568 (6%)

Query: 8   SIELHSYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKSDEDATLT 67
           SI + S+      Q +SS     K K  ++     + +HR   S     + +++   T T
Sbjct: 19  SISIRSFSAGNNFQSSSSEKTYSKQKSGSD-----KLIHRFADS-----FKRAEGSTTRT 68

Query: 68  KASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXX 127
           K    +              E+ +++  +  ++++K+ +K RH                 
Sbjct: 69  KQINENTSDL----------EDGVES--ITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVA 116

Query: 128 XXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAA 186
               +   GP   +I YI +  + + + Q+ GEMA   P + ++F  ++S F+S  FG A
Sbjct: 117 NAKGLHYGGPAALIIGYILVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFA 176

Query: 187 CGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEF 246
             ++Y F W     LEL      I+FW  K+    +I IF+V +V ++FF VK YGE EF
Sbjct: 177 TVWLYCFQWLTVLPLELITASMTIQFWNDKINPDIYILIFYVFLVFIHFFGVKAYGETEF 236

Query: 247 WVASIKVIAIIGFIIYCLCMVC-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWV 305
                K++ I GFII  + + C GAG  G +G  YW +PG +     + D +  RF    
Sbjct: 237 IFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAF-----AGDTSIGRFKNVC 291

Query: 306 SSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYND 365
             L+ A F++ G EL  ++  E +NPRKS P A K+   R               VPYND
Sbjct: 292 YILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYND 351

Query: 366 PKL-SSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSS 424
            +L  +  S   ASP+++A    G K++PHI NAVIL +++S ANS++Y G R++  L+ 
Sbjct: 352 DQLMGAGGSATHASPYVLAASIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLAQ 411

Query: 425 AKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLS 483
              APKF     R G P  A++    FG +A++  S+  +  F WL  I G++  F W S
Sbjct: 412 QGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTS 471

Query: 484 ISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP-----K 538
           I +SH+RF Q +K +G S D+L YKA      + YG FF  L+ + Q + A AP     K
Sbjct: 472 IMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNILVFVAQFWVALAPLGNGGK 531

Query: 539 FDSTAFLTAYISCFLFLFIYIVAQCYFR 566
            D+ +F   Y++  ++L  Y     Y R
Sbjct: 532 CDAESFFQNYLAFPIWLAFYFGYMVYNR 559

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  270 bits (689), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 176/577 (30%), Positives = 283/577 (49%), Gaps = 28/577 (4%)

Query: 1   MDNKDNASIELHSYHESLETQ--EASSWDK-----KLKDKVRNEWARDRRFLHRHRGSEG 53
           + +  N+S E+H+  +  E +  E  S D+      L  +  N  A  R F    R  +G
Sbjct: 10  LKDLKNSSTEIHATGQDNEIEYFETGSNDRPSSQPHLGYEQHNTSAVRRFFDSFKRADQG 69

Query: 54  ---EVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRH 110
              EVE  + ++  +    S R  +             ++I A    +   +K+ ++PRH
Sbjct: 70  PQDEVEATQMNDLTSAISPSSRQAQELEKNES-----SDNIGANTGHKSDSLKKTIQPRH 124

Query: 111 XXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMA-TFIPVTS 169
                                + +AGP G LI Y  MG++++ + Q+ GEMA  +  +T 
Sbjct: 125 VLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTG 184

Query: 170 SFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVL 229
            +  + S  V D FG A  ++Y   W     LEL      I++WT  V    ++ IF+VL
Sbjct: 185 GYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVL 244

Query: 230 IVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM-VCGAGITGPVGFRYWRHPGPWG 288
           ++ +N F  + Y E EF+    K++ + GF I  + + V GAG  G +G +YW  PG + 
Sbjct: 245 VITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAFN 304

Query: 289 PGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXX 348
            G  + D    RF G  ++L+ AAF + G+E + IT  E +NPRK++P A K++  R   
Sbjct: 305 -GKHAID----RFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILF 359

Query: 349 XXXXXXXXXXXXVPYN-DPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISA 407
                       VPYN D  L ST     ASP++IA+ + G +V+PH  NAVIL +++S 
Sbjct: 360 LFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINAVILLSVLSM 419

Query: 408 ANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAF 466
           ANS+ Y  +R+   LS    APK F    R G P IA+  +A F  +A+   S   +  F
Sbjct: 420 ANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVF 479

Query: 467 NWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLI 526
            WLL I+G++  F W +I +SH+RF + +K +G S  +L +K+      + Y    + LI
Sbjct: 480 TWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILI 539

Query: 527 ILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYI 559
           ++ Q + A AP    K D+ AF   Y++  + + +Y+
Sbjct: 540 LIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYV 576

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  269 bits (687), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 158/490 (32%), Positives = 255/490 (52%), Gaps = 23/490 (4%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           EED   T       +K+ LK RH                     +   GP G  IAY  +
Sbjct: 68  EEDYTNT-------LKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCII 120

Query: 148 GTLVFSVTQSLGEMATFIP-----VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALE 202
            ++++ +  ++GEM  ++P        S T    R+V +    A G+ Y++ + I  A E
Sbjct: 121 SSVIYPIMNAVGEMVCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAE 180

Query: 203 LSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIY 262
            +    V+E+WT  VP AAWI+IF  +I ++N   VK +GE EFW ASIK++ I+G II 
Sbjct: 181 CTAAAGVVEYWTLAVPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIIL 240

Query: 263 CLCMVCGAGITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-QGTEL 320
              +  G G +   +GFRYW++PG +   +   D +   FL   S +I  AF +  G EL
Sbjct: 241 SFILFWGGGPSHDRLGFRYWKNPGAFAHHV--TDGSLGNFLDIYSGIIKGAFAFILGPEL 298

Query: 321 VGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSY----VS 376
           V +T+ E ++ R+++ +A K+   R               V +NDP L+S  S       
Sbjct: 299 VALTSSECSDQRRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAG 358

Query: 377 ASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-T 435
           +SPF+I IQN+G +VLPHI NA ILT+  S+ N+ ++  SR L+ ++    APK F +  
Sbjct: 359 SSPFVIGIQNAGIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRIN 418

Query: 436 RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTL 495
           + GVP++AV+ +     LAY+  S+     F WL NI+ ++GF  W+   I+++RF + +
Sbjct: 419 KYGVPYMAVILSTLISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAI 478

Query: 496 KHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKF-DSTAFLTAYISCFLF 554
            +  +  D +P+K    P L  +    V++I +  G+  F PKF + + F+ AYI+  +F
Sbjct: 479 FYNNL-YDRMPFKTWGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIF 537

Query: 555 LFIYIVAQCY 564
           L +Y+  + Y
Sbjct: 538 LALYVGHKVY 547

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  268 bits (686), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 180/554 (32%), Positives = 277/554 (50%), Gaps = 46/554 (8%)

Query: 15  HESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKSDEDATLTKASKRHV 74
           HE   T  +++ D + +  +R +W R   F+   +  E E      + D  LT A K  +
Sbjct: 30  HEPCSTLSSNNNDNESRGSIRCKWTR---FVDSFKRIELE------ELDPNLTDAEKIAI 80

Query: 75  RXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQN 134
                                    + +K  LK RH                     ++ 
Sbjct: 81  ---------------------ATARSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRT 119

Query: 135 AGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFS 194
           AGP G LI +   GT+++S+  ++GE+A   PV+  FT +A+RF+ + FG A  + Y   
Sbjct: 120 AGPAGILIGWTVTGTMIYSMVMAVGELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQ 179

Query: 195 WAITFALELSVVGQVIEFWTFKVPL-AAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKV 253
           W IT  LE+      + +W         ++++FWV  VI+N F VK YGE EF  A IKV
Sbjct: 180 WLITLPLEIVSASITVNYWGVDAKYRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKV 239

Query: 254 IAIIGFIIYCLCMVCGAGITGPVGF-RYWRHPGPWGPGIISKDKNEARFLGWVSSLINAA 312
           + IIGFII  + ++CG G  G     +YW HPG +       D    +F G+ +  I A+
Sbjct: 240 VTIIGFIIMAVILICGGGPVGGYIGAKYWHHPGAF-----VGDTAGQKFKGFCTVFITAS 294

Query: 313 FTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL---S 369
           F++ G+E+VG+   E+ NPRKSVP A K+V  R               VPYND +L   S
Sbjct: 295 FSFGGSEVVGVAGSESENPRKSVPGAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGAS 354

Query: 370 STDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAP 429
           S D+  +ASPF+IA+ N G + LP + N VIL +++S  NS++Y+ SR L  L+     P
Sbjct: 355 SVDA--AASPFVIAVVNQGIRGLPSVINVVILISVLSVGNSSIYLCSRTLTALAEQGFLP 412

Query: 430 KFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISH 488
           K      RNG P +A+   +AFG +A++  S+     FNWLL ++G++  F+W +I I H
Sbjct: 413 KIVAYIDRNGRPLVAIGIASAFGLIAFVAESSHEGEVFNWLLALSGLSSLFSWSAICICH 472

Query: 489 IRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKF---DSTAFL 545
           IRF + L  +G S D+LP+ + +    +Y+G F   L+++ Q +    P     ++  F 
Sbjct: 473 IRFRRALVAQGRSTDELPFVSTVGIAGSYWGIFICVLMLIAQFYVGLFPAGASPNAKDFF 532

Query: 546 TAYISCFLFLFIYI 559
            AY+S  + L  YI
Sbjct: 533 MAYLSFPIVLAFYI 546

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  268 bits (686), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 162/483 (33%), Positives = 253/483 (52%), Gaps = 14/483 (2%)

Query: 96  VVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVT 155
           +     +K  LK RH                     ++ AGP   +I +   G++++S+ 
Sbjct: 83  ITAHTPLKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMV 142

Query: 156 QSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTF 215
            ++ EMA   P++  FT +A+RF+ + FG A  + Y   W +   LE+      + +W  
Sbjct: 143 MAVAEMAVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGT 202

Query: 216 KVPL-AAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG 274
                  ++++FW++IVI+N F VK YGE EF  ++IKVI ++GFII  L +VCG G TG
Sbjct: 203 PTKYRDGFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTG 262

Query: 275 PVGF-RYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
                +YW  PG +           A+F G+ S  + AAF++ G+EL+GI   EA NPRK
Sbjct: 263 GYVGAKYWHDPGAF-----VGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRK 317

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAIQNSGTKVL 392
           +VP A K+V  R               VP ND +L  S++   +ASPF+IAI   G + L
Sbjct: 318 AVPPAAKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGIRGL 377

Query: 393 PHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFG 451
           P + N VIL  ++S  NS +Y  SR L  L+     PK      R+G P + +  ++ FG
Sbjct: 378 PSVINVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFG 437

Query: 452 ALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAAL 511
            +A++  S    + FNWLL I+G++ FF W +I + HIRF   LK +  S D+LP+ + L
Sbjct: 438 LVAFVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPL 497

Query: 512 MPGLAYYGAFFVTLIILIQGFTAFAPKFDS---TAFLTAYISCFLFLFIYIVAQCYFRTR 568
               +Y+G F + L++  Q + A  P  D+   T F +AY+S  + L +YI  + +  T+
Sbjct: 498 GVFGSYWGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLW--TK 555

Query: 569 LWR 571
            W+
Sbjct: 556 NWK 558

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  268 bits (684), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 170/492 (34%), Positives = 257/492 (52%), Gaps = 16/492 (3%)

Query: 90  DIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGT 149
           D +  G  E  ++K++L+ RH                     +  AGP   LIAY  MG 
Sbjct: 47  DWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGW 106

Query: 150 LVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQV 209
           +VF+V   LGEMA +IP+   FT +A+R+     G A G+ Y F + +    +L+    V
Sbjct: 107 VVFTVMSCLGEMAAYIPL-DGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALV 165

Query: 210 IEFW--TFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
           I+FW    +V    WI++   +IV++N   V+ +GEFEFW++S KV+ ++  +I  L + 
Sbjct: 166 IQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLA 225

Query: 268 CGAGITGP-VGFRYWRHPGPWGPGIISKDKNE-----ARFLGWVSSLINAAFTYQGTELV 321
            G G T   +GFRYW  PG +     SK          +F+ ++S  + A F Y GTEL 
Sbjct: 226 LGGGPTHDRLGFRYWSDPGAFKE--YSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELC 283

Query: 322 GITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSAS--- 378
           GI A E  +PR++VPRAIK    R               V YNDP L    S   ++   
Sbjct: 284 GIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAAS 343

Query: 379 PFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN- 437
           P+++AI+N+   VLP++FNA +LT + SA NS++YVGSR LYGL+    APK F +T   
Sbjct: 344 PYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKW 403

Query: 438 GVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKH 497
           GVP+ A+     F  LAYM  S   + AF + +N+T + G  +W+SI I++I F +  + 
Sbjct: 404 GVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRA 463

Query: 498 RGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPK-FDSTAFLTAYISCFLFLF 556
           +G+ +  L Y A   P   +    F   + LI+ F AF  K  D   F+T YI   +++F
Sbjct: 464 QGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLPIYIF 523

Query: 557 IYIVAQCYFRTR 568
            +I  +   +T+
Sbjct: 524 CFIGYKIVHKTK 535

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  270 bits (689), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 154/471 (32%), Positives = 246/471 (52%), Gaps = 14/471 (2%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           ++  +K+ +KPRH                     + NAGP G +I Y  MG+ V+ + Q+
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 158 LGEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
            GE+A  +  +   F  +    V    G +  +++   W     LEL      I++WT K
Sbjct: 201 CGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVK 260

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGP 275
           V    ++ IF+VLI+++N F  K Y E +F+    K++ IIGF I  + + CG AG  G 
Sbjct: 261 VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGY 320

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +G +YWR PG +       D    RF G V++ + AAF +  +E + +TA E +NPRK++
Sbjct: 321 IGSKYWRDPGAF-----RGDTPIQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPY-NDPKLSSTDSYVSASPFIIAIQNSGTKVLPH 394
           P A KK+  R               VPY +D  L +  S   ASP++IA+ + G +V+PH
Sbjct: 376 PSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPH 435

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGAL 453
             NAVIL +++S ANS  Y  SRIL  L+    APK F    R G P +A+L +A FG +
Sbjct: 436 FINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVI 495

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           A+  +S   ++ F WLL I+G++  F W++I +SHIRF + +K +G S  ++ YK+ +  
Sbjct: 496 AFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGV 555

Query: 514 GLAYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISCFLFLFIYI 559
             + Y    + L ++ Q + A AP     K  + +F   Y++  + + +YI
Sbjct: 556 WGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYI 606

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  266 bits (680), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 164/525 (31%), Positives = 270/525 (51%), Gaps = 15/525 (2%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           E  ++ T   +E  +++ L  RH                     + N GP+   ++++ +
Sbjct: 33  ESQLEGTKC-DENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFVII 91

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
             +V+ V  +L EM  ++P   +     SR+V    G A G+ Y +S++I  A ELS   
Sbjct: 92  SFIVYPVMNTLAEMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSAAA 151

Query: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
            V+++WT KV +A WI+IF V++V +NF PVK YGE EFW AS+K+I I+G +I  + + 
Sbjct: 152 GVVQYWTDKVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIVIF 211

Query: 268 CGAGITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-QGTELVGITA 325
            G   +   +GFRYW +PGP+   I     N  RFL   +++I + F +    EL+G+  
Sbjct: 212 FGGAPSHDRLGFRYWNNPGPFAYHI--TGGNTGRFLDIWTAIIKSGFAFILSPELIGLAC 269

Query: 326 GEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPK----LSSTDSYVSASPFI 381
            EA + R+++ +A ++   R               +  +DPK    L+S     ++SPF+
Sbjct: 270 VEAKDTRRNIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFV 329

Query: 382 IAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVP 440
             I N+G  VL HI NAVIL++  S+ANS +Y  SR +  L+    APK F +  R GVP
Sbjct: 330 QGISNAGIPVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGVP 389

Query: 441 FIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGM 500
           + AV  + A   L Y+  S+     F WL NI  ++GF  W  I I+++RF + + +  +
Sbjct: 390 YNAVALSTAVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIFYNNL 449

Query: 501 SRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKF-DSTAFLTAYISCFLFLFIYI 559
             + +P+K+AL P   Y+   FV L+ L  G+  F PK+ +++ F+ AYI+  +F  +Y+
Sbjct: 450 -YERVPFKSALQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIFFLLYL 508

Query: 560 VAQCYFRTRLW---RTLXXXXXXXXXXXXXXXIWEEGPQTFWDKF 601
             + +F+TR +   R +                    P+  W+KF
Sbjct: 509 GHKIWFKTRWYIPFREIDVITGLADAEEEAKMTQPRTPKNMWEKF 553

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  266 bits (681), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 161/498 (32%), Positives = 262/498 (52%), Gaps = 22/498 (4%)

Query: 89  EDIDATGVV---EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYI 145
           E++D+T      ++A+  ++L  RH                     +   GP   +I ++
Sbjct: 56  ENLDSTSQEVEDQDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWV 115

Query: 146 FMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSV 205
            + T +F++  +LGE+++  PV   F V+ SRFV   FG A    Y   WA+   LEL  
Sbjct: 116 IISTCLFTIVNALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVA 175

Query: 206 VGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLC 265
               I +W   +   AW++IF+ +I++ N   VK +GE EF ++ +K++AIIGF I  + 
Sbjct: 176 ASLTIRYWNHTINSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIV 235

Query: 266 MVC-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGIT 324
           + C G    G +G +YW +PG +  G  + D    RF G  S  + AAF+Y GTEL+ ++
Sbjct: 236 LTCGGGPKGGYIGGKYWSNPGAF-VGHTAGD----RFHGLCSVFVTAAFSYSGTELIAVS 290

Query: 325 AGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL--SSTDSYVSASPFII 382
           A E+ NPR ++P+A K+                   V  +DP+L   S+   V+ASP +I
Sbjct: 291 AAESVNPRITLPKACKRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVI 350

Query: 383 AIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPF 441
           AI+N G K LP + NA+IL  ++S ANS VY  SR +  ++     PK F    R G P 
Sbjct: 351 AIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPL 410

Query: 442 IAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMS 501
            A++ T  FG L+++  S   +  F WL  ++G++  F W +I++SHIRF +T+K RG +
Sbjct: 411 YAIVATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRT 470

Query: 502 RDDLPYKAALMPGL--AYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFL 555
            D+LP+ +  M G+  +YYG   + +++++  +T+  P      ++ +F   Y+S  + L
Sbjct: 471 LDELPFVS--MTGVWGSYYGCIVIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILL 528

Query: 556 FIYIVAQCYFRTRLWRTL 573
             Y   + Y  TR WR L
Sbjct: 529 ACYFGHKLY--TRSWRLL 544

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  266 bits (680), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 157/481 (32%), Positives = 249/481 (51%), Gaps = 16/481 (3%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
           E ++++ L  RH                     +   GP G  I+Y+ + T+++ +  + 
Sbjct: 53  EGKLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAF 112

Query: 159 GEMATFIP-----VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFW 213
           GEM  ++P        S +    R+V      A G+ Y++ + I  A E +    V+++W
Sbjct: 113 GEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYW 172

Query: 214 TFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT 273
           T  VP AAWI+IF  ++V++N   VK YGE EFW ASIKV+ I+G II    +  G G  
Sbjct: 173 TDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPN 232

Query: 274 GP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-QGTELVGITAGEAANP 331
              +GFRYW++PG +   I     N   FL   S +I  AF +  G EL+ + + E  + 
Sbjct: 233 HDRLGFRYWKNPGGFAHHI--TGGNLGNFLDVYSGIIKGAFAFILGPELIALASSECKDQ 290

Query: 332 RKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSY----VSASPFIIAIQNS 387
           R+++ +A K+   R               V  NDP L+S  +       +SPF+I IQN+
Sbjct: 291 RRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNA 350

Query: 388 GTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLF 446
           G K+LPHI NA ILT+  SA N+ ++  SR L  ++S   APK F K  R GVP++AV F
Sbjct: 351 GIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTF 410

Query: 447 TAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLP 506
           +A    LAY+  S+   + F W  NI+ ++GF  W    ++++RF + +K+ G+  + LP
Sbjct: 411 SALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYNGL-ENRLP 469

Query: 507 YKAALMPGLAYYGAFFVTLIILIQGFTAFAPKF-DSTAFLTAYISCFLFLFIYIVAQCYF 565
           Y       + ++    VTL+I   G+  F P+F + + F+ AYI+  LF+ ++I  + Y 
Sbjct: 470 YAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYT 529

Query: 566 R 566
           R
Sbjct: 530 R 530

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  267 bits (683), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 164/526 (31%), Positives = 261/526 (49%), Gaps = 20/526 (3%)

Query: 59  KSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDAT----GVVEEAQVKRELKPRHXXXX 114
           + D+   + K SK H              + D++ +    G  E  ++K+ L+ RH    
Sbjct: 63  EKDDAIRMEKISKNHSASSNGTIREDLIMDVDVEKSPSVEGDNEPHKLKQGLQSRHVQLI 122

Query: 115 XXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTV- 173
                            +   GP G  I+YI +  +++ +  +LGEM  F+P   S +  
Sbjct: 123 ALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAG 182

Query: 174 ----FASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVL 229
                 +R+V    G A G+ Y++ + I  A E +    V+E+WT  VP   WI+IF  +
Sbjct: 183 STANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCV 242

Query: 230 IVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP-VGFRYWRHPGPWG 288
           +V++N   VKVYGE EFW ASIK++ I+G II    +  G G     +GFRYW+HPG + 
Sbjct: 243 VVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFA 302

Query: 289 PGIISKDKNEARFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKSVPRAIKKVSVRXX 347
             +     +   F    + +I  AF +  G ELV +T+ E A+ R+++ +A ++   R  
Sbjct: 303 HHL--TGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNISKASRRFVWRLI 360

Query: 348 XXXXXXXXXXXXXVPYNDPK----LSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTT 403
                        VPYNDP     L+       +SPF+I IQN+G KVLPHI N  IL++
Sbjct: 361 FFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILSS 420

Query: 404 IISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGG 462
             SAAN+ ++  +R L  ++    APK   +  R GVP++AV  +     LAY+  S+  
Sbjct: 421 AWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVGVSFLCSCLAYLNVSSST 480

Query: 463 QNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFF 522
            + FNW  NI+ ++GF  W+   I+++RF + + + G+  D LP+K    P   +     
Sbjct: 481 ADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-FDRLPFKTWGQPYTVWASLIV 539

Query: 523 VTLIILIQGFTAFAPKFDSTA-FLTAYISCFLFLFIYIVAQCYFRT 567
           V +I L  G+  F PK+   A F+ AYI+  +FL ++   + Y RT
Sbjct: 540 VGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLYTRT 585

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  267 bits (683), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 153/470 (32%), Positives = 243/470 (51%), Gaps = 13/470 (2%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           +  ++K+ +KPRH                     + NAGP G LI Y  MGT ++ + Q+
Sbjct: 102 KNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQA 161

Query: 158 LGEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
            GE+A ++  ++  F V+ S  V   FG +  ++Y   W     LEL      I++WT  
Sbjct: 162 AGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTT 221

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM-VCGAGITGP 275
           V    ++ IF+VLI+++N F  + Y E EF+    K++ +IGF I  + +   GAG  G 
Sbjct: 222 VNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGY 281

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +G RYW  PG +     + D+    F G +++++ AAF +  TE + +TA E +NPRK++
Sbjct: 282 IGDRYWHTPGAF-----AGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAI 336

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYN-DPKLSSTDSYVSASPFIIAIQNSGTKVLPH 394
           P A KKV  R               VPY+ D  + S  S   ASP+++A+   G KV+PH
Sbjct: 337 PSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKASPYVLAVSTHGVKVVPH 396

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGAL 453
             NAVIL +++S  NS  Y  SR+LY L+    APKFF    R G PF A++    F  +
Sbjct: 397 FINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAII 456

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           ++   S   +  F WLL I+G++  F W +I +SHIRF + +  +  S  ++ +KA    
Sbjct: 457 SFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGV 516

Query: 514 GLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYI 559
             +YY  F + +I++ Q + A AP    K D+  F   Y++  + +  Y+
Sbjct: 517 WGSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYV 566

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  268 bits (685), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 187/579 (32%), Positives = 280/579 (48%), Gaps = 38/579 (6%)

Query: 16  ESLETQEASS--WDKKLKDKVRNEWARDRRFLHRHR-----------GSEGEVE-YAKSD 61
           ES    ++SS     K   +V+NE  R R +L   +             E  VE Y+  +
Sbjct: 53  ESTNNNQSSSPHGASKFLPQVKNE--RFRNWLDSFKRAETPNASSSTADENAVENYSMQE 110

Query: 62  EDATL-TKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXX 120
            D  L  K S  H+R             + ++     E AQ+K+ +KPRH          
Sbjct: 111 FDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQD--ENAQLKQTIKPRHVIMMSLGTGI 168

Query: 121 XXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMAT-FIPVTSSFTVFASRFV 179
                     P+  AGP   +I Y  MGT ++ + Q+ GE+A  +  V  SF  F S  V
Sbjct: 169 GTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLV 228

Query: 180 SDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVK 239
              F  A  ++Y   W     LEL      I++WT KV    ++ IF+VLI+++NFF  K
Sbjct: 229 DPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDVFVVIFYVLILLINFFGAK 288

Query: 240 VYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGPVGFRYWRHPGPWGPGIISKDKNE 298
            Y E EF+    KV+ +IGF I  +C+  G AG  G +G +YW  PG +      + K E
Sbjct: 289 GYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFR----GQTKIE 344

Query: 299 ARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXX 358
            RF G + + + AAF +  TE + +TA E +NPRK++P A KKV+ R             
Sbjct: 345 -RFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVAYRILLIFLTSIILIG 403

Query: 359 XXVPYN-DPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSR 417
             VPYN D  + S+    SASP+++A    G  V+ H  NAVIL +++S ANS  Y  SR
Sbjct: 404 FLVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSR 463

Query: 418 ILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVA 476
           +L GL+    APK+F    RNG P  ++L  A    +A+  TS    + F WLL I+G++
Sbjct: 464 LLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAIIAVIAFCATSPKETDVFTWLLAISGLS 523

Query: 477 GFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFA 536
             F W +I +SHIRF + ++ +G S  +L ++A      +YY A  + L ++ Q + A  
Sbjct: 524 QIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALV 583

Query: 537 P----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571
           P      D+  F   Y++  + L +Y+        +LWR
Sbjct: 584 PMNTHTLDAENFFQNYLAMPILLALYV------GFKLWR 616

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  266 bits (679), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 158/477 (33%), Positives = 246/477 (51%), Gaps = 14/477 (2%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
           ++++K+ +K RH                     +   GP   +I Y+ +  + + + Q+ 
Sbjct: 88  DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAA 147

Query: 159 GEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217
           GEMA   P + ++F  ++S F+S PFG A  ++Y F W     LEL      I+FW  K+
Sbjct: 148 GEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFWNDKI 207

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITGPV 276
               +I IF+V ++ ++FF VK YGE EF     K++ I GFI+  + + C GAG  G +
Sbjct: 208 NPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYI 267

Query: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336
           G  YW  PG +     + D + ARF      L+ A F++ G EL  ++  E  NPRKS P
Sbjct: 268 GGAYWHKPGAF-----AGDTSIARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRKSTP 322

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPYNDPK-LSSTDSYVSASPFIIAIQNSGTKVLPHI 395
            A K+   R               VPYND + L +  S   ASP+++A    G +++PHI
Sbjct: 323 VAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHASPYVLAASIHGVRIVPHI 382

Query: 396 FNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALA 454
            NAVIL +++S ANS++Y G R++  L+    APKF     R G P  A++     G +A
Sbjct: 383 INAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVIGVIA 442

Query: 455 YMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPG 514
           ++  S+  +  F WL  I G++  F W SI +SH+RF Q +K +G S ++L YKA     
Sbjct: 443 FVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKATTGIW 502

Query: 515 LAYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
            + YG+FF  L+ + Q + A AP     K ++ AF  +Y++  ++L  YI    Y R
Sbjct: 503 GSIYGSFFNILVFIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGYMIYNR 559

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  266 bits (679), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 164/475 (34%), Positives = 249/475 (52%), Gaps = 16/475 (3%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
           +A +K  LK RH                     ++ AGP G +I +    T+++ +  +L
Sbjct: 92  KAPLKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMAL 151

Query: 159 GEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFW-TFKV 217
           GE+A   PV+  FT +A+RF+ + FG A  + Y   W  T  LE+      + +W T + 
Sbjct: 152 GELAVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPER 211

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITGPV 276
               ++++FW++IVI+N F V+ +GE EF  ++IKV+ +IGFII  + +V  G    G V
Sbjct: 212 YRDGFVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFV 271

Query: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336
           G RYW +PG +       D    +F G  S  + AAF++ G+ELVGITA EAANPRKSVP
Sbjct: 272 GGRYWHNPGAF-----VGDNAGTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVP 326

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASPFIIAIQNSGTKVLP 393
           RA K+V  R               VPY DP+L   SS D+  SASPF+IAI   G + LP
Sbjct: 327 RAAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDA--SASPFVIAIVTHGIRGLP 384

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGA 452
            + N VIL  ++S  NS ++ GSR +  LS     P+ F    R G P + ++  + FG 
Sbjct: 385 SVINVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGL 444

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           +A++  S      F WL+ ++G++  F W  I + HIRF   LK +G S ++LP+ +   
Sbjct: 445 IAFIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAG 504

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAP---KFDSTAFLTAYISCFLFLFIYIVAQCY 564
              + +G F + L+ + Q + A  P   K  +  F  +Y+S  + L  Y   + Y
Sbjct: 505 IIGSSWGLFMLLLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHKIY 559

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  265 bits (677), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 171/563 (30%), Positives = 265/563 (47%), Gaps = 43/563 (7%)

Query: 13  SYHESLETQEASSWDKKLKDKVRNEWA----RDRRFLHRHRGSEGEVEYAKSDEDATLTK 68
           S ++     E SS  K      ++ +     +D   +HR   S    E     +D+ L  
Sbjct: 5   SSNDEFVLTEVSSSPKTTPQHSKSSYEPASRQDSTMIHRFVNSFKRAEQPPLKQDSDL-- 62

Query: 69  ASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXX 128
                              EED D   +V + Q+K+ +K RH                  
Sbjct: 63  -------------------EEDTDT--IVTDTQLKKTMKSRHVVMMSLGTGIGTGLLVAN 101

Query: 129 XXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAAC 187
              +  AGP   +IAY  +  + + + Q+ GEMA   P +  +F  + S F+S PFG A 
Sbjct: 102 AQGLHKAGPAPLVIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISKPFGFAT 161

Query: 188 GYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFW 247
            ++++  W     LEL      +++W   +    ++ IF+V ++ ++FF VK YGE EF 
Sbjct: 162 VWLFFIQWLTVLPLELITAAMTVQYWNDSINADVYVVIFYVFLLFIHFFGVKAYGETEFI 221

Query: 248 VASIKVIAIIGFIIYCLCM-VCGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVS 306
               K++ + GFII+ + + V GAG +G +G +YW  PG +     + D N  RF G   
Sbjct: 222 FNLCKILFVGGFIIFSIVVNVGGAGNSGYIGAKYWHDPGAF-----TSDTNAGRFKGVCY 276

Query: 307 SLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDP 366
            L+ A F+Y G EL  ++  E  NPR+S P A K+   R               VP N  
Sbjct: 277 VLVTAYFSYGGMELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPSNSN 336

Query: 367 KL-SSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSA 425
           +L  S  S   ASP+++A    G KV+PHI NAVIL ++IS  NS +Y   R++  L+  
Sbjct: 337 ELMGSGGSVTHASPYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAAPRLMCALAQQ 396

Query: 426 KLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSI 484
             APKF     R G P  A++  + FG + ++  S+  +  FNWL  I G+A  F W  I
Sbjct: 397 GFAPKFMDYVDREGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGI 456

Query: 485 SISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP----KFD 540
            ISHIRF Q +K +  S D++ YK+      +Y+G FF  L+ + Q + A AP    +  
Sbjct: 457 MISHIRFRQAMKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLVFVAQFWVALAPPMYTEMS 516

Query: 541 STAFLTAYIS---CFLFLFIYIV 560
           +  F  +Y++    F F F Y++
Sbjct: 517 ADTFFESYLAFPIFFAFYFGYMI 539

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  265 bits (676), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 170/524 (32%), Positives = 257/524 (49%), Gaps = 16/524 (3%)

Query: 54  EVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDI-DATGVVEEA-QVKRELKPRHX 111
           E+E    + DAT    S    R            E D+ D T  + +A  +K+ +K RH 
Sbjct: 25  ELESPSFNLDATEESRSGLVHRFVDSFKRAQDSTENDLEDGTKPLGDASHLKKAMKSRHV 84

Query: 112 XXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIP-VTSS 170
                               +   GP   +I Y+ +  + + + Q+ GEMA   P +  +
Sbjct: 85  IMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGN 144

Query: 171 FTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLI 230
           F  + S F+S PFG A  ++++  W   F LEL      I++W  K+    +I IF+V +
Sbjct: 145 FNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDKINADVFIVIFYVFL 204

Query: 231 VIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITGPVGFRYWRHPGPWGP 289
           + ++FF VK YGE EF   S KV+ I GFII  + + C GAG  G +G +YWR PG +  
Sbjct: 205 LFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIGAKYWRDPGSFAE 264

Query: 290 GIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXX 349
           G    D  E +F G    L+ A F+Y G EL  ++  E  NPRKS P+A K+   R    
Sbjct: 265 G----DSVE-KFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQAAKQSIYRILII 319

Query: 350 XXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAA 408
                      VP+N+ +L  S  S   ASP+++A    G KV+PH  NAVIL ++IS A
Sbjct: 320 YLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPHFINAVILISVISVA 379

Query: 409 NSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFN 467
           NS +Y   R++  L+    APKF     R G P  A++  A FG + ++  S+  +  F 
Sbjct: 380 NSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGFVSASSKEEEVFT 439

Query: 468 WLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLII 527
           WL  I G++  F W  I +SH+RF Q +K  G S +++ ++A      + YG  F  L+ 
Sbjct: 440 WLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLVF 499

Query: 528 LIQGFTAFAP-----KFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
           + Q + A AP     K D+ +F  +Y++  ++LF Y     Y R
Sbjct: 500 IAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYMLYKR 543

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  265 bits (677), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 158/479 (32%), Positives = 243/479 (50%), Gaps = 14/479 (2%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
            + ++R LK RH                     ++  GP   LI +  +G +++SV  ++
Sbjct: 77  RSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAM 136

Query: 159 GEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVP 218
           GE+A   PV   FT +  RFV D FG A  Y+Y   W +   LE+      + +W     
Sbjct: 137 GELAVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAK 196

Query: 219 LA-AWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVG 277
               ++++F+V+IVI+N F VK YGE EF  + IKV  ++GFII  + ++CG G  G   
Sbjct: 197 YRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYV 256

Query: 278 F-RYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336
             +YW +PG +     + D    RF    S  + AAF++ GTELVG+ A E  NPRK++P
Sbjct: 257 GGKYWHNPGAF-----NGDNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALP 311

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSY-VSASPFIIAIQNSGTKVLPHI 395
           RA K+V  R               VPY    L  + S   +ASPF++AI+  G   LP +
Sbjct: 312 RAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVLAIKTHGISGLPSV 371

Query: 396 FNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALA 454
            N VIL +++S  NS+VY  SR L  L+     P+ F    R G P + +L T  FG L 
Sbjct: 372 INVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLC 431

Query: 455 YMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPG 514
           ++  S    + FNWL+ ++G++  F W  I I H+RF + L  +G S D+L + + +   
Sbjct: 432 FIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVW 491

Query: 515 LAYYGAFFVTLIILIQGFTAFAPKF---DSTAFLTAYISCFLFLFIYIVAQCYFRTRLW 570
            +Y+G   + L+ + Q + A  P     +++ F  AY+S  + LF Y+  + Y  TR W
Sbjct: 492 GSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLY--TRNW 548

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  265 bits (676), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 166/480 (34%), Positives = 249/480 (51%), Gaps = 20/480 (4%)

Query: 102 VKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEM 161
           +KR LK RH                     ++  GP   +IA+I  G++V+SV Q+LGE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 162 ATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLA- 220
           A  +PV+ S+  + SRF+   FG A  Y Y     IT  LEL      + +W      A 
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKYAD 208

Query: 221 AWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT--GPVGF 278
           A++++F+++IV +N F VK YGE EF  + IKV AI+GFII  + +VCG G +  G +G 
Sbjct: 209 AFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIGA 268

Query: 279 RYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 338
           RYW +PG +  G          F G+ +  + +AF++ G+E+  + A E  NPRK +PRA
Sbjct: 269 RYWYNPGGFAHG----------FKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLPRA 318

Query: 339 IKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAIQNSGTKVLPHIFN 397
            K+V  R               VPY D  L +++    SASPF+IAI  +G K LP + N
Sbjct: 319 AKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLPSVVN 378

Query: 398 AVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYM 456
            VIL  ++S  N  VY  SR +  L+     P+ F    R G P + +L  A FG L+++
Sbjct: 379 VVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLSFL 438

Query: 457 ETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLA 516
             S+     F+W+L I+G+  FF W SI + H+RF + L  +G S D+L YKA      +
Sbjct: 439 SASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGIWGS 498

Query: 517 YYGAFFVTLIILIQGFTAFAP---KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTL 573
            YG   + +++  Q + A  P     ++  F +AY+S  + +F Y   + Y  TR W  L
Sbjct: 499 LYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLY--TRSWTFL 556

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  265 bits (677), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 172/562 (30%), Positives = 280/562 (49%), Gaps = 25/562 (4%)

Query: 23  ASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKSDEDATLTKASKRHVRXXXXXXX 82
           +S+ DKK  + V+   +      + H+  + E      D+D  + K SK           
Sbjct: 27  SSAGDKKDDNVVQVTESASSGSRNNHQRYDNE-----KDDDIRMEKISKDQSASSNGTIH 81

Query: 83  XXXXXEEDID----ATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPV 138
                + D++    A G  E  ++K+ L+ RH                     +   GP 
Sbjct: 82  EELVMDVDLEKSPSADGDNEPRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPG 141

Query: 139 GSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTV-----FASRFVSDPFGAACGYMYWF 193
           G  I+YI +  +++ +  +LGEM  F+P   S +        +R+V    G A G+ Y++
Sbjct: 142 GLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFY 201

Query: 194 SWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKV 253
            + I  A E +    V+E+WT  VP   WI++F +++V++NF  VKVYGE EFW ASIK+
Sbjct: 202 CYVILVAAECTAASGVVEYWTTAVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKI 261

Query: 254 IAIIGFIIYCLCMVCGAGITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAA 312
           + I+G II    +  G G     +GFRYW+HPG +   +     +   F    + +I  A
Sbjct: 262 LCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGAFAHHLTG--GSLGNFTDIYTGIIKGA 319

Query: 313 FTY-QGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDP----K 367
           F +  G ELV +T+ E A+ R+++ +A ++   R               VPYNDP     
Sbjct: 320 FAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNA 379

Query: 368 LSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKL 427
           L+       +SPF+I IQN+G KVLPHI N  ILT+  SAAN+ ++  +R L  ++    
Sbjct: 380 LAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQ 439

Query: 428 APKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISI 486
           APK   K  R GVP++AV  +     LAY+  S+   + FNW  NI+ ++GF  W+   I
Sbjct: 440 APKCLGKINRWGVPYVAVAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCI 499

Query: 487 SHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTA-FL 545
           +++RF + + + G+  D LP+K    P   ++    V++I +  G+  F PK+   A F+
Sbjct: 500 AYLRFRKAIFYNGL-YDRLPFKTWGQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFI 558

Query: 546 TAYISCFLFLFIYIVAQCYFRT 567
            AY++  +FL +++  + Y RT
Sbjct: 559 AAYVTLPIFLVLWLGHKLYTRT 580

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  264 bits (674), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 152/442 (34%), Positives = 235/442 (53%), Gaps = 13/442 (2%)

Query: 102 VKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEM 161
           ++ +LK RH                     ++ AGP G LI +I  G++++ +  S+ E+
Sbjct: 84  LQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAEL 143

Query: 162 ATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFW-TFKVPLA 220
           A   PV   FT +A+RF+ + +G A  + Y   W +T  LE+      + +W T K    
Sbjct: 144 AIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRD 203

Query: 221 AWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGF-R 279
            ++++FWV+IVI+N F V+ YGE EF  +  K++ I+GFII  + ++CG G        R
Sbjct: 204 GFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGAR 263

Query: 280 YWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 339
           YW HPG +     + D +  +F G+ S  + AAF++ G+ELVG+ A EA+NPRK VP A 
Sbjct: 264 YWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGAA 318

Query: 340 KKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASPFIIAIQNSGTKVLPHIF 396
           K+V  R               VPY DP+L   SS D+  +ASPF+IAI+N G   LP + 
Sbjct: 319 KQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDA--AASPFVIAIKNQGISGLPTLV 376

Query: 397 NAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAY 455
           N VIL  ++S  NS VY  SR L  L+     PK F    R G P + +  T+AFG +A+
Sbjct: 377 NVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIAF 436

Query: 456 METSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGL 515
           +  S      F+WL+ ++G++  F W +I + HIRF + L  +G S ++L + +      
Sbjct: 437 VAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVWG 496

Query: 516 AYYGAFFVTLIILIQGFTAFAP 537
           A +G F   +++  Q + A  P
Sbjct: 497 AAWGLFLCIIMLAAQFYVALFP 518

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  265 bits (678), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 159/483 (32%), Positives = 242/483 (50%), Gaps = 20/483 (4%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           EE  +K+ +KPRH                     + NAGP G +I Y  MG+ ++ + Q+
Sbjct: 138 EEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQA 197

Query: 158 LGEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
            GEMA  +  +   F  + S  V   FG A  ++Y   W     LEL      I++WT  
Sbjct: 198 AGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTT 257

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM-VCGAGITGP 275
           V   A++ IF+V+I+ +  F  + Y E EF+    K++ IIGF I  + +   GAG  G 
Sbjct: 258 VNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGY 317

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +G +YW  PG +            RF G +++ ++AAF +  TE + +TA E +NPRK++
Sbjct: 318 LGAKYWHDPGAF-----RGTNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAI 372

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYN-DPKLSSTDSYVSASPFIIAIQNSGTKVLPH 394
           P A KKV  R               VP++ D  + +  S   ASP+++AI   G +V+PH
Sbjct: 373 PSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVPH 432

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGAL 453
             NAVIL ++ S ANS  Y  SR+L GL+    APKFF    R G PF A+   A FG +
Sbjct: 433 FINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVI 492

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           A+   S      F WLL I+G++  F W++I +SHIRF + +  +G S  ++ +KA L  
Sbjct: 493 AFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGV 552

Query: 514 GLAYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568
             +YY    + L ++ Q + A AP       D+  F   Y++      + I+   YF  +
Sbjct: 553 YGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLA------MPILIAFYFGYK 606

Query: 569 LWR 571
           LW+
Sbjct: 607 LWK 609

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  264 bits (674), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 167/482 (34%), Positives = 254/482 (52%), Gaps = 14/482 (2%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
            + ++ +LK RH                     ++ AGP G LI +   GT++F++  +L
Sbjct: 85  RSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMAL 144

Query: 159 GEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVP 218
           GE+A   PV+  FT +A+RF+ + FG AC + Y   W +   LE+      + +W   V 
Sbjct: 145 GELAVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVR 204

Query: 219 LA-AWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVG 277
               ++++FW+++VI+N F V+ YGE EF  + IKV A+IGFII  + +VCG G  G   
Sbjct: 205 YTDGFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYV 264

Query: 278 F-RYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336
             RYW +PG +         +  +F G+ S  + AAF++ G+EL+G+   EA NPRK+VP
Sbjct: 265 GARYWHNPGAF-----VGSTSGQKFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVP 319

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAIQNSGTKVLPHI 395
            A K+V  R               VPYNDP+L SS+    SASPF+IAI   G   LP +
Sbjct: 320 SAAKQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVTHGISGLPSV 379

Query: 396 FNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALA 454
            N VIL +++S  NS +Y  SR L  LS     PK      R G P + +  ++ FG +A
Sbjct: 380 INVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIA 439

Query: 455 YMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPG 514
           ++  S      FNWLL I+G++ FF W +I I HIRF   LK +G   D+LP+ +     
Sbjct: 440 FVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPAGVI 499

Query: 515 LAYYGAFFVTLIILIQGFTAFAPKFDSTA---FLTAYISCFLFLFIYIVAQCYFRTRLWR 571
            +Y+G F   L+++ Q + A  P   S +   F +AY++  + L  YI  + + +   W+
Sbjct: 500 GSYWGLFLNILMLIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAHKLWKKN--WK 557

Query: 572 TL 573
            L
Sbjct: 558 FL 559

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  265 bits (678), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 158/485 (32%), Positives = 245/485 (50%), Gaps = 13/485 (2%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           E+   +    E+   K  +K RH                     +  +GP G ++ Y  +
Sbjct: 140 EDGTTSIAASEDMPKKGGMKARHVIMMTLATGIGTGLLVANAKSLHFSGPAGLVVGYFMV 199

Query: 148 GTLVFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVV 206
             + + V Q+ GEMA   P +   F  + S F+S PFG A  +++  +W     LEL   
Sbjct: 200 SFVTYFVVQAAGEMAIAYPTLPGGFNTYQSLFISKPFGFATVWIFALNWLTILPLELITS 259

Query: 207 GQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM 266
              +++WT  +    ++ IF++ ++ ++F  +++Y E EF+  S K++ I GFII+ + +
Sbjct: 260 SITVKYWTTSINPDIFVLIFYLFLLFVHFIGLRLYAEAEFFFNSCKILMITGFIIFSIVV 319

Query: 267 VCG-AGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITA 325
            CG AG  G +G +YW  PGP+     + D   ARF      LINA F+Y GTEL  ++ 
Sbjct: 320 NCGGAGHDGYIGGKYWHDPGPF-----ASDNGAARFKEVCYVLINAYFSYGGTELYVLSV 374

Query: 326 GEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQ 385
            E  NPRK+VP A K    R               VPYN P L    +   ASP+++A Q
Sbjct: 375 NEQENPRKAVPVAAKTSVYRVAIIYLLTMILIGFNVPYNSPDLMGNANSKDASPYVLAAQ 434

Query: 386 NSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAV 444
             G K++PH  NAVIL ++IS ANS ++ G R+L  L+    APKF     R G P +A+
Sbjct: 435 IHGVKIVPHFINAVILLSVISVANSALFAGPRLLATLAEQGFAPKFLTYVDRAGRPLLAL 494

Query: 445 LFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDD 504
              + FG +A+  TS      F WL  I G++  FAW  I +SHIRF   +K+ G S D+
Sbjct: 495 CVCSLFGVIAFAATSKKEDEVFTWLAAIAGLSELFAWSGILLSHIRFRWAMKYHGKSMDE 554

Query: 505 LPYKAALMPGLAYYGAFFVTLIILIQGFTAF-AP----KFDSTAFLTAYISCFLFLFIYI 559
           + YKA      +YYG FF  L+++ Q + A  AP    +  + +F  +Y++  +++F Y+
Sbjct: 555 VGYKAITGIWGSYYGLFFNLLVLIAQFWVALSAPGSGGQVTAISFFESYLAFVIWVFFYL 614

Query: 560 VAQCY 564
               Y
Sbjct: 615 CYMIY 619

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  263 bits (671), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 165/500 (33%), Positives = 253/500 (50%), Gaps = 33/500 (6%)

Query: 88  EEDIDATGVVEE----AQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIA 143
           ++D D  G  EE    +++K+ +K RH                     +  AGP G +I 
Sbjct: 46  KQDDDVVGYDEETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIG 105

Query: 144 YIFMGTLVFSVTQSLGEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALE 202
           Y     +++ + Q+ GE+   +  +T ++T ++S  V    G +  ++Y   W   F L+
Sbjct: 106 YGVASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQ 165

Query: 203 LSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIY 262
           L      I++WT   P   +++I + LIV +N F  K Y E EF   + KV+ ++GF+I 
Sbjct: 166 LVTAAITIKYWTDTNP-DIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVIL 224

Query: 263 CLCMVCG-AGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELV 321
            + + CG AG  G +G RYW  PG +  G          F G       AAF Y G E++
Sbjct: 225 GIIINCGGAGNDGYIGARYWHTPGAFSTG----------FKGVCYVFCYAAFAYGGIEVM 274

Query: 322 GITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFI 381
            +TA E  NPRKS+P A KKV  R               VPY+ P+L+ST S   ASPF+
Sbjct: 275 VLTASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASRASPFV 334

Query: 382 IAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVP 440
           IAI + G  V+PHI NAVIL  ++S  NS++Y   R+L  LS    APK F    R G P
Sbjct: 335 IAIASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRP 394

Query: 441 FIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGM 500
            +  L     G LA++  S   ++ F+WLL I+G++  F W+SI +SH+RF   +K +G 
Sbjct: 395 LLCFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGR 454

Query: 501 SRDDLPYKAALMPGLAYYGAFF---VTLIILIQGF-TAFAP-----KFDSTAFLTAYISC 551
           S  ++ YK+       Y+G++F   V+L +L+  F  A AP     K  +  F  +Y++ 
Sbjct: 455 SLGEVGYKSQ----TGYWGSWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLAA 510

Query: 552 FLFLFIYIVAQCYFRTRLWR 571
            + +FIY   + Y++   WR
Sbjct: 511 PVLIFIYFGYKIYYKD--WR 528

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  262 bits (670), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 153/478 (32%), Positives = 243/478 (50%), Gaps = 11/478 (2%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           +++++ ++L  RH                     +   GP   +IA+  + T +F++  S
Sbjct: 60  KDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNS 119

Query: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217
           LGE++   PV   F V+ +RFV   FG A  + Y   WAI   LEL      I +W   +
Sbjct: 120 LGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYWNKSI 179

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITGPV 276
              AW+SIF+V I   N   VK +GE EF ++ +K++AIIGF I  + ++C G    G +
Sbjct: 180 NPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFI 239

Query: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336
           G +YW  PG +       D    RF G  +  I AAF+Y G ELVG++A E+ NPR ++P
Sbjct: 240 GGKYWNDPGAF-----VGDTPAQRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLP 294

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYV--SASPFIIAIQNSGTKVLPH 394
           +A K+                   VP NDP L +  S V  +ASP +IAIQN G K LP 
Sbjct: 295 KAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIAIQNGGIKGLPS 354

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGAL 453
           + NA+IL  ++S ANS VY  SR +  ++     P+      + G P  A+  T   G L
Sbjct: 355 LMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLL 414

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           +++  S      F WL  ++G++  F W +I+++H+RF   +KH+  S ++LPY +    
Sbjct: 415 SFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMTGE 474

Query: 514 GLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571
             ++YG   + L+++   +T+  P   + A  T++   +L L I+I   CY   ++W+
Sbjct: 475 WGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIA--CYLGHKIWK 530

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  263 bits (673), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 159/488 (32%), Positives = 250/488 (51%), Gaps = 19/488 (3%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
              ++K+ LK RH                     + N GP G  I+Y+ + T V+ +  +
Sbjct: 92  SNGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYPIMNA 151

Query: 158 LGEMATFIPVTSSFTV-----FASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEF 212
           LGEM  F+P   S +         ++V    G A  + Y++ + I  A E+S    VIE+
Sbjct: 152 LGEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASGVIEY 211

Query: 213 WTF--KVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGA 270
           W +   VP  AWI+IF  LIVI+NF PV VYGE EFW ASIK++ I G II    +  G 
Sbjct: 212 WAWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFWGG 271

Query: 271 G--ITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-QGTELVGITAGE 327
           G    G +GFRYW++PG +   I         FL   + +I   F+   G ELV +T+ E
Sbjct: 272 GPKSDGILGFRYWKNPGSFAHHITGGGG--GNFLDIYTGIIKGGFSVILGPELVCLTSSE 329

Query: 328 AANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDP----KLSSTDSYVSASPFIIA 383
            A+ R+++ +A K+   R               V YNDP     L+ + +   +SPF+I 
Sbjct: 330 CADQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFVIG 389

Query: 384 IQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFI 442
           IQN+G + +PHI N  ILT+  SA N+ ++  SR L  ++    APK F +    GVP+ 
Sbjct: 390 IQNAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLGVPYT 449

Query: 443 AVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSR 502
           AV  +     LAY+  S+   + FNW  NI+ ++GF  W+   +++IRF + + +  ++ 
Sbjct: 450 AVGASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKAITYNKLTH 509

Query: 503 DDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPK-FDSTAFLTAYISCFLFLFIYIVA 561
             +P++A       +Y  F+V+LI L  G+  F P+ ++   F+ AYI+  +F+ ++I  
Sbjct: 510 -RIPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWIGH 568

Query: 562 QCYFRTRL 569
           + + RT L
Sbjct: 569 KVFTRTLL 576

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  263 bits (672), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 165/481 (34%), Positives = 252/481 (52%), Gaps = 16/481 (3%)

Query: 96  VVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVT 155
           V  +  +K  LK RH                     ++  GP   LI +   GT+++S+ 
Sbjct: 80  VTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMV 139

Query: 156 QSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFW-T 214
            +LGE+A   P++  FT +A+RF+ + FG A  + Y   W +   LE+      + FW T
Sbjct: 140 MALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGT 199

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG 274
                  ++++FW++IVI+N F VK YGE EF  + IKVI ++GFII  + + CG G  G
Sbjct: 200 DPKYRDGFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEG 259

Query: 275 PVGF-RYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
                +YW  PG +     + D   A+F G  S  + +AF++ G+ELVG+ A E+ +PRK
Sbjct: 260 GYIGGKYWHDPGAF-----AGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRK 314

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASPFIIAIQNSGTK 390
           SVP+A K+V  R               VPYNDP L   SS D+  +ASPF+IAI+  G K
Sbjct: 315 SVPKAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDA--AASPFVIAIKTHGIK 372

Query: 391 VLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAA 449
            LP + N VIL  ++S  NS +Y  SR +  L+  +  P+ F    R G P + +  T+A
Sbjct: 373 GLPTVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSA 432

Query: 450 FGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKA 509
           FG +A++  S    + FNWLL ++G++  F W  I I HIRF + L  +G   D+L +K+
Sbjct: 433 FGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKS 492

Query: 510 ALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTA---FLTAYISCFLFLFIYIVAQCYFR 566
                 +Y+G F V ++ + Q + A  P   S +   F  AY+S  L + +Y+  + Y R
Sbjct: 493 PTGVWGSYWGLFMVVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMYLGHKIYKR 552

Query: 567 T 567
            
Sbjct: 553 N 553

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  264 bits (675), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 150/471 (31%), Positives = 246/471 (52%), Gaps = 14/471 (2%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
            +  +K+ +KPRH                     + NAGP G +I Y  MG+ ++ + Q+
Sbjct: 139 NQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQA 198

Query: 158 LGEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
            GE+A  +  +   F  + S  V    G +  ++Y   W     LEL      I++WT K
Sbjct: 199 CGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTVK 258

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGP 275
           V    ++ IF+VLI+++N F  K Y E +F+    K++ IIGF I  + + CG AG  G 
Sbjct: 259 VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGY 318

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +G RYW +PG +       +    RF G V++ + AAF +  +E + +TA E +NPRK++
Sbjct: 319 IGSRYWHNPGAF-----RGNTGIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 373

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPY-NDPKLSSTDSYVSASPFIIAIQNSGTKVLPH 394
           P A KK+  R               VPY +D  L ++ S   ASP++IA+ + G +V+PH
Sbjct: 374 PSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATKASPYVIAVASHGVRVVPH 433

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGAL 453
             NAVIL +++S AN   Y  SRIL  L+    APK F    R G P +A+L ++ FG +
Sbjct: 434 FINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSSIFGII 493

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           A+  +S   ++ F WLL I+G++  F W++I +SHIRF + +K +G S  ++ YK+ +  
Sbjct: 494 AFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGI 553

Query: 514 GLAYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISCFLFLFIYI 559
             + Y    + L ++ Q + A +P     K  + +F   Y++  + + +Y+
Sbjct: 554 WGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALYV 604

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  263 bits (672), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 163/492 (33%), Positives = 255/492 (51%), Gaps = 19/492 (3%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           +ED    G   + ++K+ +K RH                     ++N GP G +I Y  M
Sbjct: 82  KEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIM 141

Query: 148 GTLVFSVTQSLGEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVV 206
           G+ ++ + Q+ GE+A  +  ++  F  + S  +    G +  ++Y   W     LEL   
Sbjct: 142 GSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTA 201

Query: 207 GQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM 266
              I++WT  V    +++IF+VL + +N F  + Y E EF+  + KV+ I GF I  + +
Sbjct: 202 SITIKYWTTSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIV 261

Query: 267 VCG-AGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITA 325
            CG AG  G +G +YW  PG +     S DK    F G VS+L+ AAF +  TE + +TA
Sbjct: 262 NCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTA 316

Query: 326 GEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAI 384
            E ANPRKS+P A KKV  R               VP+N  +L  S  S   ASP++IAI
Sbjct: 317 AEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASPYVIAI 376

Query: 385 QNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIA 443
            + G KV+PH  NAVIL +++S  NS  Y  SR+L  L+    AP F +   R G P +A
Sbjct: 377 ASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLA 436

Query: 444 VLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRD 503
           ++ +A FG ++++  S   +  F WLL I+G++  F W +I +SHIRF + +K +G S  
Sbjct: 437 MIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLG 496

Query: 504 DLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYI 559
           +L +K+ +    +YY    + LI++ Q +TA AP    K D+ AF   Y++      + I
Sbjct: 497 ELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLA------MPI 550

Query: 560 VAQCYFRTRLWR 571
           +   YF  ++W+
Sbjct: 551 LIALYFGYKVWK 562

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  263 bits (673), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 152/471 (32%), Positives = 244/471 (51%), Gaps = 14/471 (2%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           ++  +K+ +KPRH                     + NAGP G +I Y  MG+ V+ + Q+
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 158 LGEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
            GE+A  +  +   F  +    V    G +  +++   W     LEL      I++WT  
Sbjct: 201 CGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTS 260

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGP 275
           V    ++ IF+VLIV++N F  K Y E +F+    K++ I+GF I  + + CG AG  G 
Sbjct: 261 VNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGY 320

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +G +YWR PG +       D    RF G V++ + AAF +  +E + +TA E +NPRK++
Sbjct: 321 IGSKYWRDPGAF-----RGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPY-NDPKLSSTDSYVSASPFIIAIQNSGTKVLPH 394
           P A KK+  R               VPY +D  L +  S   ASP++IA+ + G +V+PH
Sbjct: 376 PSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPH 435

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGAL 453
             NAVIL +++S AN   Y  SRIL  L+    APK F    R G P  A+L +A FG +
Sbjct: 436 FINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVI 495

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           A+  +S   ++ F WLL I+G++  F W++I +SHIRF + +K +G S  ++ YK+ +  
Sbjct: 496 AFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGV 555

Query: 514 GLAYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISCFLFLFIYI 559
             + Y    + L ++ Q + A AP     K  + +F   Y++  +++ +YI
Sbjct: 556 WGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYI 606

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  261 bits (668), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 165/546 (30%), Positives = 261/546 (47%), Gaps = 23/546 (4%)

Query: 35  RNEWARDR-----RFLHRHRGSEGEVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEE 89
           R + A DR      F      S   V  + S  D  L   +K + R            E+
Sbjct: 23  RTDSANDRSSSPDNFELSSVNSPVRVNVSSSGNDDILKGDTKEYPRDVKATPEAASYVED 82

Query: 90  DIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGT 149
                  +    + ++L  RH                     +   GP   +I ++ + T
Sbjct: 83  -------INNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVST 135

Query: 150 LVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQV 209
            +F+V  SLGE+A   PV   F V+ +RF+   F  A    Y   W +   LEL      
Sbjct: 136 CLFTVINSLGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASIT 195

Query: 210 IEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC- 268
           I +W  K+   AW++IF+  I + N   VK +GE EF ++ +K++AIIGF I  + + C 
Sbjct: 196 IRYWNDKINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCG 255

Query: 269 GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEA 328
           G    G +G +YW +PG +           ++F G  S  + AAF+Y G E+  ++A E+
Sbjct: 256 GGPHGGYIGGKYWHNPGAF-----VGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAES 310

Query: 329 ANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYV--SASPFIIAIQN 386
            NP++++P+A K+                   VPYNDP+L +  S V  +ASP +IAI+N
Sbjct: 311 RNPKETIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIEN 370

Query: 387 SGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVL 445
            G K LP + NA+IL  I+S ANS VY  SR +  ++     PKF  K  + G P  A+L
Sbjct: 371 GGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAIL 430

Query: 446 FTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDL 505
            T  FG L+++  S   +  F WL  ++G++  F W++I++S IRF   +K +G S D++
Sbjct: 431 LTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEM 490

Query: 506 PYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYF 565
           P+ +      A+YG   + L+++   +T+  P   STA   ++   +L L I I   CY 
Sbjct: 491 PFLSQSGTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILI--ACYV 548

Query: 566 RTRLWR 571
             +LW+
Sbjct: 549 GHKLWK 554

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  259 bits (663), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 181/563 (32%), Positives = 274/563 (48%), Gaps = 27/563 (4%)

Query: 21  QEASSWDKKLKDKVR-NEWARDRRFLHRH------RGSEGEVEYAKSDEDATLTKASKRH 73
              SS++K   + ++ N    D  FL +        GS    E A S       K S + 
Sbjct: 2   SNTSSYEKNNPENLKYNGITIDSEFLTQEPITIPSNGSAASAEEAGSGSKWQDFKDSFKR 61

Query: 74  VRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQ 133
           V             +  I    V  +  +K  LK RH                     ++
Sbjct: 62  VEPIAVDPNLTEAEKVAI----VTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALR 117

Query: 134 NAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWF 193
             GP   LI +   GT+++++  +LGE+A   P++  FT +A+RF+ + FG A  + Y  
Sbjct: 118 TGGPASLLIGWGSTGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYML 177

Query: 194 SWAITFALELSVVGQVIEFW-TFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIK 252
            W +   LE+      + FW T       ++++FWV+IVI+N F VK YGE EF  + IK
Sbjct: 178 QWLVVLPLEIVSASITVNFWGTDPKYRDGFVALFWVVIVIINMFGVKGYGEAEFVFSFIK 237

Query: 253 VIAIIGFIIYCLCMVCGAGITGPVGF-RYWRHPGPWGPGIISKDKNEARFLGWVSSLINA 311
           VI ++GFII  + + CG G  G     +YW  PG +     + D   A+F G  S  + +
Sbjct: 238 VITVVGFIILGIILNCGGGPEGGYIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTS 292

Query: 312 AFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL--- 368
           AF++ G+ELVG+ A E+  PRKSVP+A K+V  R               VPYND  L   
Sbjct: 293 AFSFAGSELVGLAASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGA 352

Query: 369 SSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLA 428
           SS D+  +ASPF+IAI+  G K LP + N VIL  ++S  NS +Y  SR +  L+  +  
Sbjct: 353 SSVDA--AASPFVIAIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFL 410

Query: 429 PKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISIS 487
           P+ F    R G P + +  T+AFG +A++  S    + FNWLL ++G++  F W  I I 
Sbjct: 411 PQIFAYVDRKGRPLVGIGVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICIC 470

Query: 488 HIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTA---F 544
           HIRF + L  +G   D+L +K+      +Y+G F V ++ + Q + A  P   S +   F
Sbjct: 471 HIRFRKALTAQGRDLDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGGSPSAEGF 530

Query: 545 LTAYISCFLFLFIYIVAQCYFRT 567
             AY+S  L + +YI  + Y R 
Sbjct: 531 FEAYLSFPLVMAMYIGHKIYKRN 553

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  261 bits (666), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 166/481 (34%), Positives = 250/481 (51%), Gaps = 16/481 (3%)

Query: 96  VVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVT 155
           +  +  +K  LK RH                     ++  GP   LI +   GT+++++ 
Sbjct: 80  ITAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMV 139

Query: 156 QSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFW-T 214
            +LGE+A   P++  FT +A+RF+ + FG A  + Y   W +   LE+      + FW T
Sbjct: 140 MALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGT 199

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG 274
                  ++++FW+ IVI+N F VK YGE EF  + IKVI ++GFII  + + CG G TG
Sbjct: 200 DPKYRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTG 259

Query: 275 PVGF-RYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
                +YW  PG +     + D   A+F G  S  + AAF++ G+ELVG+ A E+  PRK
Sbjct: 260 GYIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRK 314

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASPFIIAIQNSGTK 390
           SVP+A K+V  R               VPYND  L   SS D+  +ASPF+IAI+  G K
Sbjct: 315 SVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDA--AASPFVIAIKTHGIK 372

Query: 391 VLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAA 449
            LP + N VIL  ++S  NS +Y  SR +  L+  +  P+ F    R G P + +  T+A
Sbjct: 373 GLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSA 432

Query: 450 FGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKA 509
           FG +A++  S      FNWLL ++G++  F W  I I HIRF + L  +G   D+L +K+
Sbjct: 433 FGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKS 492

Query: 510 ALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTA---FLTAYISCFLFLFIYIVAQCYFR 566
                 +Y+G F V ++ + Q + A  P  DS +   F  AY+S  L + +YI  + Y R
Sbjct: 493 PTGVWGSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKIYKR 552

Query: 567 T 567
            
Sbjct: 553 N 553

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  259 bits (662), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 163/528 (30%), Positives = 257/528 (48%), Gaps = 22/528 (4%)

Query: 49  RGSEGEVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKP 108
           R S   +E  K+D    + K    H R            EE    +   E   + + L+ 
Sbjct: 4   RASSASIE--KADNGGYMHKVKTPHSRTSL---------EELETQSAGSEYNTLHKGLQS 52

Query: 109 RHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVT 168
           RH                     + N G    L+++I + T+V+ +  SL EM  ++P  
Sbjct: 53  RHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEMICYLPQQ 112

Query: 169 SSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWV 228
            S     SR+V    G A G+ Y +++AI  A ELS    V+ +W   VP+AAWI+IF V
Sbjct: 113 GSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYWDNPVPMAAWITIFLV 172

Query: 229 LIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP-VGFRYWRHPGPW 287
           ++V +NF  VK YGE EFW ASIK+I I+G ++  + +  G        GFRYW++PGP+
Sbjct: 173 VVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPF 232

Query: 288 GPGIISKDKNEARFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKSVPRAIKKVSVRX 346
              +     +  RFL    ++I +AF +    EL+GI   EA + R++  +A ++   R 
Sbjct: 233 AMSL--APGSTGRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRI 290

Query: 347 XXXXXXXXXXXXXXVPYNDPK----LSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILT 402
                         +   DPK    L +     ++SPF+  I N+G  VL H+ N  IL+
Sbjct: 291 IFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPVLDHVINVAILS 350

Query: 403 TIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAG 461
           +  SA NS +Y  +R++  L+    APKF  K  R GVP+ AV+       LAY+     
Sbjct: 351 SAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTT 410

Query: 462 GQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAF 521
             N F WL NI  ++GF  W ++ I+ IRF + +    + +  +PY+  L P +AYY  F
Sbjct: 411 SANVFQWLSNICTISGFIGWFAMGIAFIRFRRGIVFNNL-QSRIPYQGPLQPYIAYYFTF 469

Query: 522 FVTLIILIQGFTAFAP-KFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568
              ++ L  GF  F   +++   F+ AY++  ++L +Y+  + +FRTR
Sbjct: 470 MTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTR 517

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  261 bits (666), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 152/454 (33%), Positives = 236/454 (51%), Gaps = 11/454 (2%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           E+ I++  +  ++++K+ +K RH                     +   GP   +I Y+ +
Sbjct: 79  EDGIES--ITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLV 136

Query: 148 GTLVFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVV 206
             + + + Q+ GEMA   P + ++F  ++S F+S PFG A  ++Y F W     LEL   
Sbjct: 137 SFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELITA 196

Query: 207 GQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM 266
              I++W  K+    +I IF++ ++ ++ F VK YGE EF     K++ I GFII  + +
Sbjct: 197 SMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVVI 256

Query: 267 VC-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITA 325
            C GAG  G +G  YW +PG +     + D + ARF      L+   F++ G EL  ++ 
Sbjct: 257 NCGGAGDDGYIGGAYWHNPGAF-----AGDTSIARFKNVCYILVTGYFSFGGMELFALSV 311

Query: 326 GEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAI 384
            E +NPRKS P A K+   R               VPYND +L  +  S   ASP+++A 
Sbjct: 312 QEQSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAA 371

Query: 385 QNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIA 443
              G K++PHI NAVIL +++S ANS++Y G R++  LS    APKF     R G P  A
Sbjct: 372 SIHGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRA 431

Query: 444 VLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRD 503
           ++    FG +A++  S+  +  F WL  I G++  F W SI +SH+RF Q +K +G S D
Sbjct: 432 LIVCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLD 491

Query: 504 DLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP 537
           +L YKA      + YG FF  L+ + Q + A AP
Sbjct: 492 ELGYKATTGIWGSVYGFFFNILVFIAQFWVALAP 525

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  262 bits (670), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 180/602 (29%), Positives = 279/602 (46%), Gaps = 42/602 (6%)

Query: 5   DNASIELHSYHESLETQEASSWDKKLKDK-VRNEWARDRRFLHRHRGSEGEVE---YAKS 60
           D+ SI+ ++  +S +      +   +K+K +RN     +R  H    S   V+    A S
Sbjct: 31  DDGSIDTNNGSDSSQNSSQKDFISNIKNKRIRNFLEGFKRAEHHDESSLANVDRITIAPS 90

Query: 61  DEDATLTKASKRHVRXXXXXXXXXXXXE-------EDIDATGVVE--------------- 98
            ++ T    + ++ R            +       +D++    VE               
Sbjct: 91  KDEPTEYPGNNQYQRSSPFSNGLEDDQKVGPDIYIDDLENKQQVELIGTTIQDEELLPGQ 150

Query: 99  -----EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFS 153
                 A++++ +KPRH                    P+  AGP   +I Y  MGT ++ 
Sbjct: 151 KKEDSNAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYC 210

Query: 154 VTQSLGEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEF 212
           + Q+ GEMA  +  +T SF  F S  V   F  A  ++Y   W     LEL      I++
Sbjct: 211 IIQACGEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQY 270

Query: 213 WTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AG 271
           WT KV    ++ IF+VLI+++NFF  K Y E EF   + KV+ I GF I  +C+  G AG
Sbjct: 271 WTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAG 330

Query: 272 ITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 331
             G +G +YW  PG +      + K E RF G + + + AAF +  TE + +TA E +NP
Sbjct: 331 TDGYIGAKYWNDPGAFR----GQTKIE-RFKGVMDTFVTAAFAFGATEFIALTAAEQSNP 385

Query: 332 RKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYN-DPKLSSTDSYVSASPFIIAIQNSGTK 390
           RK++P A KK+  R               VPY+ D  L S  S   ASP+++AI   G +
Sbjct: 386 RKAIPSAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKASPYVLAISLHGVR 445

Query: 391 VLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAA 449
           V  H  NAVIL ++IS  NS  Y  SR+L  L+    APK F    R G P IA+  +A 
Sbjct: 446 VAQHFVNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCSAV 505

Query: 450 FGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKA 509
              +A+  TS      F WL+ I G++  F W +I +SH+RF + +K +G S  ++ Y +
Sbjct: 506 IAVIAFCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGYLS 565

Query: 510 ALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRL 569
                 + Y A  + L ++ Q + A  P    T    ++ S +L + I IV   YF  ++
Sbjct: 566 QTGILGSLYAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVF--YFGYKI 623

Query: 570 WR 571
           W+
Sbjct: 624 WK 625

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  259 bits (663), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 155/523 (29%), Positives = 254/523 (48%), Gaps = 13/523 (2%)

Query: 54  EVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXX 113
           +  +A  ++D+TL+  +    +               I     +    + + L  RH   
Sbjct: 27  DANFALEEKDSTLSPLASLDSKVPHEKIQTTTDFASVISHEDDINNVNLNKNLSIRHLLT 86

Query: 114 XXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTV 173
                             + + GP   +I +I + T +F+V  +LGEMA   PV   F V
Sbjct: 87  LAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINALGEMAAAFPVVGGFNV 146

Query: 174 FASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIM 233
           + +RF+    G A    Y   W +   LEL      I++W   +   AW++IF+ +I + 
Sbjct: 147 YITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNETINSDAWVAIFYCVIALA 206

Query: 234 NFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITGPVGFRYWRHPGPWGPGII 292
           N   VK +GE EF ++ IK++AIIGF I  + + C G    G +G +YW HPG +     
Sbjct: 207 NMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGFIGGKYWNHPGSF----- 261

Query: 293 SKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXX 352
               +  +F G  S  + AAF+Y G E+  ++A E+ +PR ++P+A K+           
Sbjct: 262 VGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKAAKRTFWLITASYVT 321

Query: 353 XXXXXXXXVPYNDPKLSSTDSYVSA--SPFIIAIQNSGTKVLPHIFNAVILTTIISAANS 410
                   VPY+DP+L S  S V A  SP +IAI+N G K LP + NA+IL +IIS ANS
Sbjct: 322 ILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLPSLMNAIILISIISVANS 381

Query: 411 NVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFIAVLFTAAFGALAYMETSAGGQNAFNWL 469
            VY  SR +  ++     P+   +    G P  A++FT  FG L+++  S    + F WL
Sbjct: 382 AVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWL 441

Query: 470 LNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILI 529
             ++G++  F W++I++SHIRF Q++  +  S D+LP+ +      ++YG   + L+++ 
Sbjct: 442 SALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVWGSWYGTIVLFLVLVA 501

Query: 530 QGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568
             +T+  P      D+ +F   Y+S  + L  Y   + Y R R
Sbjct: 502 SFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKR 544

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  259 bits (663), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 158/489 (32%), Positives = 245/489 (50%), Gaps = 16/489 (3%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
             D++ T    + Q K+ +K RH                     +  AGP   +IAY  +
Sbjct: 80  HNDLEKTTTAHQEQ-KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLV 138

Query: 148 GTLVFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVV 206
             + + + Q+ GEMA   P +  SF  + S F+S PFG A  +++   W     LEL   
Sbjct: 139 SFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITA 198

Query: 207 GQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM 266
              I++W   +    ++ IF+V ++ ++FF V+ YGE EF   + K++ I GFII+ + +
Sbjct: 199 AMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVV 258

Query: 267 VC-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITA 325
            C GAG  G +G +YW  PG +     +     +RF G   +L+NA F+Y G EL  ++ 
Sbjct: 259 NCGGAGKDGYIGGKYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFVLSV 313

Query: 326 GEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL--SSTDSYVSASPFIIA 383
            +  NPRKS P A K    R               VP+N  +L  +S  + + ASP+++A
Sbjct: 314 NDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLA 373

Query: 384 IQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFI 442
               G KV+PHI NAVIL  +IS ANS++Y G R+L  L+    AP+F     R G P  
Sbjct: 374 ASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLT 433

Query: 443 AVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSR 502
           A+L +A  G + +  TS   +  F WL  I+G++  F W SI  SHIRF + +K +  S 
Sbjct: 434 ALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSL 493

Query: 503 DDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISCFLFLFI 557
           D L YKA      +Y+G  F  L+   Q + A +P     K D+ +F  +Y++  ++L  
Sbjct: 494 DTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVF 553

Query: 558 YIVAQCYFR 566
           Y    C+++
Sbjct: 554 YFGYMCWYK 562

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  259 bits (662), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 173/495 (34%), Positives = 258/495 (52%), Gaps = 21/495 (4%)

Query: 90  DIDATGV-VEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMG 148
           DI+   +    + ++ +LK RH                     ++ AGP G LI +   G
Sbjct: 75  DIEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITG 134

Query: 149 TLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQ 208
           T++F++  +LGE+A   PV+  F  +A+RF+ + FG A  + Y F W +   LE+     
Sbjct: 135 TMIFTMVMALGELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASI 194

Query: 209 VIEFWTFKVPLA-AWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
            +++W   V     ++++FW+++VI+N F V+ YGE EF  + IKVIA+IGFII  + +V
Sbjct: 195 TVDYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILV 254

Query: 268 CGAGITGPVGF-RYWRHPGPWG---PGIISKDKNEARFLGWVSSLINAAFTYQGTELVGI 323
           CG G  G     RYW  PG +    PG         RF G+ S  + AAF++ G+ELVGI
Sbjct: 255 CGGGPVGGYVGGRYWHDPGAFAGHSPG--------RRFKGFCSVFVTAAFSFAGSELVGI 306

Query: 324 TAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFII 382
            + E+ NPRKSVP+A K+V  R               VPY DP+L  S+    SASPF+I
Sbjct: 307 ASAESKNPRKSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVI 366

Query: 383 AIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPF 441
           AI   G   LP + N VIL +++S  NS++Y  SR L  LS     PK      R G P 
Sbjct: 367 AIVTHGISGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPL 426

Query: 442 IAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMS 501
           + +   + FG +A++  S   +  FNWLL I+G++ F  W SI   HIRF   LK  G S
Sbjct: 427 VGIAICSGFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRS 486

Query: 502 RDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDST---AFLTAYISCFLFLFIY 558
            D+LP+K+ +    +Y+G     L+++ Q + A  P   S     F +AY++  + L  Y
Sbjct: 487 DDELPFKSPVGIIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFY 546

Query: 559 IVAQCYFRTRLWRTL 573
           I  + + R   W+ L
Sbjct: 547 IAHKLWKRN--WKLL 559

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  260 bits (664), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 154/483 (31%), Positives = 248/483 (51%), Gaps = 16/483 (3%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           +  ++K  +KPRH                     + N+GP G +I Y  MG+ ++ + Q+
Sbjct: 119 KSEELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQA 178

Query: 158 LGEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
            GEMA  +  +   F  + S  +    G +  ++Y   W     LEL      I++WT K
Sbjct: 179 TGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTK 238

Query: 217 VPLAAWISIFWVLIVIMNFFPVKV-YGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITG 274
           V    ++ IF+VLI+++N       Y E EF+  S K++ ++GF I  + ++CG AG  G
Sbjct: 239 VDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDG 298

Query: 275 PVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 334
            +G RYW  PG +       +    RF G VS+L+NAAF +  +E++G+TA E +NPRK+
Sbjct: 299 YIGGRYWHDPGAF-----RGEHAIDRFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKA 353

Query: 335 VPRAIKKVSVRXXXXXXXXXXXXXXXVPYN-DPKLSSTDSYVSASPFIIAIQNSGTKVLP 393
           +P A KK+  R               VP+N D  L S+   V ASP+++A+   G +V+P
Sbjct: 354 IPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGVRVVP 413

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGA 452
           H  NAVIL +++S ANS  Y  SR+L GL+    APK F+   R G P + +   A    
Sbjct: 414 HFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNV 473

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           +++  TS      F WLL I+G++  F W +I +SHIRF + +  +G S  ++ +K+   
Sbjct: 474 ISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCG 533

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568
              ++Y    + LI++ Q + A AP    + D  AF   Y++  + + +Y   + Y  T+
Sbjct: 534 VWGSWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIY--TK 591

Query: 569 LWR 571
            WR
Sbjct: 592 DWR 594

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  258 bits (659), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 163/519 (31%), Positives = 251/519 (48%), Gaps = 21/519 (4%)

Query: 62  EDATLTKASKRHVRXXXXXXXXXXXXEEDIDATG---VVEEAQVKRELKPRHXXXXXXXX 118
           +D  ++K++  H              EE+    G   +V +  +K+ +K RH        
Sbjct: 10  DDVEISKSNLVHRFVDSFRRAESPELEENDLEDGTRSIVTKTHLKKAMKSRHVVMMSIGT 69

Query: 119 XXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIP-VTSSFTVFASR 177
                        +  +GP   +I Y+ +  + + + Q+ GEMA   P +  SF  + S 
Sbjct: 70  GIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGSFNSYTST 129

Query: 178 FVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFP 237
           F+S PFG A  ++++  W   F LEL      +++W  K+    +I IF+  ++ ++FF 
Sbjct: 130 FISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWNDKINADVFIIIFYAFLLFIHFFG 189

Query: 238 VKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITGPVGFRYWRHPGPW--GPGIISK 294
           VK YGE EF   S KV+ + GFII  + + C GAG  G +G +YW  PG +  GP I   
Sbjct: 190 VKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYIGAKYWHDPGSFADGPPI--- 246

Query: 295 DKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXX 354
                RF G    L++A F+Y G EL  ++  E  NPRKS P A K+   R         
Sbjct: 247 ----TRFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTPAAAKQSIYRILIIYLATM 302

Query: 355 XXXXXXVPYNDPKLSSTDSYVS-ASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVY 413
                 VP+N  +L    S  + ASP+++A      KV+PH  NAVIL ++IS ANS +Y
Sbjct: 303 ILIGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKVVPHFINAVILISVISVANSALY 362

Query: 414 VGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNI 472
              R++  L+    APKF     R G P   ++  A FG + ++  S+  +  F WL  I
Sbjct: 363 AAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSASSKEEEVFTWLAAI 422

Query: 473 TGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGF 532
            G++  F W  I +SHIRF Q +K  G S D++ +KA      +YYG  F  L+ + Q +
Sbjct: 423 AGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTGIWGSYYGCAFNILVFIAQFW 482

Query: 533 TAFAP-----KFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
            A +P     K D+ AF  +Y++  ++L  Y     Y R
Sbjct: 483 VALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIYKR 521

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  257 bits (656), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 158/462 (34%), Positives = 244/462 (52%), Gaps = 7/462 (1%)

Query: 98  EEAQ-VKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQ 156
           E +Q ++R  K RH                     ++  GP   LIA+IF G+L+  V  
Sbjct: 41  ESSQTLQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLLIGVLM 100

Query: 157 SLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
           SL EMA+F P+  SF+ +A+R+V    G A G+ Y+  +AI  A ELS +G ++++W   
Sbjct: 101 SLAEMASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALASELSAIGLLVQYWRED 160

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP- 275
           + +A +I +F V+++ +NF  +K YGE EFW A +K + +I   +  L + CG G +   
Sbjct: 161 LSIAIFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGGPSKET 220

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +GFRYWR    + P ++       RFLGW + +I + + Y G+E +G+  GEA NP+K++
Sbjct: 221 IGFRYWREYA-FVPYLV--KGTTGRFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKKTI 277

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTD-SYVSASPFIIAIQNSGTKVLPH 394
           P A + V  R               +  +D  L++   S  S SPF+IA  N+G K LP 
Sbjct: 278 PAATRNVIFRITGFYIVGVLILGLIISPHDKTLANAKTSDASGSPFVIAFTNAGIKGLPS 337

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPK-FFQKTRNGVPFIAVLFTAAFGAL 453
             NA+++  I SAAN+ +YV SR  YGL+   +APK F  + R GVPF   L       L
Sbjct: 338 FINAMLIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLL 397

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           ++M  S      F +L +   V G   WLS+ IS+I + +      + RD +P++    P
Sbjct: 398 SFMNISNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFHDVPRDRIPFRMWFQP 457

Query: 514 GLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFL 555
             AY   FFV+LII   G++AF   F   +F+ +YI   +F+
Sbjct: 458 YSAYVCLFFVSLIIFFNGYSAFIAGFKYKSFIVSYIGIAVFI 499

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  256 bits (655), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 160/488 (32%), Positives = 240/488 (49%), Gaps = 15/488 (3%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
            +D D +       VKR LK RH                     +Q  GP+  L+ ++ +
Sbjct: 18  RDDRDVSEFDPNTGVKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLGFVII 77

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           G + F+V +S+GEM T  P    FT  A RF SD   A CGY Y   +    A E + + 
Sbjct: 78  GIIAFAVMESIGEMITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEYNTLS 137

Query: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
            +++FW  +VPL A+  IFW++  I     V V+GE E+W++ +K++ +I + I+ +  +
Sbjct: 138 SILQFWGPQVPLYAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFSIIYM 197

Query: 268 CGAGITGPV-GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAG 326
            G     P  GF YW+ PG    G          F G     +  +  Y GTE V +TA 
Sbjct: 198 SGGVRNKPAFGFHYWKDPGSLSHG----------FKGIAVVFVFCSSFYSGTESVALTAT 247

Query: 327 EAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQN 386
           E+ NP KSVP A+++   R               VP+NDP L S ++ V  SP  IAI  
Sbjct: 248 ESKNPTKSVPYAVRQTLWRIVVVYIGIAIFYGSTVPFNDPNL-SVNTKVLKSPIAIAISR 306

Query: 387 SGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVL 445
           +G     H+ NA IL + ISA N ++Y+GSR L  L+   LAPKF   T + GVP  A+ 
Sbjct: 307 AGWAGGSHLVNAFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPIPAIT 366

Query: 446 FTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDL 505
              A G ++ M  S G  NA+++++N++GV  F  W  IS +H+R  +    +G   ++L
Sbjct: 367 IFNALGLISLMNMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRLLEEL 426

Query: 506 PYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYF 565
           PYKA   P    +       + LIQG+T+  P F +  F+ AYI     + +Y V  C F
Sbjct: 427 PYKALFYPWTPIFSLISNIFLALIQGWTSLVP-FKAPEFVDAYILLPAAIILY-VGVCVF 484

Query: 566 RTRLWRTL 573
           +   +R +
Sbjct: 485 KNHNFRIV 492

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  258 bits (660), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 157/479 (32%), Positives = 249/479 (51%), Gaps = 18/479 (3%)

Query: 101 QVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160
           Q+++ ++PRH                     + NAGP G LI YI M + ++ + Q+ GE
Sbjct: 79  QLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138

Query: 161 MA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPL 219
           MA  ++ +   F  + S  V   +  A  ++Y   W     LEL      I++W  KV  
Sbjct: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKVDP 198

Query: 220 AAWISIFWVLIVIMNFFP-VKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGPVG 277
             +++IF++LI+ +N F   + Y E EF+    K++ I GF I  + ++CG AG +G +G
Sbjct: 199 DVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGYIG 258

Query: 278 FRYWRHPGPW---GPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 334
             YW +PG +    PG         RF G VS+L+ AAF++  TE + ITA E +NPRK+
Sbjct: 259 VSYWNNPGAFRGHTPG--------TRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKA 310

Query: 335 VPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAIQNSGTKVLP 393
           +P A KKV  R               VPYN P+L  S  S   ASP++IA+ + G ++ P
Sbjct: 311 IPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAP 370

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGA 452
           H  NAVIL +++S ANS+ Y  SR+L  L+    APK F    R G P   ++  +    
Sbjct: 371 HFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLAT 430

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           +A+  +S      F+WLL I+G++  F W +I +SHIRF + +K +G S ++L YK+ + 
Sbjct: 431 IAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVG 490

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571
              + Y A  + LI++ Q + A  P   + A +T +   +L + I ++   YF  + W+
Sbjct: 491 VWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLF--YFGYKTWK 547

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  258 bits (660), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 171/563 (30%), Positives = 270/563 (47%), Gaps = 48/563 (8%)

Query: 15  HESLETQEASSWDKKLKDKVRNEWARD---RRFLHRHRGSEGE-VEYAKSDEDATLTKAS 70
            ++  T  A+S+  ++K+   +E +R     RF+   R +E + +E     ED T +  S
Sbjct: 25  RDNFNTSTAASFSPEVKE--HSEESRSGLVHRFVDSFRRAESQRLEDDNDLEDGTRSMRS 82

Query: 71  KRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXX 130
             H+                            K+ +K RH                    
Sbjct: 83  NNHL----------------------------KKSMKSRHVVMMSLGTGIGTGLLVANAK 114

Query: 131 PIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAACGY 189
            ++ AGP   +I Y+ +  + + + Q+ GEM    P +  +F  + S FVS  FG A  +
Sbjct: 115 GLKLAGPGSLVIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTW 174

Query: 190 MYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVA 249
           ++   W     LEL      I++W   +    +I+IF+V ++ ++FF VK YGE EF   
Sbjct: 175 LFCIQWLTVLPLELITSSMTIKYWNDTINADVFIAIFYVFLLFIHFFGVKAYGETEFIFN 234

Query: 250 SIKVIAIIGFIIYCLCMVC-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSL 308
           S K++ I GFII  + + C GAG+ G +G  YWR+PG +  G      +  RF G    L
Sbjct: 235 SCKILMIAGFIILSVIINCGGAGVDGYIGGEYWRNPGSFADG-----SSATRFKGICFIL 289

Query: 309 INAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPY-NDPK 367
           + A F++ G EL  ++  E ANPRKS P A K+   R               VP+ ND  
Sbjct: 290 VTAYFSFGGIELFVLSINEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQL 349

Query: 368 LSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKL 427
           + S  S   ASP+++A    G KV+PHI NAVIL ++IS ANS +Y   R++  L+    
Sbjct: 350 MGSGSSATHASPYVLAASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGY 409

Query: 428 APKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISI 486
           APKF     R G P  A++  +  G + ++  S+  + AF WL  I G++  F W  I +
Sbjct: 410 APKFLNYIDREGRPLRALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIML 469

Query: 487 SHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP-----KFDS 541
           SHIRF + +K +G S D++ YK+      +YYG  F  L+ + Q + A +P     K D 
Sbjct: 470 SHIRFRKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALSPPGSDGKCDV 529

Query: 542 TAFLTAYISCFLFLFIYIVAQCY 564
            +F  +Y++  L++F+Y+    Y
Sbjct: 530 ESFFQSYLAAPLWIFMYLGYMIY 552

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  257 bits (657), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 155/478 (32%), Positives = 240/478 (50%), Gaps = 11/478 (2%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
           E  +K+ L  RH                     +   GP    +++I + T+V+ +  +L
Sbjct: 48  EHNLKKGLSNRHIQLIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTL 107

Query: 159 GEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVP 218
            EM  ++P   S     +R+V    G A G+ Y +S+A+  A EL+    ++ +WT +VP
Sbjct: 108 AEMVCYLPQQGSVPELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQVP 167

Query: 219 LAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP-VG 277
              WI+IF +++V++NF  V+ YGE EFW AS+K+I I+  ++  + +  G       VG
Sbjct: 168 QGVWITIFLIVVVVLNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVG 227

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKSVP 336
           FRYWR+PG +G  I     N  RFL   +++I +AF +    ELVG+   EA + R+++ 
Sbjct: 228 FRYWRNPGAFGYHI--TGGNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIE 285

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPYNDPK----LSSTDSYVSASPFIIAIQNSGTKVL 392
           +A ++   R               V  ND      L       ++SPF+  I NSG  VL
Sbjct: 286 KASRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVL 345

Query: 393 PHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFG 451
            H+ N  ILT+  SA NS  Y  SR +  LS    APK F K  R GVP+ AV   +   
Sbjct: 346 NHVINVAILTSAWSAGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVA 405

Query: 452 ALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAAL 511
            LAY+  S+     F WL NI  ++GF  W  I +++IRF + +    +  D +PY++ L
Sbjct: 406 CLAYLNVSSTSSKVFQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRL-LDRIPYRSPL 464

Query: 512 MPGLAYYGAFFVTLIILIQGFTAFAP-KFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568
            P  AY+    V +I L  G+  F   ++D   FLT+YIS  +FL  Y+  +  ++TR
Sbjct: 465 QPFSAYFFTIVVAIITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTR 522

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  258 bits (658), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 165/475 (34%), Positives = 247/475 (52%), Gaps = 13/475 (2%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           +  ++K+ ++PRH                     + N GP G  + +  MGT V+ V Q+
Sbjct: 85  KHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMGTCVYCVIQA 144

Query: 158 LGEMATFIPVTSS-FTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
            GEMA   P  S  F  + S  V   FG A  ++Y   W   F LEL      I++WT  
Sbjct: 145 AGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTASITIKYWTTA 204

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGP 275
           +    ++++F++LI+++NFF  + Y E EF+  + KV+ IIGF I  + +  G AG  G 
Sbjct: 205 INPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVNTGAAGNDGY 264

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +G +YWR PG +G G  + D     F G VS+L+NAAF+   +E V +TA E ANPRKSV
Sbjct: 265 IGAKYWREPGSFG-GHTAID----HFKGVVSTLVNAAFSLGCSEFVALTAAEQANPRKSV 319

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAIQNSGTKVLPH 394
           P A KK+  +               VP N  +L  STDS V  SP++IA+ + G +V+PH
Sbjct: 320 PSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPYVIAVASHGVRVVPH 379

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGAL 453
             NAVIL +++S  NS  Y  SR+L  L+    AP  F+   R G P +A++ +   G L
Sbjct: 380 FINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAMMVSITMGCL 439

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
            ++  S   +  F WLL I+G++  F W SI ISHIRF + L  +G   D L +KA    
Sbjct: 440 CFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDGLGFKAQTGV 499

Query: 514 GLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCY 564
             +YY A  + L  + Q +T   P    K ++ +F   Y++  +F+ +Y   + Y
Sbjct: 500 WGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVALYFGYKIY 554

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  257 bits (657), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 164/489 (33%), Positives = 249/489 (50%), Gaps = 20/489 (4%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           E  ++K+ LK RH                     +   GP G   +Y+ + T ++ +  +
Sbjct: 66  ENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIMNA 125

Query: 158 LGEMATFIPVTSSFTVFAS-----RFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEF 212
            GEM  ++P   S +  +S     ++V    G A  + Y++ + I  A E +    V+E+
Sbjct: 126 FGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGVVEY 185

Query: 213 WT--FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGA 270
           W    KVP  AWI+IF   +V +N  PV  YGE EFW ASIK++ I+G II    +  G 
Sbjct: 186 WAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSFILFWGG 245

Query: 271 GITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-QGTELVGITAGEA 328
           G +   +GFRYW+ PG +   I   D     FL   + +I   F +  G ELV +T+ E 
Sbjct: 246 GPSHDRLGFRYWQRPGAFADHI--TDGTGGNFLDVYTGVIKGGFAFVLGPELVSLTSSEC 303

Query: 329 ANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSS----TDSYVSASPFIIAI 384
            + R+++ +A ++   R               V YNDP L +    +     +SPF+I I
Sbjct: 304 HDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIGI 363

Query: 385 QNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIA 443
           QN+G KVLPHI N  I+T+  SA N+ ++  SR L  ++S   APKFF K  R GVP++A
Sbjct: 364 QNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPYVA 423

Query: 444 VLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRD 503
           V F+  F  LAY+  S+   N FNW  NI+ ++GF  W+   +++IRF + +    +  D
Sbjct: 424 VGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDL-YD 482

Query: 504 DLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKF-DSTAFLTAYISCFLFLFIYIVAQ 562
            LPYK      L +Y  F V+LI L  G+  F P+F D   F+ AYI+  +F+ ++I  +
Sbjct: 483 RLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWIGHK 542

Query: 563 CYFRTRLWR 571
               TR WR
Sbjct: 543 --LVTRSWR 549

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  257 bits (657), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 157/492 (31%), Positives = 245/492 (49%), Gaps = 18/492 (3%)

Query: 88  EEDID----ATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIA 143
           EED D       +     +K+ +K RH                     +  AGP   +I 
Sbjct: 68  EEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIG 127

Query: 144 YIFMGTLVFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALE 202
           Y+ +  + + + Q+ GEM    P +  +F  + S F+S  FG A  +++   W     LE
Sbjct: 128 YVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLE 187

Query: 203 LSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIY 262
           L      +++W   +    +I IF+V ++ ++FF VK YGE EF   S K++ + GFII 
Sbjct: 188 LITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIIL 247

Query: 263 CLCMVC-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELV 321
            + + C GAG+ G +G +YWR PG +  G         RF G    L++A F++ G EL 
Sbjct: 248 SVVINCGGAGVDGYIGGKYWRDPGSFAEG-----SGATRFKGICYILVSAYFSFGGIELF 302

Query: 322 GITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPF 380
            ++  E +NPRKS P A K+   R               VP+N+ +L  S  S   ASP+
Sbjct: 303 VLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPY 362

Query: 381 IIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGV 439
           ++A      +V+PHI NAVIL ++IS ANS +Y   R++  L+    APKF     R G 
Sbjct: 363 VLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGR 422

Query: 440 PFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRG 499
           P  A++  +  G + ++  S   + AF WL  I G++  F W  I +SHIRF + +K +G
Sbjct: 423 PLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQG 482

Query: 500 MSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISCFLF 554
            S D++ YKA      +YYG FF  L+ + Q + A +P     K D+ AF  +Y++  L+
Sbjct: 483 RSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLW 542

Query: 555 LFIYIVAQCYFR 566
           +F+Y+    Y R
Sbjct: 543 IFMYVGYMVYKR 554

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  258 bits (659), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 173/564 (30%), Positives = 273/564 (48%), Gaps = 27/564 (4%)

Query: 13  SYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKSDEDATLTKASKR 72
           +Y E+++   ++S      D       R RRF+   + +EG  +    D D     +   
Sbjct: 35  TYFENVKQGSSNSTYSLESDHHAASNTRFRRFIDSFKKAEGP-QPGSLDHDVLAGDSD-- 91

Query: 73  HVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPI 132
                          E+D DA       ++K+ +KPRH                     +
Sbjct: 92  ------IEGKPRTEPEKDDDAR------ELKKTIKPRHVVMISLGTGIGTGMLVGNGTSL 139

Query: 133 QNAGPVGSLIAYIFMGTLVFSVTQSLGEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMY 191
            N+GP G +I Y  MG+ ++ + Q+ GE+A  +  +T  F  + S  +   FG A  ++Y
Sbjct: 140 ANSGPAGLVIGYAIMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVY 199

Query: 192 WFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKV-YGEFEFWVAS 250
              W     LEL      I++WT KV    ++ IF+ LI+ +N       Y E EF+  S
Sbjct: 200 CIQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYCLILCINVLGGAAGYAEAEFFFNS 259

Query: 251 IKVIAIIGFIIYCLCMVCG-AGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLI 309
            K++ + GF I  + ++CG AG  G +G R W +PG +       DK   RF G VS+L+
Sbjct: 260 FKILMLTGFFILGIVVICGGAGNDGYIGTRLWHNPGSF-----RGDKPVDRFKGVVSTLV 314

Query: 310 NAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYN-DPKL 368
           NAAF +  +E +G+TA E +NPRK++P A KK+  R               VPY+ D  L
Sbjct: 315 NAAFAFGMSEFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLL 374

Query: 369 SSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLA 428
            S+ +   ASP+++AI   G +V+PH  NAVIL +++S  NS  Y  SR L  LS    A
Sbjct: 375 GSSGAATKASPYVLAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYA 434

Query: 429 PKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISIS 487
           P F     RNG P  A   +A  G +A+  TS      F WLL I+G++  F W SI +S
Sbjct: 435 PSFLNYVDRNGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLS 494

Query: 488 HIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTA 547
           H+RF + ++ +G S  ++ +K+ +    + Y    + LI++ Q +TA  P  +    + A
Sbjct: 495 HLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQA 554

Query: 548 YISCFLFLFIYIVAQCYFRTRLWR 571
           +   +L + I+IV   YF  ++W+
Sbjct: 555 FFENYLAMPIFIV--LYFGFKIWK 576

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  257 bits (657), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 156/481 (32%), Positives = 251/481 (52%), Gaps = 19/481 (3%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
           E ++K+ +  RH                     + N GP G +I Y  MG+ ++ + Q+ 
Sbjct: 87  ETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAA 146

Query: 159 GEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217
           GE+A ++  ++ +F  + S  +   FG +  ++Y   W     LEL      I++WT  V
Sbjct: 147 GELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTSV 206

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGPV 276
               +++IF+VLI+++N F  + Y E EF+    KV+ IIGF I  + + CG AG  G +
Sbjct: 207 NPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYI 266

Query: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336
           G RYW +PG +        K    F G +S+++ AAF +  TE + +TA E ANPR+++P
Sbjct: 267 GGRYWNNPGAF-----YGTKPIHHFKGIISTMVTAAFAFGATEFIALTAAEQANPRRAIP 321

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAIQNSGTKVLPHI 395
            A KKV  R               VP+N P+L  S  S   ASP++IA+ + G +V+PH 
Sbjct: 322 SAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIAVASHGVRVVPHF 381

Query: 396 FNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQ-KTRNGVPFIAVLFTAAFGALA 454
            NAVIL +++S  NS  Y  SR+L  L+    AP + +   R+G P  A+L +  FG ++
Sbjct: 382 INAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLIS 441

Query: 455 YMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPG 514
           ++  S   +  F WLL I+G++  F W+SI +SHIRF + L  +G    +L YK+     
Sbjct: 442 FVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQTGVA 501

Query: 515 LAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLW 570
            +YY  F +  I++ Q + A AP    K D+ +F   Y++  LF+ +      YF  ++W
Sbjct: 502 GSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVL------YFGFKIW 555

Query: 571 R 571
           +
Sbjct: 556 K 556

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  258 bits (659), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 171/578 (29%), Positives = 275/578 (47%), Gaps = 33/578 (5%)

Query: 1   MDNKDNASIELHSYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRH----RGSEGEVE 56
           + +KD ++   ++Y      ++ +  DKK K  ++       RF+       R +   ++
Sbjct: 41  LSDKDASTSADYTY------KDLNPSDKKKKSNIK-------RFIDSFKQPIRPNSDYID 87

Query: 57  YAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXX 116
            A+ D +  L       V                 DA    +   +K+ ++PRH      
Sbjct: 88  AAELDYEQALENGITTSVSPSAPNLRKLNQLRTPTDAN---DNKALKQTIRPRHVVMISL 144

Query: 117 XXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMA-TFIPVTSSFTVFA 175
                          ++NAGP G +I Y  MG++++ + Q+ GEMA  +  +   + V+ 
Sbjct: 145 GTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQATGEMAIAYSNLPGGYNVYP 204

Query: 176 SRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNF 235
           S  V   FG A  ++Y   W     LEL      I++WT  V    +++IF+ LI+I+N 
Sbjct: 205 SFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTTSVNSDIFVAIFYALIIIINV 264

Query: 236 FPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGPVGFRYWRHPGPWGPGIISK 294
           F  K Y E EF+    KV+ +IGF I  + +  G AG  G +G  YW  PG +       
Sbjct: 265 FGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGYLGGLYWHTPGAF-----RG 319

Query: 295 DKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXX 354
           D +   F G   +L+ AAF Y GTE + +TA E +NPR ++P A KKV  R         
Sbjct: 320 DSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPRAAIPSAAKKVLYRIICVYLISI 379

Query: 355 XXXXXXVPYNDPKLSSTD-SYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVY 413
                 VP++  +L  +D S  SASP+++A    G +V+PH  NAVIL +++S  NS  Y
Sbjct: 380 LMIGFLVPFDSTRLLGSDGSATSASPYVLAASLHGVRVVPHFINAVILISVLSVGNSAFY 439

Query: 414 VGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNI 472
             SR+L  L+    APK+F    R G P  A+L +A FG +A+   S      F WLL I
Sbjct: 440 SSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFGVIAFCAASPKETEVFTWLLAI 499

Query: 473 TGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGF 532
           +G++  F W +I +SHIRF   +K +G S  ++ Y A      ++Y  F + LI + Q +
Sbjct: 500 SGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQTGVWGSWYALFMMFLIYIAQFW 559

Query: 533 TAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
            A AP    +  +  F   Y++  + + +Y+  + Y++
Sbjct: 560 VAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYK 597

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  258 bits (659), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 148/469 (31%), Positives = 244/469 (52%), Gaps = 13/469 (2%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           ++  +++ +KPRH                     +  AGP G +I Y  MG+ ++ + Q+
Sbjct: 127 KDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCIIQA 186

Query: 158 LGEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
            GEMA  +  +  +F  + S  V + FG +  ++Y   W     LEL      I++WT  
Sbjct: 187 CGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTT 246

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM-VCGAGITGP 275
           V    ++ IF+VLI+ +N F  K Y E EF+  S KV+ + GF I  + +   GAG  G 
Sbjct: 247 VNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGY 306

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +G +YW +PG +       DK+  RF   +S+   AAF +  +E + I A E +NPR+++
Sbjct: 307 IGAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAI 361

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVS-ASPFIIAIQNSGTKVLPH 394
           P A K +  R               VPYN  +L  + S  + ASP++IA+ + G +V+PH
Sbjct: 362 PSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPH 421

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGAL 453
             NAVIL +++S ANS  Y   RILY LS    AP +F    R G P  A++ +A F  +
Sbjct: 422 FINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVI 481

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           A+   S+  ++ F WLL I+G++  F W++I +SHIRF + +K +G S D++ +K+ +  
Sbjct: 482 AFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGV 541

Query: 514 GLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIY 558
             + Y A  +TL ++ + + + AP      D+  F   Y++  + + +Y
Sbjct: 542 WGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLY 590

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  256 bits (654), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 157/526 (29%), Positives = 256/526 (48%), Gaps = 27/526 (5%)

Query: 68  KASKRHVRXXXXXXXXXXXXEEDIDATGVVEEA--QVKRELKPRHXXXXXXXXXXXXXXX 125
           K  K +++            E DI+ +G  E +   +K  L+ RH               
Sbjct: 21  KNDKNNIKDGVSFEKPIIYSEVDIE-SGAKESSSRNLKHGLQSRHIQLIALGGTIGTGLF 79

Query: 126 XXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSS-------FTVFASRF 178
                 + N GP   +I+YI + T+V+ +    GEM  ++P                S++
Sbjct: 80  VGTSSTLANCGPAALVISYIVISTIVYPIMNMFGEMVCYLPGNDDDDESVGYCAYLVSKY 139

Query: 179 VSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPV 238
           V +  G A  + Y++ + +  A E +    ++E+WT K+P A  I +F  +I ++NF PV
Sbjct: 140 VDESLGFATSWNYYYCFIVLVATECTAASSIVEYWTSKIPKAVLIFLFLGVIFLLNFLPV 199

Query: 239 KVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP----VGFRYWRHPGPWGPGIISK 294
           K YGE EFW A IK+  I G II    + CG          VGF YW++P  +   +   
Sbjct: 200 KFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPNNEDNSFVGFHYWKNPSSFRDYV--T 257

Query: 295 DKNEARFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXX 353
           + +   FL   ++LI  AF +  G ELV +T+ E  + R+++ +A ++   R        
Sbjct: 258 NGSLGNFLDVYNALIKGAFAFILGPELVSLTSSECVDQRRNIAKASRRFVYRLMFFYIFG 317

Query: 354 XXXXXXXVPYNDPKLSSTDSY----VSASPFIIAIQNSGTKVLPHIFNAVILTTIISAAN 409
                  VPYNDP L +  +       +SPF+I IQN+G  +LPHI N  ILT+ +SA N
Sbjct: 318 ALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGIQNAGITILPHIINFCILTSAMSAGN 377

Query: 410 SNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNW 468
           + ++  +R L  +     AP+ F +  R+GVP++A+  +     LA++  SA     F W
Sbjct: 378 AFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVALSLSIMIACLAFLNCSASSAKVFQW 437

Query: 469 LLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIIL 528
             NI+ ++GF  W +  I+++RF +T+ + G+  D LP+K      L +Y   FV ++IL
Sbjct: 438 FSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YDRLPFKTKGQVYLTWYSFVFVGILIL 496

Query: 529 IQGFTAFAPKF-DSTAFLTAYISCFLFLFIY---IVAQCYFRTRLW 570
             G+    PKF +   F+ AYI+  +FL +Y   I+    +R R W
Sbjct: 497 TNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFGHIIYSGRWRQRKW 542

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  257 bits (656), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 158/477 (33%), Positives = 246/477 (51%), Gaps = 27/477 (5%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           +   +K+ +K RH                     + + GP GS I ++ MG  V+ V Q+
Sbjct: 86  KHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQA 145

Query: 158 LGEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFW--T 214
            GE+A  +  +   F  + S  +    G A  ++Y   W   F LEL      I+FW  +
Sbjct: 146 AGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGS 205

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGA-GIT 273
             V    +++IF+VLI+++NFF  + Y E EF+  S KV+ +IGF I  + +  GA G +
Sbjct: 206 RSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTS 265

Query: 274 GPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
           G +G +YWR PG  G        +   F G V++L+NAAF+   +E V +TA E ANPRK
Sbjct: 266 GYIGGKYWRDPGSLG-----GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRK 320

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAIQNSGTKVL 392
           S+P A KK+  +               VP +  +L  S DS +  SP++IA++  G  V+
Sbjct: 321 SIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGVNVV 380

Query: 393 PHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFG 451
           P   NAVIL +++S  NS  Y  SR+L+ L+    APK F+   R G P +A++ +  FG
Sbjct: 381 PSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILFG 440

Query: 452 ALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKA-- 509
            + ++  S   +  F WLL I+G++  F W +I +SHIRF + L  +G S D+L +KA  
Sbjct: 441 TICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKAQT 500

Query: 510 --------ALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIY 558
                   A+M  LA  G F+V+L+ +       A + D+ +F T Y++  +FL  Y
Sbjct: 501 GIIGSYVSAIMMVLALIGQFWVSLVPM------GATEPDAESFFTGYLAMPMFLLFY 551

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  255 bits (651), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 162/514 (31%), Positives = 248/514 (48%), Gaps = 15/514 (2%)

Query: 62  EDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXX 121
           E   + + +K+ ++            +ED D +    +  VKR LK RH           
Sbjct: 9   ETVDIEETAKKDIKPYFASNVEAVDIDEDPDVSRYDPQTGVKRALKNRHISLLALGGVIG 68

Query: 122 XXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSD 181
                     +   GP+  L+ +  +G + FSV +S+GEM T  P    FT  A RF SD
Sbjct: 69  PGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVMESIGEMITLYPSGGGFTTLARRFHSD 128

Query: 182 PFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVY 241
              A CGY Y   +    A E + +  +++FW  +VPL  +I IFW    I     V ++
Sbjct: 129 ALPAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFWFAFEIFQLVGVGLF 188

Query: 242 GEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPV-GFRYWRHPGPWGPGIISKDKNEAR 300
           GE E+W+A +K++ ++ + I+ +  + G     P  GF YW  PG    G          
Sbjct: 189 GETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRPAFGFHYWNSPGALSHG---------- 238

Query: 301 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXX 360
           F G     +  +  Y GTE V + A E+ NP K+VP A+++   R               
Sbjct: 239 FKGIAIVFVFCSTFYSGTESVALAATESKNPGKAVPLAVRQTLWRILVVYIGIAVFYGAT 298

Query: 361 VPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILY 420
           VP++DP LS++ + V  SP  IAI  +G     H+ NA IL T ISA N ++Y+GSR L 
Sbjct: 299 VPFDDPNLSAS-TKVLKSPIAIAISRAGWAGGAHLVNAFILITCISAINGSLYIGSRTLT 357

Query: 421 GLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFF 479
            L+   LAPK    T R GVP  A+    A G ++ M  S G  NA+++++N++GV  F 
Sbjct: 358 HLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVSVGAANAYSYIVNLSGVGVFI 417

Query: 480 AWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKF 539
            W  IS +H+R  +    +G S ++LPY+A   P            + LIQG++ F P F
Sbjct: 418 VWGVISYTHLRIRKAWVAQGRSIEELPYEALFYPWTPVLSLAANIFLALIQGWSYFVP-F 476

Query: 540 DSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTL 573
           D+  F+ AYI   + + +YI   C F++  +RT+
Sbjct: 477 DAGNFVDAYILLPVGILLYI-GICVFKSNHFRTV 509

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  256 bits (655), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 158/489 (32%), Positives = 252/489 (51%), Gaps = 18/489 (3%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           +ED+D        Q+ ++L  RH                     + + GP   +I ++ +
Sbjct: 87  KEDVDG-----HPQMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVII 141

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
            T +F+V  SLGE+A   PV   F V+ +RF+   FG A    Y   W +   LEL    
Sbjct: 142 STCLFTVVNSLGELAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAAS 201

Query: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
             I +W  K+   AW++IF+  I   N   VK +GE EF ++ IK++AI+GF I  + + 
Sbjct: 202 ITIRYWNDKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLS 261

Query: 268 C-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAG 326
           C G    G +G +YW  PG +       + +  +F G  S  + AAF+Y G EL  ++A 
Sbjct: 262 CGGGPKGGYIGGKYWHDPGAF-----VGETSGTKFKGLCSVFVTAAFSYSGMELTAVSAA 316

Query: 327 EAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSA--SPFIIAI 384
           E+ NPR+++P+A K+                   VPYN+PKL +  S V A  SP +IAI
Sbjct: 317 ESLNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLVIAI 376

Query: 385 QNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIA 443
           +N G + LP + NA+IL  I+S ANS VY  SR +  ++  +  P+F  +  R G P  A
Sbjct: 377 ENGGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNA 436

Query: 444 VLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRD 503
            L T  FG L+++  S   +  F WL  ++G++  FAW++I++SHIRF Q + H+G+S D
Sbjct: 437 TLLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLD 496

Query: 504 DLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYI 559
           +LPY +      ++YG   + L+++   +T+  P      D+T+F   Y+S  + +  Y+
Sbjct: 497 ELPYISMTGVSGSWYGVIVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYV 556

Query: 560 VAQCYFRTR 568
             + Y R +
Sbjct: 557 GHKLYIRKK 565

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  256 bits (654), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 168/483 (34%), Positives = 245/483 (50%), Gaps = 16/483 (3%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
            A +K  LK RH                     ++ AGP G LI +   GT+++ +  ++
Sbjct: 78  HAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYCMVMAM 137

Query: 159 GEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFW-TFKV 217
           GE++   P++  FT +A+RF+ + FG A  + Y   W     LE+      + +W T   
Sbjct: 138 GELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAASITVNYWGTDPK 197

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVG 277
               ++++FWV+IVI+N F VK YGE EF  + IKV+ +IGFII  + + CG G  G   
Sbjct: 198 YRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYI 257

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
              + H     PG    D   ARF G  S  + AAF++ G+EL+GI A E+A PRKSVP+
Sbjct: 258 GGKYFHD----PGAFVGDTAGARFQGVCSVFVTAAFSFAGSELIGIAAAESAEPRKSVPK 313

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASPFIIAIQNSGTKVLPH 394
           A K+V  R               VPY D +L   SS D+  +ASPF+IAI + G + LP 
Sbjct: 314 AAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDA--AASPFVIAITSHGIRGLPS 371

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGAL 453
           + N VIL  ++S  NS VY  SR L  L+     PK F    R+G P   + FT+AFG +
Sbjct: 372 VVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGIAFTSAFGLV 431

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           A++  S      F WLL ++G++  F W  I   HIRF   L  +G S D+LP+KA    
Sbjct: 432 AFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDELPFKAPAGI 491

Query: 514 GLAYYGAFFVTLIILIQGFTAFAP---KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLW 570
             + +G F + L+ + Q + A  P   K  +  F  +Y+S  + L  Y   + Y R   W
Sbjct: 492 YGSMWGLFMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSFPVVLAFYFGHKLYARN--W 549

Query: 571 RTL 573
           + L
Sbjct: 550 KLL 552

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  254 bits (650), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 165/489 (33%), Positives = 254/489 (51%), Gaps = 22/489 (4%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           EED D    + E  ++R LKPRH                     +   GP    + Y  M
Sbjct: 41  EEDYDPEANIRE-DLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIM 99

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           G +V+     LGEM+T++P++ SF  +A +F S+ F  A  + YWF+ A++ A +++ + 
Sbjct: 100 GGVVYLTLLCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQ 159

Query: 208 QVIEFWTFKV---PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCL 264
            V+++W  +    P  A   +FW L+V++N   V+ YGE E+W+A +KVIAII F I  +
Sbjct: 160 LVMDYWDTEASGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFFILSI 219

Query: 265 CMVCGAGITGP-VGFRYWRH-PGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVG 322
            +  G       +GF+ W H   P+  G          F G+ S  ++A+F Y GTE + 
Sbjct: 220 VVNVGHNPQHEYIGFKNWNHGEAPFVDG----------FKGFASLFVSASFAYGGTESIT 269

Query: 323 ITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFII 382
           +T GEAANP ++ P+ +K V  R               +PY+ P L +    V  SPF +
Sbjct: 270 LTNGEAANPLRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYDYPGLDTKS--VVTSPFTL 327

Query: 383 AIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFF--QKTRNGVP 440
             Q +GTK      NAVI+T++ISA N  ++ GSR++Y +      PK    +  R  VP
Sbjct: 328 VFQMAGTKAAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKVP 387

Query: 441 FIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGM 500
           +++VL T++ G L +  +  G    + WL NI GV+   AWL I I+ IRF + L+ +G 
Sbjct: 388 YVSVLITSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGK 447

Query: 501 SRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIV 560
           +  +L YK    P   Y+   FVT IIL+QG++AF P +D T F + Y+  F+F F +I+
Sbjct: 448 TH-ELRYKNWTYPYGPYFLVIFVTFIILVQGWSAFDP-WDVTNFFSYYLDLFVFPFCFII 505

Query: 561 AQCYFRTRL 569
              Y R R 
Sbjct: 506 WWLYKRDRF 514

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  254 bits (650), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 164/487 (33%), Positives = 254/487 (52%), Gaps = 22/487 (4%)

Query: 90  DIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGT 149
           D++    + E+ + R L PRH                     +   GP    I Y  MG 
Sbjct: 46  DLEDHDKIRES-LNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGG 104

Query: 150 LVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQV 209
           +V+     LGEM+TF+P++ SF  +A +F  + F  A    YWF+ A++ A +L+ +  V
Sbjct: 105 VVYLTMLCLGEMSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLV 164

Query: 210 IEFW---TFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM 266
           +++W       P  A   +FWV ++ +N   V+VYGE E+W+A +KVIAI+ F I  + +
Sbjct: 165 LDYWKSSQHNFPYWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVV 224

Query: 267 VCGAGITGP-VGFRYWRHP-GPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGIT 324
             G       +GF+YW +   P+  G          F G+V+  +++AF+Y GTE + +T
Sbjct: 225 NVGHNPDHEYIGFKYWSYKEAPFVNG----------FKGFVTIFVSSAFSYGGTESITLT 274

Query: 325 AGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAI 384
           AGEA NP ++ PR +K V  R               +PY+ P LS+    V  SPF I  
Sbjct: 275 AGEARNPIRNTPRIVKTVFWRILIFYVATMFFISMNIPYDYPNLSTKS--VMTSPFTIIF 332

Query: 385 QNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLA-PKFFQKT-RNGVPFI 442
           Q +GTK      NAVILT+I+SA N  ++ GSR+LY +       PK   KT R   P++
Sbjct: 333 QMAGTKAAGSFMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYV 392

Query: 443 AVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSR 502
           AV+ T A G L +  +  G    + WL NI GV+   AWLSI+++ IRF + L  +G ++
Sbjct: 393 AVILTWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQGKTQ 452

Query: 503 DDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQ 562
            +L +K    P   Y+   FVTLIIL+QG++AF P + ++ F + Y+  F+F   +++  
Sbjct: 453 -ELQFKNWTYPYGPYFLVIFVTLIILVQGWSAFDP-WSTSDFFSYYLELFVFPTCWLIWW 510

Query: 563 CYFRTRL 569
            + R R 
Sbjct: 511 IFKRDRF 517

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  254 bits (650), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 152/483 (31%), Positives = 245/483 (50%), Gaps = 14/483 (2%)

Query: 97  VEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQ 156
           +    + + L  RH                     + + GP   ++ ++ + T +F+V  
Sbjct: 38  LNNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVIN 97

Query: 157 SLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
           SLGE+A   P+   F V+ +RFV    G A    Y   W +   LEL      I++W  K
Sbjct: 98  SLGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK 157

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITGP 275
           +   AW++IF+V IV+ N   VK +GE EF ++ +K++AIIGF I  + +   G    G 
Sbjct: 158 INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +GF+YW +PG +  G      N ++F G  S  + AAF++ G E++ ++A E+ NPRK +
Sbjct: 218 LGFKYWNNPGAFVGG-----TNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVI 272

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL--SSTDSYVSASPFIIAIQNSGTKVLP 393
           P+A K+                   VPYND +L  ++T    +ASP +IAI+N G K LP
Sbjct: 273 PKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLP 332

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGA 452
            + NA+IL  I+S ANS VY  SR +  ++     PK   K  + G P  A++ T  FG 
Sbjct: 333 SLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGL 392

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           L+++  S      F WL  ++G++  F W++I+ S IRF + ++ +  S D+LPY +   
Sbjct: 393 LSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTG 452

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568
              A+YG   + L+I+   +T+  P      D+ +F  +++S  + L  Y   + YF  R
Sbjct: 453 IWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYF-AR 511

Query: 569 LWR 571
            WR
Sbjct: 512 NWR 514

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  254 bits (649), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 161/514 (31%), Positives = 244/514 (47%), Gaps = 15/514 (2%)

Query: 62  EDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXX 121
           + A + K  K   +             E+ D +       VKR LK RH           
Sbjct: 9   DTANVEKTDKGDAKSPSALIIKAVDISEEPDVSKFDPNTGVKRALKNRHISLLALGGVIG 68

Query: 122 XXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSD 181
                     +   GP+  L+ +  +G + F+V +S+GE+ T  P    FT  A RF  D
Sbjct: 69  PGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVMESIGEIITLYPSGGGFTTLARRFHGD 128

Query: 182 PFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVY 241
              A CGY Y   +    A E + +  +++FW  +VPL  +I IFW    I     V ++
Sbjct: 129 ALSAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFWFAFEIFQLIGVSLF 188

Query: 242 GEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPV-GFRYWRHPGPWGPGIISKDKNEAR 300
           GE E+W++  K++ ++ + I+ +  + G     P  GF YW  PG    G          
Sbjct: 189 GETEYWLSWFKIVGLVAYYIFSIIYISGGIKDRPAFGFHYWNSPGSLSHG---------- 238

Query: 301 FLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXX 360
           F G     +  +  Y GTE V + A E+ NP K+VP A+++   R               
Sbjct: 239 FKGIAVVFVFCSTFYSGTECVALAATESKNPGKAVPLAVRQTLWRVLIVYIGIAVFYGAT 298

Query: 361 VPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILY 420
           VP++DP LS+T + V  SP  IAI  +G     H+ NA IL T ISA N ++Y+GSR L 
Sbjct: 299 VPFDDPNLSAT-TKVLKSPISIAISRAGWAGGAHLVNAFILVTCISAINGSLYIGSRTLT 357

Query: 421 GLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFF 479
            L+   LAPK    T R GVP  A+    A G ++ M  S G  +A+++++N++GV  F 
Sbjct: 358 NLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVSVGASDAYSYIVNLSGVGVFI 417

Query: 480 AWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKF 539
            W  IS +H+R  +    +G S ++LPYKA L P    +       + LIQG+T+F P F
Sbjct: 418 VWGVISYTHLRVRKAWVTQGRSLEELPYKALLYPWTPIFSLIANVFLALIQGWTSFVP-F 476

Query: 540 DSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTL 573
           D+  F+ AYI   + + +Y VA C F+   +R +
Sbjct: 477 DAGNFVDAYILLPVAIVLY-VAICVFKNHHFRIV 509

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  256 bits (653), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 168/535 (31%), Positives = 260/535 (48%), Gaps = 32/535 (5%)

Query: 41  DRRFLHRHRGSEGEVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEA 100
           D  FL   +GS G     ++  D T    S  H R            +EDI+ T      
Sbjct: 44  DSTFLLSSKGSPG---INQTTNDVT----SSDHFRGSEGIE------QEDINNT------ 84

Query: 101 QVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160
            + ++L  RH                     +   GP   +I ++ + T +F+V  SLGE
Sbjct: 85  NLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGE 144

Query: 161 MATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLA 220
           ++   PV   F V++ RFV   F  A    Y   W +   LEL      I++W  K+   
Sbjct: 145 LSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSD 204

Query: 221 AWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITGPVGFR 279
           AW++IF+  I + N   VK +GE EF ++ IK+++IIGF I  + + C G    G +G +
Sbjct: 205 AWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGK 264

Query: 280 YWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 339
           YW  PG +         +  +F G  S  + AAF+Y G E+  ++A E+ NPR+++P+A 
Sbjct: 265 YWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAA 319

Query: 340 KKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSA--SPFIIAIQNSGTKVLPHIFN 397
           K+                   VP NDP+L +  S V A  SP +IAI+N G K LP + N
Sbjct: 320 KRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLMN 379

Query: 398 AVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYM 456
           A+IL  ++S ANS VY  SR +  ++     PKF  +  + G P  A+L T  FG L+++
Sbjct: 380 AIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFV 439

Query: 457 ETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLA 516
             S      F WL  ++G++  F W++I++SHIRF Q +K +  S D+LP+ +      +
Sbjct: 440 AASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGS 499

Query: 517 YYGAFFVTLIILIQGF-TAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLW 570
           +YG F V  ++LI  F T+  P   S A   ++   +L   I IV  CYF  +++
Sbjct: 500 WYG-FIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIV--CYFGHKIY 551

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  255 bits (651), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 154/490 (31%), Positives = 247/490 (50%), Gaps = 18/490 (3%)

Query: 92  DATGVVEEAQV-----KRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIF 146
           DAT  V  A V      + L  RH                     + + GP   +I ++ 
Sbjct: 55  DATSTVSNASVTNVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVI 114

Query: 147 MGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVV 206
           + T +F+V  +LGEMA   PV   F V+ +RFV    G A    Y   W +   LEL   
Sbjct: 115 ISTCLFTVINALGEMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAA 174

Query: 207 GQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM 266
              I++W   +   AW++IF+ +I   N   VK +GE EF ++ +K++AIIGF I  + +
Sbjct: 175 SMTIKYWNDTINSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVL 234

Query: 267 VC-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITA 325
            C G    G +G +YW +PG +         +  +F G  S  + AAF+Y G E+  ++A
Sbjct: 235 SCGGGPQGGYLGGKYWHNPGSF-----VGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSA 289

Query: 326 GEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSA--SPFIIA 383
            E+ +PR+++P+A K+                   VPY++P+L S  S V A  SP +IA
Sbjct: 290 AESKDPRRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVIA 349

Query: 384 IQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFI 442
           I+N G K LP + NA+IL +IIS ANS VY  SR +  ++     P+  +   + G P  
Sbjct: 350 IENGGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVN 409

Query: 443 AVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSR 502
           A+LFT  FG L+++  S      F WL  ++G++  F W++I+ISHIRF Q +K +  S 
Sbjct: 410 AILFTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSL 469

Query: 503 DDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIY 558
           D+LPY +      ++YG   + L++++  +T+  P      D+ +F   Y+S  + +  Y
Sbjct: 470 DELPYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACY 529

Query: 559 IVAQCYFRTR 568
           +  +  +R +
Sbjct: 530 VGHKLVYRKK 539

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  255 bits (651), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 154/475 (32%), Positives = 241/475 (50%), Gaps = 14/475 (2%)

Query: 101 QVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160
           ++K+ +K RH                     ++ AGP   +I Y+ +  + + + Q+ GE
Sbjct: 85  RLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGE 144

Query: 161 MATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPL 219
           M    P +  +F  + S F+S  FG A  +++   W     LEL      I++W  K+  
Sbjct: 145 MGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDKINS 204

Query: 220 AAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITGPVGF 278
             +I IF+V ++ ++FF VK YGE EF  +S K++ I GFII  + + C GAG+ G +G 
Sbjct: 205 DVFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYIGG 264

Query: 279 RYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 338
           +YWR PG +  G         RF G    L+ A F++ G EL  ++  E +NPRKS P A
Sbjct: 265 KYWRDPGSFAEG-----NGATRFKGICFILVTAYFSFGGIELFVLSINEQSNPRKSTPVA 319

Query: 339 IKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVS-ASPFIIAIQNSGTKVLPHIFN 397
            K+   R               VP+N+ +L  + S  + ASP+++A      +V+PHI N
Sbjct: 320 AKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVVPHIIN 379

Query: 398 AVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYM 456
           AVIL ++IS ANS +Y   R++  L+    APKF     R G P  A+      G + ++
Sbjct: 380 AVILISVISVANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFV 439

Query: 457 ETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLA 516
             S   + AF WL  I G++  F W  I +SHIRF + +K +G S D++ YKA      +
Sbjct: 440 ACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGS 499

Query: 517 YYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
           YYG FF  L+ + Q + A +P     K ++ AF  +Y++  L+L +Y+    Y R
Sbjct: 500 YYGVFFNILVFMAQFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGYMLYER 554

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  254 bits (650), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 156/485 (32%), Positives = 243/485 (50%), Gaps = 15/485 (3%)

Query: 92  DATGVVE-EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTL 150
           D T  ++ +  +K+ +K RH                     +  AGP   +I Y  +  +
Sbjct: 66  DGTNSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFI 125

Query: 151 VFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQV 209
            + V Q+ GEMA   P +   F  +AS FVS PFG A  +++   W     LEL      
Sbjct: 126 TYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMT 185

Query: 210 IEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC- 268
           I++W  K+    ++ I +V ++ ++FF V+ YGE EF   S K++ I GF+I  + + C 
Sbjct: 186 IKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCG 245

Query: 269 GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEA 328
           GAG+ G +G +YWR PG +     + D   +RF G    L+ A F+Y G EL  ++  E 
Sbjct: 246 GAGVDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQ 300

Query: 329 ANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYN-DPKLSSTDSYVSASPFIIAIQNS 387
            NPR+S P A K+   R               VP+N D  + +  S   ASP+++A+   
Sbjct: 301 ENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAVSIH 360

Query: 388 GTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLF 446
           G KV+PHI NAVIL ++ S ANS +Y   R+L  L+    APK+F    R G P  A++ 
Sbjct: 361 GVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALIL 420

Query: 447 TAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLP 506
            + FG +A+   S   +  F WL  I G++  F W SI +SH+RF   +K +G S ++L 
Sbjct: 421 CSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELG 480

Query: 507 YKAALMPGLAYYGAFFVTLIILIQGFTAFAPK-----FDSTAFLTAYISCFLFLFIYIVA 561
           Y +      + YG FF  L+ + Q + A +P      + + AF  +Y++  ++LF Y+  
Sbjct: 481 YISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGY 540

Query: 562 QCYFR 566
             Y R
Sbjct: 541 MLYSR 545

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  254 bits (650), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 155/477 (32%), Positives = 242/477 (50%), Gaps = 18/477 (3%)

Query: 97  VEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQ 156
           + + +++R ++PRH                     ++  GP G +I Y  +  + + + Q
Sbjct: 74  LTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMMQ 133

Query: 157 SLGEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTF 215
           + GEMA   P +  +F  ++S F+S PFG A  ++Y   W   F LEL      I++WT 
Sbjct: 134 AAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKYWTD 193

Query: 216 KVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITG 274
            V    +I+IF+V I+ ++FF  + YGE EF     KV+ I GF+I  + + C GAG +G
Sbjct: 194 SVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAGNSG 253

Query: 275 PVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 334
            +G RYW  PG +  G        ++F G+   L+   F+Y GTEL  +T  E ++PR++
Sbjct: 254 YIGARYWHDPGAFAVG-----DPASKFKGFCYVLVTGYFSYGGTELYAMTVNEQSSPRRA 308

Query: 335 VPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL--SSTDSYVSASPFIIAIQNSGTKVL 392
           +  A K+   R               VP+   +L  S   S   ASP+++A+   G KV+
Sbjct: 309 IHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYVLAVSLHGVKVV 368

Query: 393 PHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFG 451
           PHI NAVIL  ++S  NS +Y G R+L  L+    APKF     R G P +A++  +  G
Sbjct: 369 PHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACSVIG 428

Query: 452 ALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAAL 511
            LA++  S   ++ F WL  I G++  F W +I +SHIRF Q +K+ G S   L YK+  
Sbjct: 429 LLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKSIT 488

Query: 512 MPGLAYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISC---FLFLFIYIV 560
               + YG  F  L+ + Q + A AP     K D  +F  +Y++    F+F   Y+V
Sbjct: 489 GLWGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLGYMV 545

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  255 bits (652), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 162/523 (30%), Positives = 251/523 (47%), Gaps = 14/523 (2%)

Query: 56  EYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXX 115
           E    DED        R V+              D D   ++    + ++L  RH     
Sbjct: 96  ENINVDEDKLPFSDDIRDVKDRSDFSSSFVSSARDKDEETLLA-TDMNKDLSVRHLLTLA 154

Query: 116 XXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFA 175
                           +   GP   +I ++ + T +F+V  SLGE+A   PV   F+V+ 
Sbjct: 155 VGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLGELAAAFPVVGGFSVYM 214

Query: 176 SRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNF 235
            +FV   F  A    Y   W +   LEL      I +W   +   AW+SIF+V I + N 
Sbjct: 215 DKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYWNSSINSDAWVSIFYVAIGLANM 274

Query: 236 FPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP-VGFRYWRHPGPWGPGIISK 294
             VK +GE EF ++ +K++AIIGF I  + + CG G +   +G +YW  PG +  G  S 
Sbjct: 275 LDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGGKYWHDPGAF-VGTTSG 333

Query: 295 DKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXX 354
            K    F G  S  + AAF++ G E+  ++A E+ NPR+++P+A K+             
Sbjct: 334 SK----FKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPKAAKRTFWLITGSYVSIL 389

Query: 355 XXXXXXVPYNDPKLSSTDSYVSA--SPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNV 412
                 VPYNDP+L +  S V A  SP +IAI+N     LP + NA+IL  I+S ANS+V
Sbjct: 390 TLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENGHIHGLPSLMNAIILIAILSVANSSV 449

Query: 413 YVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLN 471
           Y  SR +  +S  +  PK F K  R G P  A+ F   FG L+++  S      F WL  
Sbjct: 450 YACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLSFVAASDKQAEVFTWLSA 509

Query: 472 ITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQG 531
           ++G++  F W+ I++ HIRF Q +  + +S D+LP+ +      + YG   + L+++   
Sbjct: 510 LSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIWGSIYGIVILFLVLVASF 569

Query: 532 FTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLW 570
           +T+  P    K ++T+F   Y+S  + L  YI  + YF+   W
Sbjct: 570 WTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKNWRW 612

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  253 bits (647), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 154/494 (31%), Positives = 250/494 (50%), Gaps = 19/494 (3%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
             +++A G     ++K+ L  RH                     ++  GP G +I+YI +
Sbjct: 47  SSEVEAEG---NGKLKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIII 103

Query: 148 GTLVFSVTQSLGEMATFIP-----VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALE 202
            T+++ +  +LGEM  ++P        S      R+V      A G+ Y++ + I  A E
Sbjct: 104 STVIYPIMNALGEMVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAE 163

Query: 203 LSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIY 262
            +    V+ +WT  VP A WI+IF  ++ ++NF  VK +GE EFW ASIK++ I+G I+ 
Sbjct: 164 CTAASGVVTYWTTSVPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILV 223

Query: 263 CLCMVCGAGITG-PVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-QGTEL 320
              +  G G +   +GF YW+ PG +   I     +   FL   + +I  AF +  G EL
Sbjct: 224 SFILFWGGGPSHVRLGFHYWKDPGTFAHHI--TGGSWGSFLDIYTGIIKGAFAFILGPEL 281

Query: 321 VGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDP----KLSSTDSYVS 376
           V +T+ E  + R+++ +A K+   R               V YNDP     L       +
Sbjct: 282 VALTSSECNDQRRNIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAA 341

Query: 377 ASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-T 435
           +SPF+I IQN+G KVLPHI NA IL++  SA NS ++  SR L  ++    APK F K  
Sbjct: 342 SSPFVIGIQNAGIKVLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVN 401

Query: 436 RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTL 495
           R GVP+ +V  +A    LA++  S+     F+W  NI+ ++GF  W+   I+++RF + +
Sbjct: 402 RFGVPYYSVGLSAMLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAI 461

Query: 496 KHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKF-DSTAFLTAYISCFLF 554
            +  M  D LP+K    P L +Y    +++I L  G+  F P+F   + F+ AYI+  LF
Sbjct: 462 FYNNM-YDRLPFKTFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLF 520

Query: 555 LFIYIVAQCYFRTR 568
           L +++  + + R +
Sbjct: 521 LILWVGHKFWARYK 534

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  253 bits (646), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 163/495 (32%), Positives = 248/495 (50%), Gaps = 23/495 (4%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           +EDI+ T       + +EL  RH                     +   GP   +I ++ +
Sbjct: 78  QEDINNT------NLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVII 131

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
            T +F+V  SLGE++   PV   F V++ RFV   F  A    Y   W +   LEL    
Sbjct: 132 STCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAAS 191

Query: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
             I++W  K+   AW++IF+  I + N   VK +GE EF ++ IK++AIIGF I  + + 
Sbjct: 192 ITIKYWNDKINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLS 251

Query: 268 C-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAG 326
           C G    G +G +YW  PG +    +  D    +F G  S  + AAF+Y G E+  ++A 
Sbjct: 252 CGGGPHGGYIGGKYWNDPGAF----VGHDSG-TKFKGLCSVFVTAAFSYSGIEMTAVSAA 306

Query: 327 EAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSA--SPFIIAI 384
           E+ NPR+++P+A K+                   VP NDP+L +  S V A  SP +IAI
Sbjct: 307 ESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAI 366

Query: 385 QNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIA 443
           +N   K LP + NA+IL  ++S ANS VY  SR +  ++     PKF ++  + G P  A
Sbjct: 367 ENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINA 426

Query: 444 VLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRD 503
           ++ T  FG L+++  S      F WL  ++G++  F W++I++SHIRF Q +K +  S D
Sbjct: 427 IVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLD 486

Query: 504 DLPYKAALMPGLAYYGAFFVTLIILIQGF-TAFAPKFDSTAFLTAYISCFLFLFIYIVAQ 562
           +LP+ +      + YG F V  ++LI  F T+  P   S A   ++   +L   I IV  
Sbjct: 487 ELPFISQTGVWGSIYG-FVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILIV-- 543

Query: 563 CYF----RTRLWRTL 573
           CYF     TR WR L
Sbjct: 544 CYFGHKIYTRDWRLL 558

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  253 bits (645), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 154/494 (31%), Positives = 246/494 (49%), Gaps = 22/494 (4%)

Query: 89  EDIDATGVVEEAQ--VKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIF 146
           E  DA   + + Q  +K  +K RH                     +   GP G +I Y+ 
Sbjct: 53  EGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVT 112

Query: 147 MGTLVFSVTQSLGEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSV 205
             T+++ V Q+  E+   +  +  ++  + +  V   FG A   +Y   WA    LEL  
Sbjct: 113 TSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVT 172

Query: 206 VGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLC 265
               +++WT  V    +++IF+V ++ ++FF  + Y E EF   S+KV+ + GFII  + 
Sbjct: 173 ASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAIS 232

Query: 266 MVCGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITA 325
           +  GA   G +G +YW  PG +G      D+   RF G  S  + AAF Y G+E + +TA
Sbjct: 233 LTAGASEQGYIGGQYWHDPGAFG-----GDRAIDRFKGICSVWVQAAFAYGGSEFIALTA 287

Query: 326 GEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTD--SYVSASPFIIA 383
            E ANPR+SVP+A K+   R               VP+N  +L S +  S   ASPF+IA
Sbjct: 288 AEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRASPFVIA 347

Query: 384 IQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFI 442
               G +V+PHI N +ILT++IS  NS +Y   RIL  L+   + PK F    R G P +
Sbjct: 348 AALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLV 407

Query: 443 AVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSR 502
            ++F + FG +A++  S   +N F WL  I G++  F W +I++SH+RF + ++ +G S 
Sbjct: 408 TLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSL 467

Query: 503 DDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISCFLFLFI 557
            +L Y+A      +YY  FF  ++++ Q + A AP     + D   F   Y++ F  L +
Sbjct: 468 GELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLA-FPVLVV 526

Query: 558 YIVAQCYFRTRLWR 571
           +     Y   +LW+
Sbjct: 527 F-----YLGYKLWK 535

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  253 bits (646), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 160/484 (33%), Positives = 247/484 (51%), Gaps = 15/484 (3%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           +   +K+ +KPRH                     + N GP   LI Y  + T+++ V QS
Sbjct: 83  KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142

Query: 158 LGEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
             E+A  +  ++  F  + +  V   F  +  ++Y   W     LEL      I++W   
Sbjct: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGP 275
           +   A++ IF+V+++++NF     Y E EF+  + KV+ +IGF I  + + CG AG  G 
Sbjct: 203 INPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGNDGY 262

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +G  YW  PG +       +    RF G V+ L+NAAF Y G E   +TA E  NP+KS+
Sbjct: 263 LGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 317

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVS-ASPFIIAIQNSGTKVLPH 394
             A KK+  R               VPYN P+L  + S  + ASPF+IAI + G KV+PH
Sbjct: 318 RSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPH 377

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGAL 453
           I NAVIL +++S ANS +Y  SRIL  LS    APK F    R G P   +L +  FG L
Sbjct: 378 IINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLL 437

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
            ++  S   +  F WLL I+G++  F W SIS+SH+RF +++  +G S D+L Y++    
Sbjct: 438 CFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGV 497

Query: 514 GLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRL 569
             AYY    + LI++ Q + A +P    K D+  F   Y++  + + +Y+  + ++R   
Sbjct: 498 WGAYYAMIMILLILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRD-- 555

Query: 570 WRTL 573
           WR +
Sbjct: 556 WRVI 559

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  253 bits (646), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 155/497 (31%), Positives = 251/497 (50%), Gaps = 20/497 (4%)

Query: 88  EEDIDATGVVE--------EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVG 139
            E +  T VVE          ++K+ ++PRH                     + +AGP G
Sbjct: 77  HESVFDTAVVEISAVDNQINEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAG 136

Query: 140 SLIAYIFMGTLVFSVTQSLGEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAIT 198
            +I Y  M T ++ V Q++GEMA  ++ +   F+ +    +      A  ++Y   W   
Sbjct: 137 LIIGYAIMSTCIYCVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCV 196

Query: 199 FALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFP-VKVYGEFEFWVASIKVIAII 257
             LEL      I++WT KV    ++ IF++L++ +N F   + Y E EF+    K++ + 
Sbjct: 197 CPLELVTASMTIQYWTTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMT 256

Query: 258 GFIIYCLCMVCG-AGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQ 316
           GF I  + ++CG AG +G +G RYW  PG +       D    RF G VS+L+ AAF + 
Sbjct: 257 GFFILGIILICGGAGNSGFIGARYWHSPGAF-----RGDNGINRFKGIVSTLVTAAFAFG 311

Query: 317 GTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYV 375
           GTE + ITA E ANPRK++P A KKV  R               VPYN  +L  S+    
Sbjct: 312 GTEFLAITASEQANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPAT 371

Query: 376 SASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT 435
            ASP++IA+ + G +V+PH  NAVIL ++ S A+S  Y  SR+L  L+    APK F   
Sbjct: 372 KASPYVIAVASHGIRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYV 431

Query: 436 -RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQT 494
            + G P +  +  A    +++   S+   + FNWLL+I+G++  F W  IS+SHIRF + 
Sbjct: 432 DKRGRPTLGFVVGAIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRA 491

Query: 495 LKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLF 554
           +K +G S D++ +K+      + Y    + L+++ Q +    P  + +A   ++   +L 
Sbjct: 492 MKVQGRSLDEIGFKSQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLA 551

Query: 555 LFIYIVAQCYFRTRLWR 571
           + ++IV   YF  ++W 
Sbjct: 552 MPVFIV--LYFGYKIWN 566

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  253 bits (645), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 149/476 (31%), Positives = 243/476 (51%), Gaps = 12/476 (2%)

Query: 101 QVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160
           ++K+ ++PRH                     + +AGP G +I Y  M + ++ + Q++GE
Sbjct: 98  KLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAVGE 157

Query: 161 MA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPL 219
           MA  ++ +   F  +    V      +  ++Y   W     LEL      I++WT KV  
Sbjct: 158 MAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKVNA 217

Query: 220 AAWISIFWVLIVIMNFFP-VKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGPVG 277
             ++ IF++L++ +N F   + Y E EF   S K++ +IGF I  + ++CG AG  G +G
Sbjct: 218 DIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGFIG 277

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
            +YWR PG +            RF G VS+L+ AAF++  TE + ITA E +NPRK++P 
Sbjct: 278 GKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPS 332

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAIQNSGTKVLPHIF 396
           A KKV  R               VPY+  +L  S+ +   ASP+++A+   G +V+PH  
Sbjct: 333 AAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFI 392

Query: 397 NAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQ-KTRNGVPFIAVLFTAAFGALAY 455
           NAVIL ++ S A+S  Y  SR+L  L+    APK F    R G P +  L  A    +A+
Sbjct: 393 NAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAF 452

Query: 456 METSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGL 515
              S+     FNWLL I+G++  F W  I +SHIRF + +K +G S D++ YK+ +    
Sbjct: 453 CACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWG 512

Query: 516 AYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571
           + Y    + LI++ Q +    P  + +A + A+   +L + ++IV   Y   ++W+
Sbjct: 513 SAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIV--LYLGYKIWK 566

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  252 bits (644), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 167/487 (34%), Positives = 258/487 (52%), Gaps = 18/487 (3%)

Query: 96  VVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVT 155
           +  +  +K +LK RH                     ++  GP   LI +  MGT+++++ 
Sbjct: 79  ITAQTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMV 138

Query: 156 QSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFW-T 214
            +LGE+A   P++  FT +A+RF+ + FG A  + Y   W +T  LE+      + +W T
Sbjct: 139 MALGELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGT 198

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGI-T 273
                  ++++FW++IV +N F VK YGE EF  + IKVI IIGFII  + + CG G   
Sbjct: 199 DPKYRDGFVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEK 258

Query: 274 GPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
           G +G +Y+  PG +     + D   A+F G  S  + AAF++ G+ELVG+ A E+ +PRK
Sbjct: 259 GYIGGKYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRK 313

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASPFIIAIQNSGTK 390
           SVP+A K+V  R               VPYND +L   SS D+  +ASPF+IAI   G K
Sbjct: 314 SVPKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDA--AASPFVIAIVTHGIK 371

Query: 391 VLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAA 449
            LP + N VIL  ++S  NS ++  SR    L+     P+ F    R G P + ++ T+A
Sbjct: 372 GLPSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSA 431

Query: 450 FGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKA 509
            G +A++  S   ++ FNWLL ++G++  F W  I I HIRF + L  +G S D+L +K+
Sbjct: 432 VGLIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKS 491

Query: 510 ALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTA---FLTAYISCFLFLFIYIVAQCYFR 566
                 +Y+G F + ++ + Q + A  P   S +   F  AY+S  L L +YI  + Y R
Sbjct: 492 PTGVWGSYWGLFMIVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMYIGHKIYKR 551

Query: 567 TRLWRTL 573
              W+ L
Sbjct: 552 N--WKLL 556

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  253 bits (646), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 175/573 (30%), Positives = 272/573 (47%), Gaps = 32/573 (5%)

Query: 16  ESLETQEASSWDKKLKDKVRNEWARDRRFLHR-----HRGSEGEVEYAKSDEDATLTKAS 70
           E L+ Q  +S+D+     VRN   ++  F+        R           D D T T  S
Sbjct: 29  EYLDDQINNSYDES---SVRNRKTKEGTFVRSFIDSFKRADRNSNPLHDLDNDIT-TSIS 84

Query: 71  KRHVRXXXXXXXXXXXXEEDIDATGVVEEAQ----VKRELKPRHXXXXXXXXXXXXXXXX 126
           +  +                I  T    + +    +K+ +KPRH                
Sbjct: 85  RTSMDAALNKTKFDDAISSSISETNKGHQNEKSEDLKKTIKPRHVIMISLGTGIGTGLLV 144

Query: 127 XXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMAT-FIPVTSSFTVFASRFVSDPFGA 185
                +  AGP   +I Y  MGT ++ + Q+ GE+A  +  +   F  + S  V    G 
Sbjct: 145 GNGPVLSKAGPAALVIGYAIMGTCLYCIIQAAGELAVVYSDLNGGFNAYPSFLVDPALGF 204

Query: 186 ACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFE 245
           +  ++Y   W     LEL      I++WT KV    ++ IF+VLI+ +N F  + Y E E
Sbjct: 205 SVAWVYCLQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYVLIIAINTFGARGYAEAE 264

Query: 246 FWVASIKVIAIIGFIIYCLCMVCG-AGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGW 304
           F+    KV+ + GF I  + +  G AG  G +G +YW  PG +     + DK+  RF G 
Sbjct: 265 FFFNCCKVLMMTGFFILGIIITAGGAGNDGYLGAKYWHDPGAF-----NGDKSIDRFKGV 319

Query: 305 VSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYN 364
           + + + AAF +  TE + +TA E +NPRK++P A KKV  R               VPYN
Sbjct: 320 MDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVCIFLASITLIGFLVPYN 379

Query: 365 -DPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLS 423
            D  L S  S + ASP++IA+ + G +V+PH  NAVIL +++S  NS  Y  SR+L  L+
Sbjct: 380 SDQLLGSGGSGIKASPYVIAVSSHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLA 439

Query: 424 SAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWL 482
               APK+F    R G PF A+L +A FG +A+  TS      F+WLL I+G++  F W+
Sbjct: 440 QQGYAPKWFDYVDREGRPFRAMLMSALFGVIAFCATSPKETEVFSWLLAISGLSQLFTWI 499

Query: 483 SISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP----K 538
           +I +SHIRF + ++ +G S  ++ Y +      + Y A  + L ++ Q + A AP    K
Sbjct: 500 TICVSHIRFRRAMQVQGRSLGEVGYLSQSGVYGSAYAAIMLFLALIAQFWVAIAPIGEGK 559

Query: 539 FDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571
            D+  F   Y++      + I+   YF  R+W+
Sbjct: 560 LDAENFFQNYLA------MPILIAFYFGYRVWK 586

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  251 bits (642), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 151/487 (31%), Positives = 248/487 (50%), Gaps = 18/487 (3%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
           +  +K+ LK RH                     +   GP G   +Y  +  +++ V  +L
Sbjct: 48  DHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNAL 107

Query: 159 GEMATFIPVTSSFTV-----FASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFW 213
           GEM  ++P   S +        +R+V    G A G+ Y++ + I  A E +    V+++W
Sbjct: 108 GEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYW 167

Query: 214 TFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT 273
           T  VP  AWI+IF  ++V++NF  VK YGE EFW AS+K++ I+G +     +  G G  
Sbjct: 168 TTAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPH 227

Query: 274 GP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-QGTELVGITAGEAANP 331
              +GFRYW+ PG +   I S   N  RFL   + +I   F +  G ELV +T+ EA + 
Sbjct: 228 HDRLGFRYWQKPGAFAYHITS--GNTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDA 285

Query: 332 RKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSST----DSYVSASPFIIAIQNS 387
           R+++ +A ++   R               V YND  LS+          +SPF+I IQN+
Sbjct: 286 RRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNA 345

Query: 388 GTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLF 446
           G KVLPHI N  IL++  S+ NS ++  SR L  +S    APK   +  R GVP+ AV  
Sbjct: 346 GIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVAL 405

Query: 447 TAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLP 506
           T+    +AY+  S+   + F W  NI+ ++GF  W+ I I+++RF + +  + +  + +P
Sbjct: 406 TSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERVP 464

Query: 507 YKAALMPGLAYYGAFFVTLIILIQGFTAFAP-KFDSTAFLTAYISCFLFLFIYIVAQCYF 565
           +K    P   ++    V++I L  G+  F P  ++ + F+ AY++  +FL ++I  + + 
Sbjct: 465 FKTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLW- 523

Query: 566 RTRLWRT 572
            TR W+T
Sbjct: 524 -TRTWKT 529

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  252 bits (643), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 158/487 (32%), Positives = 241/487 (49%), Gaps = 14/487 (2%)

Query: 89  EDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMG 148
           ED   +   ++  +K+ +K RH                     +  AGP   ++ Y  + 
Sbjct: 65  EDGSKSITSDDDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVS 124

Query: 149 TLVFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
            + + + Q+ GEMA   P + +SF  +AS FVS PFG A  +++   W     LEL    
Sbjct: 125 FVTYFMIQAAGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITAS 184

Query: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
             I++W   +    +I IF+V ++ ++FF VK YGE EF   S K++ I GFII  + + 
Sbjct: 185 MTIKYWNDTINPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVIN 244

Query: 268 C-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAG 326
           C GAG  G +G +YW +PG +     + +   ARF G    L+   F+Y GTEL  ++  
Sbjct: 245 CGGAGRDGYIGNKYWINPGAF-----ASESPAARFKGVAYILVTGYFSYGGTELFSLSVN 299

Query: 327 EAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYN-DPKLSSTDSYVSASPFIIAIQ 385
           E  NPRKS P A K+   R               VP++ D  + +  S   ASP+++A  
Sbjct: 300 EQKNPRKSTPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHASPYVLAAS 359

Query: 386 NSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAV 444
             G KV+PH  NAVIL +++S ANS +Y   R++  L+    APK+F    R G P  A+
Sbjct: 360 LHGVKVVPHFINAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRAL 419

Query: 445 LFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDD 504
                FG + ++  S   + AF WL  I G++  F W SI ISHIRF   +K +G S ++
Sbjct: 420 CICGLFGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEE 479

Query: 505 LPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISCFLFLFIYI 559
           L Y+A      + Y  FF  L+ + Q + A +P     K+D+  F  +Y++  L+L  Y 
Sbjct: 480 LGYRATTGIWGSVYSVFFNMLVFIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYF 539

Query: 560 VAQCYFR 566
               Y R
Sbjct: 540 GYMIYSR 546

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  250 bits (639), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 163/508 (32%), Positives = 248/508 (48%), Gaps = 23/508 (4%)

Query: 60  SDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXX 119
           SD +A    + K+ +               D D    + E  + R L PRH         
Sbjct: 6   SDREAVKVDSGKQEI-YEVSSSLDIDELRSDFDPEQNIRE-DLTRALSPRHINMISIAGI 63

Query: 120 XXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFV 179
                       + N GP    + Y  +G +V+     LGEM+TF+P++ SF  +A +F 
Sbjct: 64  IGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGEMSTFMPISGSFCSYARKFG 123

Query: 180 SDPFGAACGYMYWFSWAITFALELSVVGQVIEFW---TFKVPLAAWISIFWVLIVIMNFF 236
           S+ F  A  + YWF+ A++ A +L+ +  V+++W       P      IFW  ++ +N  
Sbjct: 124 SESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHHFPYWGASLIFWFFVLFLNVI 183

Query: 237 PVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP-VGFRYWRH-PGPWGPGIISK 294
            V++YGE E+W+A +KVIAI+ F I  + +  G       +GF+ W H   P+  G    
Sbjct: 184 HVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHEYIGFKNWTHGEAPFVNG---- 239

Query: 295 DKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXX 354
                 F G+ S  ++A F Y GTE + +T GEA+NP ++ P+ +K V  R         
Sbjct: 240 ------FKGFASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTVFWRILIFYVLST 293

Query: 355 XXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYV 414
                 +PY+ P LS+    V  SPF +  Q +GT+      NAVILT++ISA N  ++ 
Sbjct: 294 FFIGMNIPYDYPGLSTKS--VMTSPFTLVFQMAGTRGAGSFMNAVILTSVISACNHALFA 351

Query: 415 GSRILYGLSSAKLAPKFF--QKTRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNI 472
           GSRI+Y ++     PK    +  R   P++AVL T A G L    +  G    + WL NI
Sbjct: 352 GSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLGASFIGAGTLWTWLQNI 411

Query: 473 TGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGF 532
            GV+   AWL I I+ IRF + L+ +G + D L +K    P   Y+   F   IILIQG+
Sbjct: 412 VGVSNQIAWLCIGITSIRFRKGLEVQGKT-DLLQFKNWTYPFGPYFLVIFTVFIILIQGW 470

Query: 533 TAFAPKFDSTAFLTAYISCFLFLFIYIV 560
            AF P +  T F + Y+  F+F F+YI+
Sbjct: 471 QAFDP-WSVTDFFSVYLELFVFPFVYII 497

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  252 bits (644), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 166/483 (34%), Positives = 249/483 (51%), Gaps = 24/483 (4%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
           +A ++  LK R                      ++  GP G +I +    T+++S+  +L
Sbjct: 100 KAPLQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMAL 159

Query: 159 GEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFW-TFKV 217
           GE+A   PV   FT +A+RFV + FG A  + Y   W +   LE+      + +W T   
Sbjct: 160 GELAVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTR 219

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVG 277
               ++++FW++IVI+N F VK +GE EF  + IKV  +IGFII  + +VCG G  G   
Sbjct: 220 YRDGFVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFV 279

Query: 278 F-RYWRHPGPW-GPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
             +YW  PG + G G      + A+F G  S  + AAF++ G+EL+GITA EAANPRKS+
Sbjct: 280 GAKYWHDPGAFVGHG------SGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSI 333

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASPFIIAIQNSGTKVL 392
           P A K+V  R               VPYND +L   SS D+  +ASPF+IAI   G K L
Sbjct: 334 PGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDA--AASPFVIAIVTHGIKGL 391

Query: 393 PHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFG 451
           P + N VIL  ++S  NS ++  SR +  LS     PK F    R+G P + +  T+ FG
Sbjct: 392 PSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFG 451

Query: 452 ALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAAL 511
            LA++  S      FNWLL ++G++  F W  I + HIRF   LK +G   ++L + +  
Sbjct: 452 LLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPA 511

Query: 512 MPGLAYYGAFFVTLIILIQGFTAFAP---KFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568
               +Y+G F + L+ + Q + A  P   K D+  F  +Y+S        IV   YF  +
Sbjct: 512 GVAGSYWGLFMIVLMFIAQFYVALFPPGGKPDAEVFFQSYLS------FPIVVATYFGHK 565

Query: 569 LWR 571
           +++
Sbjct: 566 IYK 568

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  251 bits (642), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 161/520 (30%), Positives = 253/520 (48%), Gaps = 16/520 (3%)

Query: 59  KSDEDATL---TKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXX 115
           KS  D+T    TK S    +            + D      +    + ++L  RH     
Sbjct: 40  KSQTDSTFPLSTKGSPGMKQTTNDITSSERSRDNDDVEQVDINNTNLNKDLSVRHLLTLA 99

Query: 116 XXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFA 175
                           +   GP   +I ++ +GT +F+V  SLGE++   PV   F V+ 
Sbjct: 100 VGGAIGTGLYVNTGTALSTGGPASLVIDWVIIGTCLFTVINSLGELSAAFPVVGGFNVYG 159

Query: 176 SRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNF 235
            RFV   F  A    Y   W +   LEL      I++W  K+   AW++IF+  I + N 
Sbjct: 160 MRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANM 219

Query: 236 FPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITGPVGFRYWRHPGPWGPGIISK 294
             VK +GE EF ++ IK+++IIGF I  + + C G    G +G +YWR+PG +       
Sbjct: 220 LDVKSFGETEFVLSMIKILSIIGFSILGIVLSCGGGPHGGYIGGKYWRNPGAF-----VG 274

Query: 295 DKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXX 354
             +  +F G  S  + AAF+Y G E+  ++A E+ NPR+++P+A K+             
Sbjct: 275 HNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTIL 334

Query: 355 XXXXXXVPYNDPKLSSTDSYVSA--SPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNV 412
                 VP NDP+L +  S V A  SP +IAI+N   K LP + NA+IL  ++S ANS V
Sbjct: 335 TLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAV 394

Query: 413 YVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLN 471
           Y  SR +  ++     PKF  +  + G P  A+L T  FG L+++  S      F WL  
Sbjct: 395 YACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASNKEAEVFTWLSA 454

Query: 472 ITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQG 531
           ++G++  F W++I++SHIRF + +K +  S D+LP+ +      ++YG F V  ++LI  
Sbjct: 455 LSGLSTIFCWMAINLSHIRFRKAMKVQERSLDELPFISQTGVLGSWYG-FVVLFLVLIAS 513

Query: 532 F-TAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLW 570
           F T+  P   S A   ++   +L   I IV  CYF  +++
Sbjct: 514 FWTSLFPIGSSGASAESFFEGYLSFPILIV--CYFGHKIY 551

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  251 bits (641), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 178/575 (30%), Positives = 268/575 (46%), Gaps = 45/575 (7%)

Query: 15  HESLETQEASSWDKKLKDKVRNEWARD------RRFLHRHRGSEGEVEYAKSDEDATLTK 68
           +E L   E  S +  L++ + +    D       R LH    S         D    L  
Sbjct: 11  NEKLPATECGSSNSNLRESISSNDLSDGDRGFVNRKLHNFCNSFKRANSDTFDASQDLEG 70

Query: 69  ASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXX 128
           AS   VR                        ++ K+ +K RH                  
Sbjct: 71  ASINSVR----------------------SNSKFKQSMKSRHVVMMSLGTGIGTGLLVAN 108

Query: 129 XXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAAC 187
              +   GP G LI Y  +  + + + Q+ GEMA   P +  +F V++S F+S  FG A 
Sbjct: 109 GKSLHFGGPAGLLIGYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFAT 168

Query: 188 GYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFW 247
            ++Y   W     LEL      I++W   +   A+I+IF+ +IV ++FF    YGE EF 
Sbjct: 169 VWLYCLQWLTVLPLELITASLTIKYWNSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFI 228

Query: 248 VASIKVIAIIGFIIYCLCMVC-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVS 306
            ++ KV  I GFII  + + C GAG  G +G  YWR+PG +  G          F G   
Sbjct: 229 FSTCKVSMIAGFIILSIVINCGGAGTGGYIGGEYWRNPGAFAGG-----SPIGHFKGIAY 283

Query: 307 SLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDP 366
            L+ A F+Y G EL  +T  E ANPRK+VP A KK   R               VPYN  
Sbjct: 284 VLVTAYFSYGGMELFALTVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSD 343

Query: 367 KL--SSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSS 424
           +L  SS  S   ASP++IA+ + G KV+PHI NAVIL +++S  NS +Y   R+L  L+ 
Sbjct: 344 ELMGSSGKSATHASPYVIAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAE 403

Query: 425 AKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLS 483
              APK F    R G P +A++  + FG L+++  S   +  F WL  I G++  F W +
Sbjct: 404 QGYAPKIFSYVDRAGRPLVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSA 463

Query: 484 ISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP-----K 538
           I +SH+RF   +K++G S  +L YK+      + Y  FF  ++ + Q + A AP     K
Sbjct: 464 ICLSHVRFRDAMKYQGYSLSELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAPIGNGGK 523

Query: 539 FDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTL 573
            D+ AF  +Y++  +++  Y+  + Y  ++ W+ L
Sbjct: 524 ADAEAFFQSYLAFPIWISCYVGYKIY--SKEWKLL 556

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  251 bits (640), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 156/488 (31%), Positives = 245/488 (50%), Gaps = 19/488 (3%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           +EDI+ T       + ++L  RH                     +   GP   +I ++ +
Sbjct: 78  QEDINNT------NLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVII 131

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
            T +F+V  SLGE++   PV   F V++ RF+   F  A    Y   W +   LEL    
Sbjct: 132 STCLFTVINSLGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAAS 191

Query: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
             I++W  K+   AW++IF+  I + N   VK +GE EF ++ IK+++IIGF I  + + 
Sbjct: 192 ITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLS 251

Query: 268 C-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAG 326
           C G    G +G +YW  PG +         +  +F G  S  + AAF+Y G E+  ++A 
Sbjct: 252 CGGGPHGGYIGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAA 306

Query: 327 EAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSA--SPFIIAI 384
           E+ NPR+++P+A K+                   VP NDP+L +  S V A  SP +IAI
Sbjct: 307 ESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAI 366

Query: 385 QNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIA 443
           +N G K LP + NA+IL  ++S ANS VY  SR +  ++     PKF  +  + G P  A
Sbjct: 367 ENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNA 426

Query: 444 VLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRD 503
           +L T  FG L+++  S      F WL  ++G++  F W++I++SHIRF Q +K +  S D
Sbjct: 427 ILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLD 486

Query: 504 DLPYKAALMPGLAYYGAFFVTLIILIQGF-TAFAPKFDSTAFLTAYISCFLFLFIYIVAQ 562
           +LP+ +      ++YG F V  ++LI  F T+  P   S A   ++   +L   I IV  
Sbjct: 487 ELPFISQTGVKGSWYG-FIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPILIV-- 543

Query: 563 CYFRTRLW 570
           CY   +L+
Sbjct: 544 CYVGHKLY 551

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  250 bits (639), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 166/563 (29%), Positives = 264/563 (46%), Gaps = 48/563 (8%)

Query: 15  HESLETQEASSWDKKLKDKVRNEWARD---RRFLHRHRGSEGEVEYAKSD-EDATLTKAS 70
           + +  T   +S   ++K+   +E +R+    RF+   R +E +     +D ED T    S
Sbjct: 25  YNNFNTSTTASLSPEVKE--HSEESRNGLVHRFVDSFRRAESQCLEENNDLEDGTRPMKS 82

Query: 71  KRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXX 130
             H+                            K+ +K RH                    
Sbjct: 83  NNHL----------------------------KKSMKSRHVVMMSLGTGIGTGLLVANAK 114

Query: 131 PIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMAT-FIPVTSSFTVFASRFVSDPFGAACGY 189
            ++ AGP   +I Y+ +  + + + Q+ GEM   +  +  +F  + S F+S  FG A  +
Sbjct: 115 GLKLAGPGSLVIGYVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTW 174

Query: 190 MYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVA 249
           ++   W     LEL      I++W   +    +I IF+V ++ ++FF VK YGE EF   
Sbjct: 175 LFCIQWLTVLPLELITSSMTIKYWNDSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFN 234

Query: 250 SIKVIAIIGFIIYCLCMVC-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSL 308
           S K++ + GFII  + + C GAG+ G +G +YWR PG +  G      N  RF G    L
Sbjct: 235 SCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFADG-----SNATRFKGICFIL 289

Query: 309 INAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL 368
           + A F++ G EL  ++  E +N RKS P A K+   R               VP+N+ +L
Sbjct: 290 VTAYFSFGGIELFVLSINEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQL 349

Query: 369 SSTDSYVS-ASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKL 427
             + S  + ASP+++A      +V+PHI NAVIL ++IS ANS +Y   R++  L+    
Sbjct: 350 MGSGSAATHASPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGY 409

Query: 428 APKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISI 486
           AP+F     R G P  A+   A  G + ++  S   + AF WL  I G++  F W  I +
Sbjct: 410 APRFLNYIDREGRPLRALAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIML 469

Query: 487 SHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP-----KFDS 541
           SHIRF + +K +G S  +L YKA      +YYG FF  L+ + Q + A +P     K D 
Sbjct: 470 SHIRFRKAMKVQGRSLGELGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCDV 529

Query: 542 TAFLTAYISCFLFLFIYIVAQCY 564
            AF   Y++  L++F+Y+    Y
Sbjct: 530 QAFFEGYLAAPLWIFMYLGYMLY 552

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  251 bits (640), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 152/469 (32%), Positives = 234/469 (49%), Gaps = 12/469 (2%)

Query: 97  VEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQ 156
           + E+ +K+ +K RH                     +  +GP   ++AY  +  + + + Q
Sbjct: 96  ISESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQ 155

Query: 157 SLGEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTF 215
           + GEMA   P +  +F  + S FVS PFG A  +++   W     LEL      I++W  
Sbjct: 156 AAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYWND 215

Query: 216 KVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITG 274
           K+    ++ IF+V ++ ++FF V+ YGE EF   S K++ I GFII+ + + C GAG  G
Sbjct: 216 KINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDG 275

Query: 275 PVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 334
            +G +YW  PG +     +   N  RF G    L+ A F+Y GTEL  ++  E  NPRKS
Sbjct: 276 YIGGKYWHDPGAF-----TSHTNIGRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKS 330

Query: 335 VPRAIKKVSVRXXXXXXXXXXXXXXXVPY-NDPKLSSTDSYVSASPFIIAIQNSGTKVLP 393
            P+A K+   R               VP+ ND  + S  S   ASP+++A    G +++P
Sbjct: 331 TPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHASPYVLAASIHGVRIVP 390

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGA 452
           H  NAVIL ++IS ANS++Y   R+L  L+    APKF     R G P  A+   + FG 
Sbjct: 391 HFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGV 450

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           + +   S   +  F WL  I G++  F W  I +SH+RF Q +K +G   ++L YKA   
Sbjct: 451 IGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSG 510

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAP---KFDSTAFLTAYISCFLFLFIY 558
              + YG FF  L+   Q + A AP   K  + +F  +Y++  +F   Y
Sbjct: 511 VWGSVYGVFFNILVFFAQFWVALAPPGSKPTALSFFESYLAFPIFFTFY 559

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  250 bits (638), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 151/481 (31%), Positives = 249/481 (51%), Gaps = 20/481 (4%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
            + +KR LK RH                     ++  GP   ++A+I  G++V+SV Q++
Sbjct: 81  RSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAI 140

Query: 159 GEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVP 218
           GE+   +PV+ S+  + SRF+   FG A  Y Y     +T  LE+      +++W     
Sbjct: 141 GELCVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHK 200

Query: 219 LA-AWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGI--TGP 275
            A  ++++F+V ++++NF  VK YGE EF  + IKV+AI+GFII  + +VCG G   TG 
Sbjct: 201 YADGFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGY 260

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +G +YW +PG +  G          F G+ +  + +AF++ G+E+  + A E+ NPR+ +
Sbjct: 261 IGTKYWHNPGGFAHG----------FKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDL 310

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAIQNSGTKVLPH 394
           P+A K+V  R               VPY +  L +S+    SASPF+IAI+ +G   LP 
Sbjct: 311 PKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPS 370

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGAL 453
           + N VIL  ++S  N+ V+  SR    L+     PK F    R G P   ++ +  FG L
Sbjct: 371 VINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLL 430

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           +++ +S      F W+L ++G+  FF W SI + H+RF Q L+ +G S D+L +KA    
Sbjct: 431 SFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGI 490

Query: 514 GLAYYGAFFVTLIILIQGFTAFAPKFDSTA---FLTAYISCFLFLFIYIVAQCYFRTRLW 570
             + YG   +++++  Q + A  P   S +   F   Y+S  + +  Y+  + Y  +R W
Sbjct: 491 WGSIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVY--SRNW 548

Query: 571 R 571
           R
Sbjct: 549 R 549

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  248 bits (633), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 155/472 (32%), Positives = 234/472 (49%), Gaps = 15/472 (3%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
           ++ VKR+LK RH                     +   GP+  L+ +  +G L F + +S+
Sbjct: 53  DSGVKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESI 112

Query: 159 GEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVP 218
           GEM T  P    FT    RF SD   A CGY Y   +    A E + +  +++FW  +VP
Sbjct: 113 GEMITLYPSGGGFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFWGPQVP 172

Query: 219 LAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPV-G 277
           L  +I IFW    +     V  +GE E+W+A  K++ ++ + I+ +  + G     P  G
Sbjct: 173 LYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFG 232

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
           F+YW  PG    G          F G  +  +  +  Y GTE V + A E+ NPR++VP 
Sbjct: 233 FQYWNDPGALSNG----------FKGIANVFVFCSTFYSGTESVALAATESKNPRRAVPI 282

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFN 397
           AI++   R               VPYND  L+   + V  SP  IAI  +G     H+ N
Sbjct: 283 AIRQTFWRILIVYLGISIFYGVTVPYNDENLNFA-TKVLKSPIAIAISRAGWPAGVHLVN 341

Query: 398 AVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYM 456
           A IL T ISA N ++Y+GSR L  L++  LAPK    T R GVP  A+    A G ++ M
Sbjct: 342 AFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISLM 401

Query: 457 ETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLA 516
             S    +A+N+++N++GV  F  W  IS++H+RF +  K +G +RD+LPYKA L P   
Sbjct: 402 NVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPVFP 461

Query: 517 YYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568
                    + L+QG++ F P FD+  F+ AYI     + +Y+    Y++T+
Sbjct: 462 IVSIIANIFLGLVQGWSYFKP-FDAKNFVDAYILIPAGIILYL-GVSYWKTK 511

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  248 bits (633), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 149/478 (31%), Positives = 239/478 (50%), Gaps = 13/478 (2%)

Query: 101 QVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160
            + ++L  RH                     +   GP   +I ++ + + +F+V  +LGE
Sbjct: 77  NLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGE 136

Query: 161 MATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLA 220
           +A   P+   F V+ +RFV   F  A    Y   W ++  LEL      I +W  ++   
Sbjct: 137 LAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYWNREINSD 196

Query: 221 AWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM-VCGAGITGPVGFR 279
           AW++IF+V I ++N   VK + E EF ++ IK++AI+GF I  + + V G    G +G +
Sbjct: 197 AWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGK 256

Query: 280 YWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 339
           YW  PG +       D   +RF G  S  + AAF+Y G E+  ++A E+ NPRK++P+A 
Sbjct: 257 YWNDPGAF-----HGDSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKAT 311

Query: 340 KKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYV--SASPFIIAIQNSGTKVLPHIFN 397
           K+                   VPYND +L S  S V  SASP +IAI+N+G K LP + N
Sbjct: 312 KRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMN 371

Query: 398 AVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYM 456
           A+IL  ++S ANS VYV SR++  ++     PK F K  + G P  ++  T   G L+++
Sbjct: 372 AIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFI 431

Query: 457 ETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLA 516
             S   +  F WL  I G++  F W+ I+++HIRF   LK +  S D+L Y +      +
Sbjct: 432 AASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGS 491

Query: 517 YYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLW 570
           +YG   + L+++   + +  P      D+ AF   Y+S  + +  YI  + Y +   W
Sbjct: 492 WYGVIILVLVLIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKNWKW 549

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  248 bits (634), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 155/484 (32%), Positives = 244/484 (50%), Gaps = 15/484 (3%)

Query: 93  ATGVVEEAQ-VKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLV 151
           ATG+ +  Q +K  +K RH                     +   GP G LI Y+   T++
Sbjct: 61  ATGLNKTQQKLKHNIKTRHLTMISLGTGIGTGLLVASGKALHYGGPGGLLIGYLTTSTML 120

Query: 152 FSVTQSLGEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVI 210
           + V Q+  E+   +  +  ++  + +  V   FG A   +Y   WAI   LEL      I
Sbjct: 121 YCVVQACCELGVAYATLPGNYNAYPTFLVDRGFGFAVALVYGLQWAIVLPLELVTASMTI 180

Query: 211 EFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGA 270
           ++WT  V    +++IF++ IV ++FF  + Y E EF   ++KV+ + GFII  + + CGA
Sbjct: 181 KYWTESVNPDVFVAIFYLFIVFIHFFGSRGYAESEFIFNTLKVLLMAGFIIMGISLNCGA 240

Query: 271 GITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 330
              G +G +YW +PG +     + +++     G  S  + +AF Y G+E + +TA E AN
Sbjct: 241 SKLGYIGAKYWSNPGTF-----AGERSINHLKGICSVWVQSAFAYGGSEFIALTAAEQAN 295

Query: 331 PRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL--SSTDSYVSASPFIIAIQNSG 388
           PR+SVP A K+   R               VPY   +L  SS  S   ASPF+IA    G
Sbjct: 296 PRESVPSATKRWLYRVVVVFLIPIALICFLVPYTSDQLLSSSGASASHASPFVIAAAYHG 355

Query: 389 TKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFT 447
            K++PHI NA+ILT++IS  NS +Y   RIL  L+   L PK F    R G P   +LF 
Sbjct: 356 VKIVPHIINAIILTSVISVGNSGMYSAPRILLSLAENGLCPKIFTYVDRAGRPLATLLFV 415

Query: 448 AAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPY 507
             FG L+++  S   ++ F WL  I G++  F W SI++SHIRF   +K +G S  +L Y
Sbjct: 416 CVFGLLSFVAASKNQESVFTWLTAIAGLSQLFTWTSIALSHIRFRAAMKVQGRSLGELGY 475

Query: 508 KAALMPGLAYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISCFLFLFIYIVAQ 562
            +      +YY  FF  ++++ Q + A AP     + D+ +F   Y++  + +  Y+  +
Sbjct: 476 TSTTGAIGSYYAVFFNIVVLVAQFWIAIAPIDKHGELDAESFFKNYLAFAVLVLFYVGYK 535

Query: 563 CYFR 566
            ++R
Sbjct: 536 IWYR 539

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  249 bits (635), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 152/485 (31%), Positives = 239/485 (49%), Gaps = 15/485 (3%)

Query: 97  VEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQ 156
           +  + + ++L  RH                     +   GP   +I +  + T +F+V  
Sbjct: 81  IHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVIN 140

Query: 157 SLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
           SLGE+A   PV   F V+ +RFV   F  +    Y   W +   LEL      I +W   
Sbjct: 141 SLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYWDDT 200

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITGP 275
           +   AW++IF+ LI+I N   VK +GE EF ++ +K++AIIGF I  + + C G    G 
Sbjct: 201 INSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGGY 260

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +G +YW  PG +       D    +F G  S  + AAF+Y G E++ ++A E+ NPRK++
Sbjct: 261 IGGKYWHDPGAF-----VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKTI 315

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL--SSTDSYVSASPFIIAIQNSGTKVLP 393
           P A K+                   V YND +L   S+   V+ASP +IAI+N G K LP
Sbjct: 316 PTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIENGGIKGLP 375

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGA 452
            + NA+IL  I+S ANS VY  SR +  ++     PK      + G P  A+  T  FG 
Sbjct: 376 SLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFFGL 435

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           L+++  S   +  F WL  ++G++  F W+ I+I+HIRF Q +  +  S D++PY +   
Sbjct: 436 LSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQTG 495

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568
              +YYG   + L+++   +T+  P      D+ AF   Y+S  + +  YI  + YF+  
Sbjct: 496 IYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYFKN- 554

Query: 569 LWRTL 573
            WR +
Sbjct: 555 -WRIM 558

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  249 bits (635), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 151/515 (29%), Positives = 256/515 (49%), Gaps = 21/515 (4%)

Query: 65  TLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXX 124
           T +  + +++             +EDID +       + ++L  RH              
Sbjct: 58  TTSSGATKNINGTSNPNDSNMLSKEDIDGS------NLNKDLNIRHLLTLAVGGAIGTGL 111

Query: 125 XXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFG 184
                  +   GP   +I ++ + T +F+V  SLGE+A   PV   F+V+ +RF+     
Sbjct: 112 FVNSGASLNTGGPASLVIGWVIVSTALFTVINSLGELAAAYPVVGGFSVYMTRFIDPSIA 171

Query: 185 AACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEF 244
            +    Y   W +   LEL      I +W  K+   AW+SIF+ +I ++N   VK +GE 
Sbjct: 172 FSINLNYLVQWLVLLPLELVAASITIRYWNDKINSDAWVSIFYTVIGLLNMLDVKSFGET 231

Query: 245 EFWVASIKVIAIIGFIIYCLCMVC-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLG 303
           EF ++ IK++AIIGF I  + + C G  + G +G +YW  PG +           ++F G
Sbjct: 232 EFVLSFIKILAIIGFTILGIVLSCGGGPVGGYIGGKYWHDPGAF-----VGHTAGSQFKG 286

Query: 304 WVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPY 363
             S  + AAF+Y G E++ ++A E+ +PRK++P A K+                   VPY
Sbjct: 287 LCSVFVTAAFSYSGIEMIAVSAAESIDPRKTIPVAAKRTFWLITASYVTILTLIGCLVPY 346

Query: 364 NDPKL--SSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYG 421
           +DP+L   S+   V++SP +IAI+N G K LP + NA+IL  ++S ANS VY  SR +  
Sbjct: 347 DDPRLLNGSSSVDVASSPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRYMVS 406

Query: 422 LSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFA 480
           ++     PK   +  + G P  A L T  FG ++++  S      F WL  ++G++  F 
Sbjct: 407 MAIIGNLPKQLGRIDKKGRPINATLVTLFFGLISFVAASDKQAEVFTWLSALSGLSTIFC 466

Query: 481 WLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP--- 537
           W+ I+ISHIRF + +  +G S +++PY + +    ++YG   + L+++   +T+  P   
Sbjct: 467 WMGINISHIRFRRAMDIQGRSLEEMPYLSQVGVYGSWYGCIILFLVLIAAFWTSLFPVGS 526

Query: 538 -KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571
            + ++T F   Y+S  + L  Y+  + YF+   WR
Sbjct: 527 SQANATTFFEGYLSLPILLACYVGHKFYFKN--WR 559

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score =  248 bits (632), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 158/475 (33%), Positives = 250/475 (52%), Gaps = 22/475 (4%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
            +D ++   V   ++ R L PRH                     +   GP   LI Y+ M
Sbjct: 48  SDDPESQDAVIRERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAGGPGSLLINYVIM 107

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           G +++    SLGEM+TF+P++ S+  ++ +FVS+ +  A     W+S A++ A +L+ + 
Sbjct: 108 GGVIYLTMLSLGEMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAVSVASDLTALQ 167

Query: 208 QVIEFW---TFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCL 264
            V+++W   T   P  A   +FW LI+ +N   VK+YGE E+W+A +KV+A+I F I  +
Sbjct: 168 LVLDYWKTNTHHFPYWAASLLFWFLILGLNVVHVKLYGEAEYWLAMLKVVAVIIFFIMAI 227

Query: 265 CMVCGAGITGP-VGFRYWRH-PGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVG 322
              CG       +GF+ W H   P+  G          F G+V+  + ++F+Y GTE V 
Sbjct: 228 IANCGHNQQHEYIGFKNWSHGDAPFVQG----------FKGFVTIFVTSSFSYGGTETVT 277

Query: 323 ITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFII 382
           +T GEA NP ++ P+ IK V  R               +PY+ P L +    V  SPF I
Sbjct: 278 LTGGEAKNPVRNTPKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNLKTKS--VLTSPFTI 335

Query: 383 AIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAP--KFFQKT-RNGV 439
             Q +GTK      NAVI+T+ ISA N  ++ GSRILY +      P  +FF KT RN  
Sbjct: 336 VFQMAGTKAAGSFMNAVIMTSAISACNHALFGGSRILYNMGLEGFLPYSRFFTKTNRNKA 395

Query: 440 PFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRG 499
           P++AV+ T A G L +  +  G    F+WL NI GV+   +WLSI++  IRF + L+ +G
Sbjct: 396 PYVAVITTWAVGGLCFGASFIGAGELFSWLQNIVGVSNQISWLSIAVISIRFRKGLEAQG 455

Query: 500 MSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLF 554
               +L ++    P   ++   F++LIIL+QG++AF P + +++F + Y+   +F
Sbjct: 456 KVH-ELKFRNWTYPYGPWFCIIFISLIILVQGWSAFDP-WSTSSFFSFYLELIVF 508

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  248 bits (633), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 158/493 (32%), Positives = 244/493 (49%), Gaps = 22/493 (4%)

Query: 90  DIDATG---VVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIF 146
           D+DA G      E ++K+ +  RH                     + N GP G  I Y  
Sbjct: 64  DVDAEGQPVAPRETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAI 123

Query: 147 MGTLVFSVTQSLGEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSV 205
           MG+ ++ + Q+ GEMA ++  ++ +F  + S  +    G +  ++Y   W     LEL  
Sbjct: 124 MGSCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVT 183

Query: 206 VGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLC 265
               I++WT  V    ++ IF+VL V++N F  + Y E EF+  + KV+ I GF I  + 
Sbjct: 184 ATITIKYWTTAVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGII 243

Query: 266 MVCG-AGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGIT 324
           + CG AG  G +G +YW  PG      +   K    F G +++++ AAF +  TE + +T
Sbjct: 244 VNCGGAGNDGYLGGKYWHDPGA-----LYGTKPIHHFKGIIATMVTAAFAFGATEFIALT 298

Query: 325 AGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYN-DPKLSSTDSYVSASPFIIA 383
           A E ANPR+++P A KK+  R               VPYN D  + S  S   ASP++IA
Sbjct: 299 AAEQANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIA 358

Query: 384 IQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFI 442
           I + G KV+PH  NAVIL +++S  NS  Y  SR+L  LS    AP +     R G P  
Sbjct: 359 IASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIR 418

Query: 443 AVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSR 502
           A+L +  FG +A++  S   +  F WLL I+G++  F W+ I +SHIRF + L  +G S 
Sbjct: 419 AMLVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSL 478

Query: 503 DDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIY 558
            +L YK+      +YY    +  ++  Q + A AP    K D+  F   Y++      + 
Sbjct: 479 GELGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLA------MP 532

Query: 559 IVAQCYFRTRLWR 571
           I+   YF  R+W+
Sbjct: 533 ILIALYFGYRVWK 545

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  248 bits (633), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 154/487 (31%), Positives = 239/487 (49%), Gaps = 18/487 (3%)

Query: 89  EDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMG 148
            D +AT    + ++K+ +K RH                     +   GP G +I Y+   
Sbjct: 67  NDYNAT----QKKMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTS 122

Query: 149 TLVFSVTQSLGEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           T+++ V Q+  E+  ++  +  ++  + S  V   F  A  ++Y   WAI   LEL    
Sbjct: 123 TMLYCVIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSS 182

Query: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
             I++W   +    +++IF+  IV ++FF  + Y E EF   S KV+ ++GFII  + + 
Sbjct: 183 MTIKYWNDSINPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVN 242

Query: 268 CGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGE 327
           CGA  +G +G +YW  PG +       +K    F G  S  + +AF Y G+E + +TA E
Sbjct: 243 CGASKSGYIGGKYWHTPGAF-----VGEKAIDHFKGICSVWVQSAFAYGGSEFIALTAAE 297

Query: 328 AANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL--SSTDSYVSASPFIIAIQ 385
             NPRKSVP+A K+   R               VPY+ P L  S   +   ASPF+IA  
Sbjct: 298 QTNPRKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHASPFVIAAA 357

Query: 386 NSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAV 444
           + G KV+PHI NAVIL ++IS  NS  Y   RIL  L+   + PK F    R G P + +
Sbjct: 358 SHGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTM 417

Query: 445 LFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDD 504
           LF A FG ++++  S   +  F WL  I  ++  F W +IS+SHIRF   +K +G S  +
Sbjct: 418 LFVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGE 477

Query: 505 LPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISCFLFLFIYI 559
           L YKA      ++Y   F  +++  Q + A AP     K D   F   Y++  + +F Y 
Sbjct: 478 LGYKANTGYWGSWYAIAFNIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYF 537

Query: 560 VAQCYFR 566
             + ++R
Sbjct: 538 GYKLWYR 544

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  248 bits (633), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 163/561 (29%), Positives = 261/561 (46%), Gaps = 24/561 (4%)

Query: 17  SLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKSDEDATLTKASKRHVRX 76
           +LE   ++  + K   ++      + + L  ++ S       +S +D  + +    +   
Sbjct: 2   ALENSLSNEGENKQNSEIYEFTTFEPKALDSYKSSSFRTFTKQSKDDDDIAEGHSSYQPP 61

Query: 77  XXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAG 136
                      +  +D  G      +KR LK RH                     + + G
Sbjct: 62  RNIFQRCIDSFKPPLD--GSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGG 119

Query: 137 PVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWA 196
           P+  +I +   GT +      LGE+    PV  +F  +++RF+          +Y   W 
Sbjct: 120 PLALIIGWSIAGTQIVGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWF 179

Query: 197 ITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAI 256
               LE+      I++W   +    W++IF+ +IV +N F  + +GE EF  +SIKVI I
Sbjct: 180 FVLPLEIIASAMTIQYWNQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITI 239

Query: 257 IGFIIYCLCMVCGAGITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY 315
           IGFII C+ ++CG G     VG RYW  PG    G          F G +S L+ A+++ 
Sbjct: 240 IGFIILCIVLICGGGPDHDFVGARYWHDPGCLSHG----------FPGVLSVLVVASYSL 289

Query: 316 QGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYV 375
            GTE+V + +GE  NPR+ +P AIK+   R               VPY +P L    S V
Sbjct: 290 GGTEMVCLASGE-TNPRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSS-V 346

Query: 376 SASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK- 434
           + SPF+IAI+    K LP I NAVIL +I+S  NS ++  SR L  ++   L PKFF   
Sbjct: 347 NNSPFVIAIKLHHIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYI 406

Query: 435 TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQT 494
            R G P   +L  + FG LA++  S+     F+WL+ I G+A    WLSI+ISHIRF   
Sbjct: 407 DRAGRPLTGILTNSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLA 466

Query: 495 LKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP-------KFDSTAFLTA 547
           +K +G S D+L + +A+    + Y A   +LI++ Q + A  P          +  F  +
Sbjct: 467 MKAQGKSLDELEFVSAVGMWGSAYSALINSLILIAQFYCALWPIGGWKDSSERAKTFFQS 526

Query: 548 YISCFLFLFIYIVAQCYFRTR 568
           Y+   +  F+++  + ++R +
Sbjct: 527 YLCALIMAFLFVCHKVFYRYK 547

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  248 bits (632), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 157/497 (31%), Positives = 248/497 (49%), Gaps = 19/497 (3%)

Query: 88  EEDIDATG---VVEE---AQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSL 141
           E++ID T    V +E     + ++L  RH                     + + GP   +
Sbjct: 58  EDNIDITSQSSVTKEDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLV 117

Query: 142 IAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFAL 201
           I ++ + T +F+V  SLGE+A   PV   F V+ +RFV   F  A    Y   W +   L
Sbjct: 118 IDWVIISTCLFTVINSLGELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPL 177

Query: 202 ELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFII 261
           EL      I++W   +   AW++IF+ +I + N   VK +GE EF ++ +K++AIIGF I
Sbjct: 178 ELVAASITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTI 237

Query: 262 YCLCMVC-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTEL 320
             + + C G    G +G +YW +PG +         +  +F G  S  + AAF+Y G E+
Sbjct: 238 LGIVLSCGGGPKGGYLGGKYWHNPGAF-----VGHTSGTKFKGLCSVFVTAAFSYSGIEM 292

Query: 321 VGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYV--SAS 378
             ++A E+ +PRK++P+A K+                   VPY+DP+L S  S V  +AS
Sbjct: 293 TAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAAS 352

Query: 379 PFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RN 437
           P +IAI+N G K L  + NA+IL +IIS ANS VY  SR +  ++     PK   K  + 
Sbjct: 353 PLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKR 412

Query: 438 GVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKH 497
           G P  A L T  FG L+++  S      F WL  ++G++  F W++I+ISHIRF Q +  
Sbjct: 413 GRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIK 472

Query: 498 RGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFL 553
           +  S D++PY +      + YG   + L+++   +T+  P      D  +F   Y+S  +
Sbjct: 473 QNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPI 532

Query: 554 FLFIYIVAQCYFRTRLW 570
            +  YI  + YF+   W
Sbjct: 533 LIVCYIGHKLYFKNWSW 549

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  247 bits (630), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 156/497 (31%), Positives = 244/497 (49%), Gaps = 23/497 (4%)

Query: 88  EEDIDATGVVEEAQV--------KRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVG 139
            ED   +G +E+ ++        ++ ++ RH                     +   GP G
Sbjct: 41  REDTSRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAG 100

Query: 140 SLIAYIFMGTLVFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAIT 198
            LI Y+ +  + + +  + GEMA   P +  +F  ++S F+S PFG A  +++   W   
Sbjct: 101 LLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTV 160

Query: 199 FALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIG 258
           F LEL     VI++W   V    ++ IF++ I+ ++FF  + YGE EF     KV+ I+G
Sbjct: 161 FPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVG 220

Query: 259 FIIYCLCMVCGA-GITGPVGFRYWRHPGPWGPGI-ISKDKNEARFLGWVSSLINAAFTYQ 316
           F+I  + +  GA G TG +G RYWR+PG +  G  + K K  A        L+ A F++ 
Sbjct: 221 FVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYV------LVTAYFSFG 274

Query: 317 GTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSY-V 375
           G EL  ++  E  NP+ ++P A KK   R               VP++  +L  + S  V
Sbjct: 275 GMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDV 334

Query: 376 SASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK- 434
             SP+++AI+  G KVLPHI NAVIL ++IS  NS +Y   R+L  L+    APK     
Sbjct: 335 HPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYI 394

Query: 435 TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQT 494
            R G P I+++  A FG +A+   S   +  F WL  I G++  F W SI +SH RF Q 
Sbjct: 395 DREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQA 454

Query: 495 LKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYIS 550
           +K +G S + L Y+A      + Y  FF  L+ + Q + A  P    K D  +F   Y++
Sbjct: 455 MKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMA 514

Query: 551 CFLFLFIYIVAQCYFRT 567
             L+L +++    Y R 
Sbjct: 515 FPLWLIMFLGYMVYSRN 531

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  247 bits (630), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 180/567 (31%), Positives = 273/567 (48%), Gaps = 49/567 (8%)

Query: 2   DNKDNASIELHSYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKSD 61
           + K + SI+  +  ES E  E +S+  +  D    E  R  RF    + ++ +      D
Sbjct: 4   EKKLDYSIDQETQLESGEFHEQNSYVSQ-SDASPVEGTRWERFRDSFKRADTQ------D 56

Query: 62  EDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXX 121
            D  LT A K  +                     +   A +KR LK RH           
Sbjct: 57  LDPNLTDAEKMAI---------------------LTANAPLKRTLKSRHLQMIAIGGAIG 95

Query: 122 XXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSD 181
                     +  AGP G LI +   GT+++ +  ++GE+A   P+   FT +ASRFV +
Sbjct: 96  TGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGELAVTFPIAGGFTTYASRFVDE 155

Query: 182 PFGAACGYMYWFSWAITFALELSVVGQVIEFW-TFKVPLAAWISIFWVLIVIMNFFPVKV 240
            FG A   +Y   W +   LE+      + +W T       ++++F+V+IV +NFF VK 
Sbjct: 156 SFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRDGFVALFYVVIVAINFFGVKG 215

Query: 241 YGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITGPVGFRYWRHPGPWGPGIISKDKNEA 299
           YGE EF  + IKVI +IG+II  + +VC G    G +G R W +PG +  G         
Sbjct: 216 YGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGRLWHNPGAFANG--------- 266

Query: 300 RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXX 359
            F G  S  + AAF++ G+ELVG+ A E ANPRKS+P A K+V  R              
Sbjct: 267 -FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWRITLFYILALLMVGL 325

Query: 360 XVPYNDPKL---SSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGS 416
            VPY   +L   SS D+  +ASPF+I+IQN+G K LP + N VIL  ++S  NS V+  S
Sbjct: 326 LVPYTSDRLIGQSSVDA--AASPFVISIQNAGIKGLPSVINVVILIAVLSVGNSAVFACS 383

Query: 417 RILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGV 475
           R +  L++    PK F    R G P + ++ T  FG L+++  S      F+WLL ++G+
Sbjct: 384 RSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDWLLALSGL 443

Query: 476 AGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAF 535
           +  F W  I + HIR  + L  +  +  +L + A      + YG   + LI++ Q + A 
Sbjct: 444 SSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILILMAQFWIAL 503

Query: 536 APKFD---STAFLTAYISCFLFLFIYI 559
            P  D   ++AF  AY+S  + +  YI
Sbjct: 504 FPIGDKPSASAFFEAYLSFPILIAFYI 530

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  249 bits (635), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 156/483 (32%), Positives = 247/483 (51%), Gaps = 23/483 (4%)

Query: 101 QVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160
           ++K+ +KPRH                     +  AGP G +I +  MG+ ++ + Q++GE
Sbjct: 157 ELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQAVGE 216

Query: 161 MAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPL 219
           +A  +  +   F  + S  V + F  A  ++Y   W     LEL      I++WT KV  
Sbjct: 217 LAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTKVDP 276

Query: 220 AAWISIFWVLIVIMNFFPVKV-YGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGPVG 277
             ++ IF++LI+ +N       Y E EF   S K++ +IGF I  + ++CG AG  G +G
Sbjct: 277 DIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDGYIG 336

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
            +YW  PG      +  D +  RF G +++L+NAAF +  +E +G+TA E +NPRK++P 
Sbjct: 337 AKYWHDPGA-----LRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPS 391

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYN-DPKLSSTDSYVSASPFIIAIQNSGTKVLPHIF 396
           A KK+  R               VPYN D  L ST S V ASP+++AI   G +V+PH  
Sbjct: 392 AAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVPHFI 451

Query: 397 NAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAY 455
           NAVIL +++S ANS  Y  SR+L  L+    APK +    R G P + +   A FG +A+
Sbjct: 452 NAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVIAF 511

Query: 456 METSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGL 515
             TS      F WLL I+G++  F W++I ISHIRF + +  +G S  +L +++ +    
Sbjct: 512 CATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGWYG 571

Query: 516 AYYGAFFVTLIILIQGFTAFAP-------KFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568
           + Y A  + +I++ Q + A  P       K D+  F   Y++  + L        YF  +
Sbjct: 572 SAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAF------YFGYK 625

Query: 569 LWR 571
           +W+
Sbjct: 626 IWK 628

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  248 bits (632), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 161/563 (28%), Positives = 273/563 (48%), Gaps = 30/563 (5%)

Query: 19  ETQEASSWDKKLKDKVRNEW-------ARDRRFLHRHRGSEGEVEYAKSDEDATLTKASK 71
           ++ + SS ++ L    R +W          +RF+   + +E   E  K  E    T  S 
Sbjct: 47  KSTDQSSSNEDLSYAGRKKWYELGVKEPHLKRFIDSFKRAEEGTEETKHMETELTTTLSP 106

Query: 72  RHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXP 131
                           E D+  T   E+A +++ ++PRH                     
Sbjct: 107 ----------LSAAIKEHDVAITSKEEDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSA 156

Query: 132 IQNAGPVGSLIAYIFMGTLVFSVTQSLGEMA-TFIPVTSSFTVFASRFVSDPFGAACGYM 190
           +  AGP G +I Y  MGT ++ + Q+ GEMA ++  +  +F  + +  V + FG A  ++
Sbjct: 157 LHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWV 216

Query: 191 YWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVAS 250
           Y   W     LEL      I++WT KV    ++ IF+VLI+++N F  K Y E +F+  +
Sbjct: 217 YCIQWLCVMPLELVTASMTIDYWTTKVNNDIFVVIFYVLIILINVFGAKGYAEADFFFNT 276

Query: 251 IKVIAIIGFIIYCLCM-VCGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLI 309
            KV+ I GF I  + +   GAG +G +G +YW  PG +       D++  RF   +++  
Sbjct: 277 CKVLMITGFFILAIIINAGGAGTSGYIGAKYWHDPGAF-----RGDRSIDRFKDVMATFT 331

Query: 310 NAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLS 369
            AAF +  +E + I A E +NPR+++P A K +  R               VPY+  +L 
Sbjct: 332 TAAFAFGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELM 391

Query: 370 STDS-YVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLA 428
            + S    ASP+++AI + G +V+PH  NAVIL  ++S +NS  Y   RIL+ LS    A
Sbjct: 392 GSGSGGTKASPYVLAISSHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYA 451

Query: 429 PKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISIS 487
           P++F    R G P  A++ +  FG +A+   S+  +  F WLL I+G++  F W++I +S
Sbjct: 452 PQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLS 511

Query: 488 HIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP----KFDSTA 543
           HIRF + +  +G S  +L +++ L    + Y A  + L ++ + + + AP      D+ +
Sbjct: 512 HIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKS 571

Query: 544 FLTAYISCFLFLFIYIVAQCYFR 566
           F   Y++  + +  Y   + Y R
Sbjct: 572 FFENYLAMPILIVFYFGYKIYNR 594

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  246 bits (629), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 152/459 (33%), Positives = 227/459 (49%), Gaps = 14/459 (3%)

Query: 88  EEDIDATG-----VVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLI 142
           + D++  G     V  +  +K+ +K RH                     +   GP   +I
Sbjct: 72  DSDVERNGDAAYSVNTDTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVI 131

Query: 143 AYIFMGTLVFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFAL 201
            Y  +  + + + Q+ GEMA   P +  +F  +AS FVS PFG A  +++   W     L
Sbjct: 132 GYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPL 191

Query: 202 ELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFII 261
           EL     +I++WT KV    ++ IF+V ++ ++F  VK YGE EF     K++ I GFII
Sbjct: 192 ELITASLIIKYWTEKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFII 251

Query: 262 YCLCMVC-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTEL 320
           + + + C GAG  G +G +YW  PG +     +      RF G    L++  F+Y GTEL
Sbjct: 252 FSIVVNCGGAGHDGYIGGKYWHSPGAF-----AGTNAAERFKGVCYVLVSGYFSYGGTEL 306

Query: 321 VGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASP 379
             ++  E  NPRKS P A K+   R               VP+ND +L  +  S   ASP
Sbjct: 307 YVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHASP 366

Query: 380 FIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNG 438
           +++A    G +V+PHI NAVIL  +IS ANS++Y   R+L  L+    APKF     R G
Sbjct: 367 YVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREG 426

Query: 439 VPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHR 498
            P  A+L  A FG +A+   S   +  F WL  I G++  F W SI +SH+RF Q +K +
Sbjct: 427 RPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQ 486

Query: 499 GMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP 537
           G   +++ Y A      + YG  F  L+ + Q + A AP
Sbjct: 487 GRDLNEVGYIANTGYWGSVYGVVFNILVFIAQFWVALAP 525

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  245 bits (626), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 153/481 (31%), Positives = 242/481 (50%), Gaps = 8/481 (1%)

Query: 97  VEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQ 156
           +EE   +R+L PR                      I + GP   LIA+     +   ++Q
Sbjct: 40  LEERIARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQ 99

Query: 157 SLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
            +  M T++PVT SF  F  RFV    G + G+ Y+   A     E++ V  V+EFWT K
Sbjct: 100 CMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTDK 159

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPV 276
           +P AA ISI   L   +N F V ++GE EF+++  KVI  IG I + + ++ G      V
Sbjct: 160 IPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHKV 219

Query: 277 -GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
            GF+ W +PG +    ISK  +  +F G++S LI A + + G + +G  A EA NPRK +
Sbjct: 220 LGFKNWSNPGAFAE-YISKG-SAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKVI 277

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSY----VSASPFIIAIQNSGTKV 391
           P + +KV  R               VP+ND  +    S       ASP++ A++  G  V
Sbjct: 278 PSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIGV 337

Query: 392 LPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRNGVPFIAVLFTAAFG 451
           LPHI N +ILT+IISA NS++Y  SR+L+ L+    APK F+ T+ GVP    +      
Sbjct: 338 LPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLFKITKRGVPIYCCVAVLLVC 397

Query: 452 ALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAAL 511
            LAY+  S    N   W LN+   A    ++ I IS+++F +  K + +    LPY ++ 
Sbjct: 398 GLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSSSF 457

Query: 512 MPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLW 570
           +P L ++  F++ L++ + G+  F    +D  +F+ +Y     F+ ++   + Y +TR  
Sbjct: 458 LPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTRFV 517

Query: 571 R 571
           +
Sbjct: 518 K 518

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  247 bits (630), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 153/481 (31%), Positives = 249/481 (51%), Gaps = 15/481 (3%)

Query: 96  VVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVT 155
           V+++ ++KR++  RH                     + +AGP G LI Y  MGT V+ V 
Sbjct: 111 VIKKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVI 170

Query: 156 QSLGEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
           Q+ GE+  T+  +   F  + +  V+  F  + G++Y   W     LEL      I++WT
Sbjct: 171 QAAGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWT 230

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGIT 273
            KV    ++ IF++LI+++NFF  K Y E +F+   +K+  I GF I  + + C GAG  
Sbjct: 231 TKVDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHD 290

Query: 274 GPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
           G +G +YW +PG +       +K    F G  S  + +AF + G+E V ++A E ANPRK
Sbjct: 291 GYLGGKYWHNPGAF-----RGEKAIDHFKGVSSVFVTSAFAFGGSEFVALSASEQANPRK 345

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLP 393
           S+P A K +  R               VP++ P+L  +      SP+++AI   G KV+P
Sbjct: 346 SIPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQPSSDGKKTSPYVVAIAMHGVKVVP 405

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGA 452
           H+ NAVIL  ++S +NS  +  SR+L  LS    APK+F    R G P  A+L +A FG 
Sbjct: 406 HLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGV 465

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           + +  TS    + F+WLL I+G++  F + SI +SHIR    +K +G S  +L +++ + 
Sbjct: 466 ICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVG 525

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISC---FLFLFIYIVAQCYF 565
              ++Y    + L ++ + + A AP    K D+ +F   Y++     +F F Y++ +  F
Sbjct: 526 TYGSFYACLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDF 585

Query: 566 R 566
           R
Sbjct: 586 R 586

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  246 bits (629), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 150/490 (30%), Positives = 246/490 (50%), Gaps = 18/490 (3%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           EE I+  G   + ++K+ L  RH                     +   GP G + +Y+ +
Sbjct: 90  EELINEDG--RKNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLII 147

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTV-----FASRFVSDPFGAACGYMYWFSWAITFALE 202
            T+V+ +   LGEM  ++P   S +         R++ D    A G+ Y++ + +  A E
Sbjct: 148 STMVYPIMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAE 207

Query: 203 LSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIY 262
            +    V+E+WT  VP  AWI +F ++I  +N  PV+VYGE EFW A  K++ I+G II 
Sbjct: 208 CTAASGVVEYWTKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIIL 267

Query: 263 CLCMVCGAGITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-QGTEL 320
              +  G G     +GFRYW  PG +   I   + +   FL     +I  AF++  G EL
Sbjct: 268 SFILFWGGGPNHDRLGFRYWITPGSFANTI--TNGSFGNFLDVYKGIILGAFSFILGPEL 325

Query: 321 VGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSST----DSYVS 376
           V + + E ++PR+++ +A K+   R               V YNDP LS+          
Sbjct: 326 VVLPSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAG 385

Query: 377 ASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-T 435
           +SPF+I IQN+G  VLPHI N  IL +  S+ N+ ++  SR L  ++    APK   K  
Sbjct: 386 SSPFVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKIN 445

Query: 436 RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTL 495
           R GVP++AV+ +     +AY+  S    + F W  N++ ++GF  W+ +S++++RF + +
Sbjct: 446 RFGVPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAI 505

Query: 496 KHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPK-FDSTAFLTAYISCFLF 554
           ++ GM +D LPY     P L  Y      +I +  GF    P+ ++ + F+ AY++  +F
Sbjct: 506 EYHGM-KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIF 564

Query: 555 LFIYIVAQCY 564
           L I+I  + Y
Sbjct: 565 LMIWIGHKFY 574

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  246 bits (627), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 167/475 (35%), Positives = 249/475 (52%), Gaps = 16/475 (3%)

Query: 102 VKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEM 161
           +KR LK RH                     ++ AGP G LI +   GT+++ +  ++GE+
Sbjct: 77  LKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAMGEL 136

Query: 162 ATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFW-TFKVPLA 220
           A   PV+  FT +A+RF+ + FG A  + Y   W +   LE+      + +W T      
Sbjct: 137 AVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 196

Query: 221 AWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPVGFR- 279
            ++++F+V+IV +N F VK YGE EF  + IKVI +IGFII  + +VCG G  G      
Sbjct: 197 GFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYIGGA 256

Query: 280 YWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 339
            W +PG +      K     RF G  S  + AAF++ G+ELVG+ + E ANPRKS+PRA 
Sbjct: 257 NWHNPGAFVGNTAGK-----RFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPRAA 311

Query: 340 KKVSVRXXXXXXXXXXXXXXXVPYNDPKL---SSTDSYVSASPFIIAIQNSGTKVLPHIF 396
           K+V  R               VPYND +L   SS D+  +ASPF++AI+N G K LP + 
Sbjct: 312 KQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDA--AASPFVLAIKNHGIKGLPSVV 369

Query: 397 NAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAY 455
           N VIL  ++S  NS V+  SR L  L+     PK F    R G P + + FT+ FG L++
Sbjct: 370 NVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLSF 429

Query: 456 METSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGL 515
           +  S      F+WLL ++G++  F W++I I H+RF + L  +G S D+L + +      
Sbjct: 430 IAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPAGVWG 489

Query: 516 AYYGAFFVTLIILIQGFTAFAP---KFDSTAFLTAYISCFLFLFIYIVAQCYFRT 567
           + YG   + LI+  Q + A  P     D+  F  +Y+S  + L +YI  +CY R 
Sbjct: 490 SIYGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHKCYKRN 544

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  246 bits (627), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 166/578 (28%), Positives = 267/578 (46%), Gaps = 50/578 (8%)

Query: 2   DNKDNASIELHSYHESLET--QEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAK 59
           D+ D+A   L S      +  QE ++WD    ++ RN W R   F++  + +E     + 
Sbjct: 14  DSDDSAQPVLSSVKSESGSIGQEWNAWD----NENRNAWGR---FVNSFKRAEKHSTPSN 66

Query: 60  SDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXX 119
            D +   T +                          V   + +KR +KPRH         
Sbjct: 67  GDLEHATTHS--------------------------VASSSPLKRSIKPRHVAMMSICTG 100

Query: 120 XXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIP-VTSSFTVFASRF 178
                       ++  GP G +I Y  +  + + + Q+ GEMA   P +  +F  ++S+ 
Sbjct: 101 IGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQL 160

Query: 179 VSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPV 238
           +S PFG A  ++Y   W     LEL      I++W   +    +I+IF+V I+ ++FF  
Sbjct: 161 ISRPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGS 220

Query: 239 KVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITGPVGFRYWRHPGPWGPGIISKDKN 297
           + YGE EF     KV+ IIGF+I  + + C GAG    +G +YW  PG +  G       
Sbjct: 221 RGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVG-----SG 275

Query: 298 EARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXX 357
             +F G    L+   F+Y GTEL  +T  E +NPR+++    K+   R            
Sbjct: 276 ATKFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILI 335

Query: 358 XXXVPYNDPKL--SSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVG 415
              VP+   +L  SS  S   ASP+++A+   G K++PHI NAVIL  +IS  NS +Y G
Sbjct: 336 GFLVPHTSSELMGSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSG 395

Query: 416 SRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITG 474
            RIL  L+    AP+F     R G P +A++  + FG LA++  S   ++ F WL  I G
Sbjct: 396 PRILNTLAEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAG 455

Query: 475 VAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTA 534
           ++  F W +I +SH+RF Q +++      +L YKA      +  G  F  L+ + Q + +
Sbjct: 456 LSELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVS 515

Query: 535 FAP-----KFDSTAFLTAYISCFLFLFIYIVAQCYFRT 567
            AP     K D  +F  +Y++  L++ ++      FR 
Sbjct: 516 IAPFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMIVFRN 553

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  246 bits (628), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 166/589 (28%), Positives = 270/589 (45%), Gaps = 19/589 (3%)

Query: 2   DNKDNASIELHSYHE------SLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGS---- 51
           D   +  I    YHE      S+    +    K     ++    RD   LH+ R +    
Sbjct: 7   DAGSSQRINHLPYHENAKIIISVAASFSVQVQKSQGSAIKESTQRDHPGLHKTRTTCFTI 66

Query: 52  EGEVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHX 111
             ++  +   E   L   S                 +     +  +EE   +R+L PR  
Sbjct: 67  VSQMSVSGKKEAFELNVTSLEEGETATIDDFVLQNRDSPKSQSLSLEERIARRKLLPRQV 126

Query: 112 XXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSF 171
                               I   GP   LIA+     +   +++ +  M T++PVT SF
Sbjct: 127 SMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSVVFIGLSKCMCVMVTYLPVTGSF 186

Query: 172 TVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIV 231
             F  RFV    G A G+ Y+   A     E++ V  V+E+WT K+P AA IS+  +L  
Sbjct: 187 VHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWTDKIPKAALISMLIILFG 246

Query: 232 IMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPV-GFRYWRHPGPWGPG 290
            +N + V  +GE EF+++  KV+  IG II+ + ++ G      V GF+ W +PG +   
Sbjct: 247 SLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGAFAEY 306

Query: 291 IISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXX 350
           I   D +  RF G++S L+ A + + G + +G  A EA NPRK +P + +KV  R     
Sbjct: 307 I--SDGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFY 364

Query: 351 XXXXXXXXXXVPYNDPKL----SSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIIS 406
                     +PYNDP +            ASP++ A++  G +VLPHI N +ILT+IIS
Sbjct: 365 IGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIRVLPHIVNILILTSIIS 424

Query: 407 AANSNVYVGSRILYGLSSAKLAPKFFQ-KTRNGVPFIAVLFTAAFGALAYMETSAGGQNA 465
           A NS++Y  SR+L+ L+    AP+ F+  T+ GVP    +       LAY+  S    N 
Sbjct: 425 AGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTNNV 484

Query: 466 FNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTL 525
             W LN+   A    ++ I +S+++F +    + +    LPY ++ +P LA++  F++ L
Sbjct: 485 LTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYSSSLPYLAWHSLFWLVL 544

Query: 526 IILIQGFTAFAP-KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTL 573
           ++L+ G+T F    +D+ +F+ +Y     FL      + Y  T+  R L
Sbjct: 545 MLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYKGTKSVRPL 593

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  243 bits (621), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 148/454 (32%), Positives = 227/454 (50%), Gaps = 16/454 (3%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
            + VKR LK RH                     +   GP+  L+ +  +G + FS+ +S+
Sbjct: 39  HSGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIMESI 98

Query: 159 GEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVP 218
           GE+ T  P    F   A RF S+   A  GY Y   +    A E + +  +++FW  +VP
Sbjct: 99  GELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIVVFFAVLANEYNTISSILQFWGPQVP 158

Query: 219 LAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG--PV 276
           +  +  IFW   ++     V  +GE E+W+A  K++ ++ F I+ +  + G GI G  P+
Sbjct: 159 IYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFYIFSIVYMSG-GIPGKPPI 217

Query: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336
           GF+YW++PG    G          F G     +  +  Y GTE V + A E+ NPRK+VP
Sbjct: 218 GFQYWKNPGALSHG----------FRGIAVVFVFCSTFYSGTESVALAATESRNPRKAVP 267

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIF 396
            A+++   R               VPYNDP L +    +  SP  IA+  +G     H+ 
Sbjct: 268 LAVRQTFWRILIVYLGISFFYGVTVPYNDPTLGAQTKSLK-SPISIALSRAGWAGGVHLV 326

Query: 397 NAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAY 455
           NA IL T ISA NS++Y+GSR L  L+   LAP+    T + GVP  A++   A G ++ 
Sbjct: 327 NAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPVPALIVFNALGLISL 386

Query: 456 METSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGL 515
           M  S G  NA+N+++N++GV  F  W +ISI+H+RF +    +G S  +LPY+A   P  
Sbjct: 387 MNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRSLSELPYRALFYPWT 446

Query: 516 AYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYI 549
             +       + LIQG+T+  P F +  F+ AYI
Sbjct: 447 TIFSLAANIFLALIQGWTSLVP-FVAKDFVDAYI 479

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  243 bits (621), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 149/480 (31%), Positives = 242/480 (50%), Gaps = 15/480 (3%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           +  ++K+ LK RH                     ++  GPVG LIAY+ +G +V     +
Sbjct: 42  DRTKLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIA 101

Query: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFAL----ELSVVGQVIEFW 213
           + E+A+F+P T +    + +F+ +  G      + F W  T++     ELS    V+ +W
Sbjct: 102 IAEVASFMPATGATIRHSEQFIDEAVG------FTFGWISTYSSLMPGELSATAVVMTYW 155

Query: 214 TFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT 273
           T   P A +I+IF VL ++ N + ++ YGE E++   +K+  I   II  L +  G    
Sbjct: 156 TDLSP-AIFITIFGVLFILTNIYTIRFYGEIEYFFGWLKLALIAILIITGLVIDLGGTKQ 214

Query: 274 GPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
             +GF YWR+PGP+   ++  D    +F+G+ ++L +  ++Y G + + I AGE  N R 
Sbjct: 215 ERLGFHYWRNPGPFAEYLVGGDT--GKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRH 272

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLP 393
           ++    K V VR               VPYND  +++      +SPF+IA++ +G KVLP
Sbjct: 273 AIFHGAKNVFVRIILLYLITVFVLTLIVPYNDKLIATGSGNARSSPFVIAMERAGIKVLP 332

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGA 452
           HI NA+ILT+  SA N  +  GSR L+ L++   APK F KT + G+P++ VLF ++F  
Sbjct: 333 HIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGVLFISSFLP 392

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           LAYM  S      F+W   +        W+ IS +HI   + L+ +G SR DLPY   + 
Sbjct: 393 LAYMSCSESSATVFSWFQELVSSNTLLRWILISANHIHMDRALRAQGYSRKDLPYSTTIA 452

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAP-KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571
           P  A++      + +L  GF  F    FD  +F + Y    L + ++   + + +TR  R
Sbjct: 453 PYAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSRYFIIPLAIALFTFWKLFKKTRYLR 512

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  246 bits (627), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 149/482 (30%), Positives = 249/482 (51%), Gaps = 15/482 (3%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           E + +K+ +K RH                     +++AGP G +I Y  MG+ ++ + Q+
Sbjct: 113 ENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQA 172

Query: 158 LGEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
            GE+A  +  + S+F ++ +  V   FG A  ++Y   W     LEL      I++WT  
Sbjct: 173 CGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 232

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITGP 275
           V    ++SIF+VLI+++N F  + Y E EF+  S KV+ + GF I  + + C GAG +G 
Sbjct: 233 VNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGY 292

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +G +YW  PG +     + ++    F G +++   AAF +  +E + +TA E +NPRK++
Sbjct: 293 IGAKYWHSPGAF-----NGNRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSNPRKAI 347

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPK-LSSTDSYVSASPFIIAIQNSGTKVLPH 394
           P+A K +  R               VPYN P  L S      ASP+++A+ + G +V+PH
Sbjct: 348 PKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKASPYVVAVASHGVRVVPH 407

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGAL 453
             NAVIL +++S  NS  Y  SR+L  L+    APK F    + G P +A++ +  F  +
Sbjct: 408 FINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLFMTI 467

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           A+   S   +  F WLL I+G++  F W++I ISH+RF + LK +G S  ++ +K+ +  
Sbjct: 468 AFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQVGI 527

Query: 514 GLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRL 569
             + Y A  + L ++ Q + A AP      D+  F   Y++  + L +Y   +   R R 
Sbjct: 528 YGSLYAATMLILALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGYK--IRKRD 585

Query: 570 WR 571
           W+
Sbjct: 586 WK 587

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  245 bits (626), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 157/535 (29%), Positives = 266/535 (49%), Gaps = 33/535 (6%)

Query: 42  RRFLHRHRGSEGEVEYAKSDED---ATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVE 98
           R+F+   R +E + E A+  E+   +TL+ +  + +             +++ D     +
Sbjct: 72  RKFVDSFRRAEDDEETAEDLENELVSTLSPSKSKQLHG-----------QKNGD-----D 115

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
           +A +++ ++PRH                     +  AGP   +I Y  MG+ ++ + Q+ 
Sbjct: 116 DAHLQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQAC 175

Query: 159 GEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217
           GEMA  +  +  +F  + S  V +       ++Y   W     LEL      I++WT KV
Sbjct: 176 GEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTKV 235

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM-VCGAGITGPV 276
               ++ IF+VLI ++N F  K Y E EF+  S KV+ + GF I  + +   GAG  G +
Sbjct: 236 NSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYI 295

Query: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336
           G +YW +PG +       DK+  RF   +S+   AAF +  +E + I A E +NPR+++P
Sbjct: 296 GAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIP 350

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL--SSTDSYVSASPFIIAIQNSGTKVLPH 394
            A K +  R               VPY+  +L  S   +   ASP++IA+ + G +V+PH
Sbjct: 351 SAAKTMIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPH 410

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGAL 453
             NAVIL +++S ANS  Y   RILY L+    APK+F+   R G P  A+L T  FG +
Sbjct: 411 FINAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVI 470

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           A+   S   ++ F WLL+I G++  F W +I +SHIRF + +K +G S D++ +K+ +  
Sbjct: 471 AFCSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGV 530

Query: 514 GLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCY 564
             + Y A  + L ++ + + + AP      D+  F   Y++  + + +Y   + Y
Sbjct: 531 WGSGYAAIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIY 585

>SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance"
          Length = 551

 Score =  243 bits (619), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 166/485 (34%), Positives = 248/485 (51%), Gaps = 34/485 (7%)

Query: 89  EDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMG 148
           E +     V E  + R L PRH                     +   GP   LI Y  +G
Sbjct: 35  EGLTTDNNVRE-HLNRSLSPRHVNMIAIAGVIGTGLYLGTGRALHLGGPASLLINYSIIG 93

Query: 149 TLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQ 208
            +V++   SLGEM+T++P++ SF  FA +F S+ F  A    YWF+ A++ A +L+ +  
Sbjct: 94  LIVYATLLSLGEMSTYMPISGSFCSFAKKFGSESFAFALMCNYWFNDAVSVASDLTALQL 153

Query: 209 VIEFW-TFKVPLAAWIS--IFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLC 265
           V+++W T +     WI+  IFWV ++ +N   VK+YGE E+W+A +KVIAII  I + L 
Sbjct: 154 VLDYWKTSESGFPYWIASLIFWVFLLFLNVIHVKIYGEAEYWLAMLKVIAII--IFFILS 211

Query: 266 MVCGAGITGP---VGFRYW-RHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELV 321
           +V   G       +GFR W R   P+  G          F G+ +  ++A+F Y GTE +
Sbjct: 212 IVANVGHNEQHEYIGFRNWTRGDAPFVNG----------FRGFATLFVSASFAYGGTESI 261

Query: 322 GITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFI 381
            +T+GE  NP ++ P+ IK V  R               VPY+ P LS  +  V  SPF 
Sbjct: 262 TLTSGETKNPVRNTPKVIKTVFWRILIFYIFTVFFIGMNVPYDYPNLS--EKSVMTSPFT 319

Query: 382 IAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLS-SAKLAPKFFQKTR-NGV 439
           I  Q  G+K      NAVILT+++SA N  ++ GSRIL+ L       PK   +T    V
Sbjct: 320 IVFQMVGSKAAGSFMNAVILTSVVSACNHALFAGSRILFNLGLEGYFFPKLVTRTNWYQV 379

Query: 440 PFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRG 499
           P++AVL T A G L +  +  G    + WL N+ GV+   AWLSI +  IRF      RG
Sbjct: 380 PYVAVLVTWAVGGLCFGSSFIGAGTLWIWLQNLVGVSNQIAWLSIGVISIRF-----RRG 434

Query: 500 MSRDDLPYKAALMPGLAYYGAFF----VTLIILIQGFTAFAPKFDSTAFLTAYISCFLFL 555
           +SR    ++   +     YG +F    V+ IIL+QG+++ +P  D T+F + Y+  F+FL
Sbjct: 435 LSRQGKTHELKFVNWTYPYGPYFVIISVSFIILVQGWSSSSP-MDVTSFFSYYVELFIFL 493

Query: 556 FIYIV 560
             ++V
Sbjct: 494 ACWLV 498

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  244 bits (622), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 152/481 (31%), Positives = 243/481 (50%), Gaps = 20/481 (4%)

Query: 100 AQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLG 159
           A +KR++KPRH                     +   GP G  I Y  MG+ ++S+ Q+ G
Sbjct: 100 ASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAG 159

Query: 160 EMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVP 218
           E+A   P +T +F  + S  V      A   +Y   W   F LE+      I++W   + 
Sbjct: 160 ELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTSIN 219

Query: 219 LAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGPVG 277
              W  IF+V+I+ +N      Y E +F+  + K++   GF I  + + CG AG +  +G
Sbjct: 220 PNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIG 279

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
            +YW  PG +     + D   +RF   VS+L+ AAF +  +E V +TA E ANPRK++P 
Sbjct: 280 GKYWNDPGAF-----NGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPS 334

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAIQNSGTKVLPHIF 396
           A K+V  R               VPYN P+L  S  S V +SP++IA+ + G KV+P   
Sbjct: 335 AAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPSFI 394

Query: 397 NAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAY 455
           NAVIL +++S  N + Y  SRIL  LS    APKFFQ   R G P  A++  A  G + +
Sbjct: 395 NAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICF 454

Query: 456 METSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGL 515
           +  S+  ++ F WL+ ++G++  F W +I ISH+RF + ++ +  S  +L +++ +    
Sbjct: 455 VSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVWG 514

Query: 516 AYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLW 570
           +YYG F + L+ + Q + A  P       D+  F   Y++  +FL +      YF  ++W
Sbjct: 515 SYYGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLAL------YFGFKIW 568

Query: 571 R 571
           +
Sbjct: 569 K 569

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  241 bits (616), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 155/461 (33%), Positives = 228/461 (49%), Gaps = 14/461 (3%)

Query: 102 VKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEM 161
           VKR LK RH                     +   GP+  L+ +  +G + F+V +S+GEM
Sbjct: 44  VKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESIGEM 103

Query: 162 ATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAA 221
            T  P  S F+  + RF SD   A  GY Y   +    A E + +  +++FW  +VPL  
Sbjct: 104 ITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYG 163

Query: 222 WISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPV-GFRY 280
           +I IF V   +     V ++GEFE+W+A  K+I +I + I+ +  + G     P  GF Y
Sbjct: 164 YILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRPAFGFHY 223

Query: 281 WRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIK 340
           W +PG    G          F G     +  +  Y GTE V + A E+ NP K+VP AIK
Sbjct: 224 WNNPGALADG----------FKGIAVVFVFCSSFYSGTESVALAATESRNPGKAVPIAIK 273

Query: 341 KVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVI 400
           +   R               VPYND  L +    +  SP  IAI  +G +   H+ NA I
Sbjct: 274 QTFWRIIIVYLGIAVFYGATVPYNDTSLGAHTKALK-SPIAIAITRAGWEGGVHLVNAFI 332

Query: 401 LTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETS 459
           L T +SA N ++Y+GSR L  L+   LAPKF + T + GVP  A+    A G ++ M  S
Sbjct: 333 LITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNALGLVSLMNVS 392

Query: 460 AGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYG 519
            G  NA+++++N++GV  F  W  IS++H+RF +    +G S  +LPYK+ L P    + 
Sbjct: 393 VGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASELPYKSLLFPWGPIFS 452

Query: 520 AFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIV 560
                 + LIQG+T F P F +  F+ AYI     + +YIV
Sbjct: 453 LAANIFLGLIQGWTTFVP-FSAKDFVDAYILLPAAVILYIV 492

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  243 bits (620), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 150/487 (30%), Positives = 245/487 (50%), Gaps = 18/487 (3%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           +EDI+         + ++L  RH                     + + GP   +I ++ +
Sbjct: 85  KEDINE-------NLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVII 137

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
            T +F+V  +LGE+A   PV   F V+ +RFV      A    Y   W +   LEL    
Sbjct: 138 STCLFTVINALGELAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAAS 197

Query: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
             I++W   +   AW++IF+ +I + N   VK +GE EF ++ +K++AIIGF I  + + 
Sbjct: 198 ITIKYWNDTINSDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLA 257

Query: 268 C-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAG 326
           C G    G +G  YW  PG +       DK   +F G  S  + AAF+Y G EL  ++A 
Sbjct: 258 CGGGPQGGFLGGHYWHDPGSF-----VGDKPGTQFKGLCSVFVTAAFSYSGIELTAVSAA 312

Query: 327 EAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYV--SASPFIIAI 384
           E+ +PRK++P+A K+                   VP++DP+L +  S V  +ASP +I+I
Sbjct: 313 ESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAASPLVISI 372

Query: 385 QNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIA 443
           +N+G K L  + NA+IL +I+S ANS VY  SR +  ++     PK   +  + G P  A
Sbjct: 373 KNAGIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNA 432

Query: 444 VLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRD 503
           +L T  FG L+++  S      F WL  ++G++  F W++I+ SHIRF   +K +  + D
Sbjct: 433 ILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLD 492

Query: 504 DLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQC 563
           +LPY +      ++YG   + L+++   +T+  P    TA +T++   +L L I I   C
Sbjct: 493 ELPYLSQCGVIGSWYGVIVLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIA--C 550

Query: 564 YFRTRLW 570
           Y   +L+
Sbjct: 551 YVGHKLY 557

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  241 bits (616), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 164/489 (33%), Positives = 253/489 (51%), Gaps = 22/489 (4%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           +E+ D    + E  + R LKPR                      +   GP    + Y  M
Sbjct: 37  DENYDPEANIRE-DLTRALKPRVVNMISIAGIIGTGLYLSTSKSLHTGGPASLFMNYTIM 95

Query: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
           G +V+    +LGEM+T++P++ SF V+A +F S+ F  A  + YWF+ A++ A +L+ + 
Sbjct: 96  GGVVYLTLLALGEMSTYMPISGSFCVYARKFGSESFACALMWNYWFNDAVSVASDLTALQ 155

Query: 208 QVIEFWT---FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCL 264
            V+++W       P  A   IFW ++V +N   V+ YGE E+W+A +K+IAII F I  +
Sbjct: 156 LVMDYWKTSEHGFPYWAASLIFWFVVVCLNVIHVRFYGEAEYWLAMLKIIAIIIFFILSI 215

Query: 265 CMVCGAGITGP-VGFRYW-RHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVG 322
            +  G       +GF+ W R   P+  GI           G+ S  ++A+F Y GTE + 
Sbjct: 216 VVNVGKNPQHEYIGFKNWTRGEAPFVDGI----------KGFASLFVSASFAYGGTESIT 265

Query: 323 ITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFII 382
           +T GEA NP ++ P+ +K V  R               +PY+ P L S    +  SPF +
Sbjct: 266 LTNGEAENPIRNTPKIVKTVFWRILIFYVGSTFFIAMNIPYDYPGLDSKS--IVTSPFTL 323

Query: 383 AIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAP-KFFQKT-RNGVP 440
             Q +GTK      NAVI+T++ISA N  ++ GSRI+Y +      P +   +T RN VP
Sbjct: 324 VFQMAGTKGAGSFMNAVIMTSVISACNHALFAGSRIMYNMGLEGFLPARIVSRTNRNKVP 383

Query: 441 FIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGM 500
           +++VL TAA GAL +  +  G    + WL NI GV+   AWL I I+ IRF + L+ +G 
Sbjct: 384 YVSVLITAAVGALCFGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGK 443

Query: 501 SRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIV 560
           +  +L YK    P   Y+   FV+ IILIQG++AFAP ++ + F + Y+  F+F   +I+
Sbjct: 444 TH-ELIYKNWTYPYGPYFVIIFVSFIILIQGWSAFAP-WNVSNFFSYYLELFVFPVCFII 501

Query: 561 AQCYFRTRL 569
                R R 
Sbjct: 502 WWLVKRDRF 510

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  243 bits (620), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 160/477 (33%), Positives = 243/477 (50%), Gaps = 11/477 (2%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
           E  +K+ +KPRH                     +  AGP G +  Y  MGT V+ + QS 
Sbjct: 107 EDNLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSA 166

Query: 159 GEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217
           GEMA  +  +   F  + +  V   F   C     F+     +  +       ++WT +V
Sbjct: 167 GEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCLSFGIGYCFDDYKYWTTRV 226

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM-VCGAGITGPV 276
               ++ IF+VLI+++N F  + Y E EF+    KV+ + GF I  + + V GAG  G +
Sbjct: 227 DPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYL 286

Query: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336
           G  YWR+PG +       DK    F G V++L+ AAF + GTE + +TA E +NPRK++P
Sbjct: 287 GNIYWRNPGAF-----RGDKGIDHFKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKAIP 341

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAIQNSGTKVLPHI 395
            A KKV  R               VP+  P+L  S  +  +ASP++IA+ + G +V+PH 
Sbjct: 342 SAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATAASPYVIAVASHGVRVVPHF 401

Query: 396 FNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALA 454
            NAVIL +++S  NS  Y  SR+L  LS    APK+F    R G P  A++ +A FG +A
Sbjct: 402 INAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALFGVIA 461

Query: 455 YMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPG 514
           +  TS      F WLL I+G++  F W+SI +SHIRF   +K +G S  ++ +KA     
Sbjct: 462 FCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQTGIW 521

Query: 515 LAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571
            +YY  F + L ++ Q + A AP    TA L+A      +L + I+   YF  ++W+
Sbjct: 522 GSYYSIFLMILTLIGQFWVAIAPI--GTAELSARNFFENYLAMPILIGFYFGYKIWK 576

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  241 bits (614), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 152/483 (31%), Positives = 237/483 (49%), Gaps = 18/483 (3%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
           +  +K+ LK  H                     +   GP G  I+Y  M T+++ V  +L
Sbjct: 49  DHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNAL 108

Query: 159 GEMATFIP-------VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIE 211
            EM  F+P          S +   +R+V    G A G+ Y + + I  A E +    V+ 
Sbjct: 109 AEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVT 168

Query: 212 FWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAG 271
           +WT  VP AAWI+IF  +IV++N   V+ YG  E    S+K+  I+G II  + +  G G
Sbjct: 169 YWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGG 228

Query: 272 ITGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-QGTELVGITAGEAA 329
                +GFR+W+ PG W   +   D    R    ++ +I A F +  G ELV +T+ EA 
Sbjct: 229 PNHDRLGFRFWKDPGAWAYHL--ADGGAGRLSDIITGVIRAGFAFILGPELVVLTSTEAQ 286

Query: 330 NPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDP----KLSSTDSYVSASPFIIAIQ 385
           + R+++ +A ++   R               V  NDP     LS       +SPF+I IQ
Sbjct: 287 DSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQ 346

Query: 386 NSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAV 444
           N+G KVLPHI N  IL++  S+ NS +Y  +R L  LS    APK F +  R GVP+  V
Sbjct: 347 NAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGV 406

Query: 445 LFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDD 504
            F  AF  LAY+  S+   + FNW  NI+ ++GF  W+   ++++RF + +    +  D 
Sbjct: 407 AFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNL-YDR 465

Query: 505 LPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCY 564
           LP+K    P   ++    + +I LI G+ +F   ++   F+ AYI+  LFL +++  + Y
Sbjct: 466 LPFKTPFQPYFTWFYIILIAIICLINGYESFV-HWNYKDFIAAYITLPLFLILWLGHKAY 524

Query: 565 FRT 567
            RT
Sbjct: 525 TRT 527

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  241 bits (615), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 151/507 (29%), Positives = 238/507 (46%), Gaps = 37/507 (7%)

Query: 42  RRFLHRHRGSEGEVEYAKSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQ 101
           +R +   +  EGEV  +   ED  +T A                               +
Sbjct: 39  QRIVDSFKRVEGEVRNSSDLEDGEVTSA----------------------------HSTK 70

Query: 102 VKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEM 161
           +K+ +K RH                     +   GP G LI Y F+  + + + Q+ GEM
Sbjct: 71  LKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVSIISYIMMQAAGEM 130

Query: 162 ATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLA 220
           A   P +  +F  ++S F+S PFG A  +++   W     LEL     V+++WT K+   
Sbjct: 131 AVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWTTILPLELITSSIVVKYWTTKINAD 190

Query: 221 AWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGA-GITGPVGFR 279
            ++ IF++ I+ ++F   + YGE EF   S KV+ + GFII  + + CGA G  G +G +
Sbjct: 191 IFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGILINCGAVGDDGYIGGK 250

Query: 280 YWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAI 339
           YW  PG +  G         RF G    L+ A F+Y G EL  ++  E  NPRK++P A 
Sbjct: 251 YWHEPGAFAAG-----SGIDRFKGIAYVLVTAYFSYGGMELYALSVNELPNPRKAIPSAC 305

Query: 340 KKVSVRXXXXXXXXXXXXXXXVPYNDPK-LSSTDSYVSASPFIIAIQNSGTKVLPHIFNA 398
            K   R               VP++  K L S  S V  SP+++A+   G K++PHI NA
Sbjct: 306 AKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSSGVHPSPYVLALSLHGIKIVPHIINA 365

Query: 399 VILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYME 457
           VIL ++IS  NS +Y G R+L  L+    APK      R G P +A++  + FG +A++ 
Sbjct: 366 VILISVISVGNSAMYSGPRLLCSLAQQGYAPKILDYVDRQGRPLMALIICSVFGLIAFVA 425

Query: 458 TSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAY 517
            S   ++ F WL  I+G++  F W +I +SH RF + +K +G S + L Y++      + 
Sbjct: 426 ASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFRRAMKLQGRSLETLGYRSTTGEWGSL 485

Query: 518 YGAFFVTLIILIQGFTAFAPKFDSTAF 544
           Y   F   +++ Q + A  P  +   F
Sbjct: 486 YAVVFNVFVLIAQLWVAMIPMDNGGKF 512

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  241 bits (615), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 163/581 (28%), Positives = 274/581 (47%), Gaps = 41/581 (7%)

Query: 1   MDNKDNASIELHSYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKS 60
           M+++D+  I+      S      S +++   +K + ++A   +   +   SE +V+  K+
Sbjct: 1   MNDRDDLLID----EASTAPYSHSLYERANAEKQKRDFAITEK---QDEESEQQVKPQKT 53

Query: 61  DEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXX 120
              + L    K+ +             E +       E+  + + +K RH          
Sbjct: 54  GNKSKLQNECKKILSSFKRQLPPSQNSELESQ-----EKNNLTKSIKSRHLVMISLGTGI 108

Query: 121 XXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMA-TFIPVTSSFTVFASRFV 179
                      +  AGP G ++ Y     +++ + Q+ GE+   +  +T ++T + S  V
Sbjct: 109 GTGLLVGNGQVLGTAGPAGLVLGYGVASIMLYCIIQAAGELGLCYAGLTGNYTRYPSILV 168

Query: 180 SDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVK 239
               G A   +Y   W     L+L      +++WT  V    ++++ ++ ++I+N F  +
Sbjct: 169 DPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWT-SVNSDIFVAVVFIFVIIINLFGSR 227

Query: 240 VYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGPVGFRYWRHPGPWGPGIISKDKNE 298
            Y E EF     K++ +IGF+I  + + CG AG    +G  YW +PGP+  G        
Sbjct: 228 GYAEAEFIFNICKILMVIGFVILAIIINCGGAGDRKYIGTEYWHNPGPFAHG-------- 279

Query: 299 ARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXX 358
             F G  +    AAF+Y G E++ ++A E  NP KS+P A KKV  R             
Sbjct: 280 --FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILLIYMLTTILVC 337

Query: 359 XXVPYN-DPKLSSTDSYVS-ASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGS 416
             VPYN D  L S DS  S ASPF+IA+ + G KV+PH  NAVIL ++IS ANS++Y G 
Sbjct: 338 FLVPYNSDELLGSDDSSGSHASPFVIAVASHGVKVVPHFINAVILISVISVANSSLYSGP 397

Query: 417 RILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGV 475
           R+L  L+   + PK      R G P +  L + AFG + ++ TS   +  F WLL I+ +
Sbjct: 398 RLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSLAFGCIGFVATSDAEEEVFTWLLAISSL 457

Query: 476 AGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLI----ILIQG 531
           +  F W+S+S+SHIRF   +  +G S +++ YKA       Y+G++   LI    ++ Q 
Sbjct: 458 SQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQ----TGYWGSWLAVLIAVFFLVCQF 513

Query: 532 FTAFAP-----KFDSTAFLTAYISCFLFLFIYIVAQCYFRT 567
           + A AP     K +   F   Y++  + L  Y   + YF++
Sbjct: 514 WVAIAPVNDHGKLNVKVFFQNYLAMPIVLVAYFGHKIYFKS 554

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  240 bits (613), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 153/488 (31%), Positives = 238/488 (48%), Gaps = 31/488 (6%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           E   + R +K RH                     +  AGP G ++ Y     +++ + Q+
Sbjct: 86  ERNNLTRSIKSRHLIMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQA 145

Query: 158 LGEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
            GE+   +  +T ++T ++S  V    G A   +Y   W     L+L      I++WT  
Sbjct: 146 AGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTIKYWT-N 204

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGP 275
           V    +++  ++ ++I+N F  K Y E EF     K++ +IGF+I  + + CG AG    
Sbjct: 205 VNADIFVAAVFIFVIIINLFGSKGYAEAEFMFNICKILMVIGFVILAIVINCGGAGDRKF 264

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +G +YW +PGP+  G          F G  +    AAF+Y G E++ ++A E  NP KS+
Sbjct: 265 IGTKYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSI 314

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL--SSTDSYVSASPFIIAIQNSGTKVLP 393
           P A KKV  R               VPYN  +L  S + S   ASPF+IA+ + G KV+P
Sbjct: 315 PNACKKVVYRILFIYMLTTILICFLVPYNSDELLGSGSSSGSHASPFVIAVASHGVKVVP 374

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGA 452
           H  NAVIL ++IS ANS++Y   R+L  L+     PK      RNG P +  L +  FG 
Sbjct: 375 HFINAVILISVISVANSSLYSAPRLLLSLAEQGFLPKCLAYVDRNGRPLLCFLVSIIFGC 434

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           + ++ TS   +  F WLL I+ ++  F W+S+S+SHIRF   +  +G S D++ YKA   
Sbjct: 435 IGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMDEVGYKAQ-- 492

Query: 513 PGLAYYGAFFVTLIIL----IQGFTAFAP-----KFDSTAFLTAYISCFLFLFIYIVAQC 563
               Y+G++   LI L     Q + A AP     K D+  F   Y++  + LF Y   + 
Sbjct: 493 --TGYWGSWLAVLIALFFLVCQFWVAIAPVSKHGKLDANVFFQNYLAMPIVLFAYFGHKI 550

Query: 564 YFRTRLWR 571
           Y  T+ W+
Sbjct: 551 Y--TKSWK 556

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  239 bits (610), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 161/491 (32%), Positives = 253/491 (51%), Gaps = 24/491 (4%)

Query: 89  EDIDATGVVEEAQV----KRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAY 144
           E I++     E+ +    KR+L PRH                     +   GP    + Y
Sbjct: 51  ESIESASFDPESNIREDLKRDLSPRHINMISIAGVIGTGLYLSTSKSLHVGGPASLFMNY 110

Query: 145 IFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELS 204
              G +V+     LGEM+T++P++ SF  +A +F S+ F  A  + YWF+ A++ A +L+
Sbjct: 111 SIFGGVVYLTMMCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDLT 170

Query: 205 VVGQVIEFWTFK---VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFII 261
            +  V+++W  K    P  A   +FWV ++++N   V++YGE E+W+A +KVIAII F I
Sbjct: 171 ALQLVLDYWKTKDHHFPYWAASLLFWVFVLLLNVISVRLYGEAEYWLALLKVIAIIIFFI 230

Query: 262 YCLCMVCGAGITGP-VGFRYWRH-PGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTE 319
             + +  G       +GF  W H   P+  G          F G+ S  ++A+F Y GTE
Sbjct: 231 LSIVVNVGHNPEHKYIGFHNWNHGDAPFVNG----------FKGFASLFVSASFAYGGTE 280

Query: 320 LVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASP 379
            + +T GEA NP ++ P+ IK V  R               VPY+ P L++    V  SP
Sbjct: 281 SITLTNGEATNPVRNTPKVIKTVFWRILIFYVFSAFFIAMNVPYDYPGLATKS--VMTSP 338

Query: 380 FIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNG 438
           F I  Q +G+K      NAVI+T++ISA N  ++ GSR++Y +S     PK+  KT R  
Sbjct: 339 FTIVFQMAGSKGAGSFMNAVIMTSVISACNHALFAGSRVMYNMSLDGYLPKWVTKTNRYK 398

Query: 439 VPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHR 498
            P++AV  T A G L +  +  G    + WL NI GV+   AWL I+I+ IRF + L+ +
Sbjct: 399 APYVAVAITWAVGGLCFGASFIGAGTVWIWLQNIVGVSNQIAWLCIAITSIRFRRGLELQ 458

Query: 499 GMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIY 558
           G +  +L +K    P   Y+   FV+ +ILIQG++AF P + ++ F + Y+  F+F   Y
Sbjct: 459 GKTH-ELKFKNWTYPWGPYFLVVFVSFVILIQGWSAFDP-WSTSNFFSVYLELFVFPACY 516

Query: 559 IVAQCYFRTRL 569
           ++   Y R + 
Sbjct: 517 LIWWLYKRDKF 527

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  239 bits (611), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 148/483 (30%), Positives = 233/483 (48%), Gaps = 22/483 (4%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G  + + +KR LKPRH                     I   GP+G +I +   G+ +   
Sbjct: 71  GSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGT 130

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
              LGE+    PV  +F  + +RF+          +Y   W     LE+      +++W 
Sbjct: 131 IHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWN 190

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG 274
             +    W++IF+ +IV +N F V+ +GE EF  ++IK I + GFII C+ ++CG G   
Sbjct: 191 SSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPDH 250

Query: 275 P-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
             +G +YW  PG    G          F G +S L+ A+++  G E+  + +GE  +P K
Sbjct: 251 EFIGAKYWHDPGCLANG----------FPGVLSVLVVASYSLGGIEMTCLASGE-TDP-K 298

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLP 393
            +P AIK+V  R               VPY +  L    S V  SPF+IAI+    K LP
Sbjct: 299 GLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKALP 357

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGA 452
            I NAVIL +++S  NS ++  SR L  ++   L P +F    R G P + ++  + FG 
Sbjct: 358 SIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGL 417

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           LA++  S      FNWL+ I G+A    WLSI++SHIRF   +K +G S D+L + +A+ 
Sbjct: 418 LAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVG 477

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAP-------KFDSTAFLTAYISCFLFLFIYIVAQCYF 565
              + Y A    LI++ Q + +  P       K  +  F   Y+   + LFI+IV + Y+
Sbjct: 478 IWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFIFIVHKIYY 537

Query: 566 RTR 568
           + +
Sbjct: 538 KCQ 540

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  239 bits (609), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 152/483 (31%), Positives = 238/483 (49%), Gaps = 30/483 (6%)

Query: 100 AQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLG 159
           A++K+ +K RH                     +  AGP G ++ Y+    +++ + ++ G
Sbjct: 63  AKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAAG 122

Query: 160 EMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVP 218
           E+   +  +T ++T ++S  V    G +  ++Y   W   F L+L     +I++WT   P
Sbjct: 123 ELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTDINP 182

Query: 219 LAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGPVG 277
              +++I + +IV +N F  K Y E EF+    KV+ IIGF+I  + + CG AG +G +G
Sbjct: 183 -DIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYIG 241

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
            +YW  P P+  G          F G       AAF Y G E++ ++A E  NPRKS+  
Sbjct: 242 DKYWHEPRPFMNG----------FKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKSISS 291

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFN 397
           A KKV  R               VP + P L+S  S   ASP +IA+   G K++PHI N
Sbjct: 292 ACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGS--RASPLVIAVSFHGVKIVPHIIN 349

Query: 398 AVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYM 456
           AVIL  ++S  NS++Y   R+L  L+    APK F    R G P  A      FG LA++
Sbjct: 350 AVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFL 409

Query: 457 ETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLA 516
             S    + F WLL I+G++  F W+SI ISHIRF   +K +G S  ++ YKA       
Sbjct: 410 AASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKAR----TG 465

Query: 517 YYGAFFVT----LIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTR 568
           Y+G++       LI++ Q + A +P      D+ +F  +Y++  + L  Y   + Y +  
Sbjct: 466 YWGSWIAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKD- 524

Query: 569 LWR 571
            WR
Sbjct: 525 -WR 526

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  240 bits (612), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 155/491 (31%), Positives = 241/491 (49%), Gaps = 34/491 (6%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
           E Q+ + +KPRH                     +  +GP G +I Y     +++ V Q+ 
Sbjct: 103 ETQLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMIYCVVQAA 162

Query: 159 GEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217
           GE+   +  +T ++T + +  +    G A   +Y   W     L+L      I +WT  V
Sbjct: 163 GELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTIRYWTTNV 222

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGPV 276
               +++   VL++ +N F  K Y E EF+    K++ + GF+I  + + CG AG    +
Sbjct: 223 NPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIVINCGGAGDKEYI 282

Query: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336
           G +YW+ PG +  G          F G  +    AAF+Y G E++ +TA E ANPRK++P
Sbjct: 283 GVKYWQTPGAFANG----------FKGVAAVFCYAAFSYGGIEVLVLTANEQANPRKAIP 332

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL--SSTD-SYVSASPFIIAIQNSGTKVLP 393
            A +KV  R               VPYN P L  S+ D S   ASPF+IA+ + G +V+P
Sbjct: 333 DACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSDASPFVIAVASHGVQVVP 392

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGA 452
           HI NA IL ++IS ANS++Y G R+L  LS    APK F    R G P I VL + A G 
Sbjct: 393 HIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRRGRPIICVLVSVAMGL 452

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHR--GM-SRDDLPYKA 509
           +A++      +  F WLL ++G++  F W+SI+ISH+RF   ++ +  G+ +RD + Y A
Sbjct: 453 IAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAIRSQLGGLRARDVVEYTA 512

Query: 510 ALMPGLAYYG---AFFVTLIILIQGF-TAFAP-----KFDSTAFLTAYISCFLFLFIYIV 560
                  Y G   A  +++ IL+  F  A AP     + D   F   Y++  + L  Y+ 
Sbjct: 513 Q----TGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLDVQIFFENYLAAPVLLGGYLA 568

Query: 561 AQCYFRTRLWR 571
            + + R   WR
Sbjct: 569 YKIWHRD--WR 577

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  239 bits (611), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 148/488 (30%), Positives = 241/488 (49%), Gaps = 30/488 (6%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           E+  +++ +K RH                     +  AGP G ++ Y     +++ + Q+
Sbjct: 86  EKNNLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQA 145

Query: 158 LGEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
            GE+   +  +T ++T ++S  V    G A   +Y   W     L+L      +++WT  
Sbjct: 146 AGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWT-N 204

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGP 275
           V    ++++ ++ ++I+N F  + Y E EF     K++ + GF+I  + + CG AG    
Sbjct: 205 VNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGDRRY 264

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +G  YW +PGP+  G          F G  +    AAF+Y G E++ ++A E  NP +S+
Sbjct: 265 IGTEYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTESI 314

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL--SSTDSYVSASPFIIAIQNSGTKVLP 393
           P A KKV  R               VPYN  +L  S + S   ASPF+IA+ + G KV+P
Sbjct: 315 PNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFVIAVSSHGVKVVP 374

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGA 452
           H  NAVIL ++IS ANS++Y G R+L  L+   + PK      RNG P +  L + AFG 
Sbjct: 375 HFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSLAFGC 434

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           + ++ TS   +  F WLL I+ ++  F W+S+ +SHIRF   +  +G S D++ YKA   
Sbjct: 435 IGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYKAQ-- 492

Query: 513 PGLAYYGAFFVTLI----ILIQGFTAFAP-----KFDSTAFLTAYISCFLFLFIYIVAQC 563
               Y+G++   LI    ++ Q + A AP     K D   F   Y++  + L  Y   + 
Sbjct: 493 --TGYWGSWIAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHKM 550

Query: 564 YFRT-RLW 570
           YF++ R W
Sbjct: 551 YFKSWRFW 558

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  238 bits (606), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 152/502 (30%), Positives = 250/502 (49%), Gaps = 24/502 (4%)

Query: 88  EEDIDAT------------GVV--EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQ 133
           EED+D              GV+  +  ++K+ LK RH                     ++
Sbjct: 21  EEDVDEEHDIVSVEETVKRGVLHNDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLK 80

Query: 134 NAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWF 193
             GPVG LIAY+F+G +V     ++ E+A+F+P T +    A +F+ +  G   G++  +
Sbjct: 81  KTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVGFTFGWISTY 140

Query: 194 SWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKV 253
           S  +    ELS    ++ +WT   P A +I++F +L V+ N + ++ YGE E+    +K+
Sbjct: 141 SSLM--PGELSATAVIMRYWTDVSP-AVFITVFGILFVVTNIYTIRFYGELEYIFGWLKL 197

Query: 254 IAIIGFIIYCLCMVCGAGITGP--VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINA 311
           + I   II  L +  G G  G   +GF YWR PGP+   ++    +  +F+G+ +++ + 
Sbjct: 198 VLIFILIISGLVIDLG-GTKGQERLGFHYWREPGPFANYLVGG--HIGKFVGFWAAISSV 254

Query: 312 AFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSST 371
            ++Y G + + I AGE  N R ++    K V +R               VPYND  +++ 
Sbjct: 255 VYSYSGIQNIAILAGETKNSRHAIFHGAKNVFLRIIVLYLVTVFILTLIVPYNDKLIATG 314

Query: 372 DSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKF 431
                +SPF+IA+  +G KVLPHI NA+ILT+  SA N  +  GSR L+ L++   APK 
Sbjct: 315 TGTARSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKI 374

Query: 432 FQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIR 490
           F +T + G+P++ V+F ++F  LAYM  S      F W   +        W+ IS +HI 
Sbjct: 375 FLRTSKRGIPYVGVIFISSFLPLAYMSCSKSSATVFGWFQELVSSNTLLRWILISANHIH 434

Query: 491 FMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP-KFDSTAFLTAYI 549
             + LK +G SR DLPY   + P  A++      + +L  GF  F    FD  +F T Y 
Sbjct: 435 MDRALKAQGYSRSDLPYSTPMGPFAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYF 494

Query: 550 SCFLFLFIYIVAQCYFRTRLWR 571
              L + ++   + + +T+  R
Sbjct: 495 IIPLAIGLFTFWKLFKKTKYLR 516

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  238 bits (608), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 155/502 (30%), Positives = 246/502 (49%), Gaps = 36/502 (7%)

Query: 89  EDI-DATGVVEEA----QVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIA 143
           ED+ +  G  EE     ++K+ +K RH                     +  AGP G +I 
Sbjct: 52  EDVKELKGENEECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIG 111

Query: 144 YIFMGTLVFSVTQSLGEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALE 202
           Y     +++ + Q+ GE+   +  +  ++T ++S  V    G +  ++Y   W     L+
Sbjct: 112 YAVASIMLYCIIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQ 171

Query: 203 LSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIY 262
           L      + +WT   P   ++++F+V+I+++N F  K Y E EF     KV+ I GF+I 
Sbjct: 172 LVTAAMTVRYWTNANP-DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVIL 230

Query: 263 CLCMVCG-AGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELV 321
            + + CG AG +G +G +YW  PG +  G          F G       AAF+Y G E++
Sbjct: 231 GIAINCGGAGTSGYIGAKYWHSPGSFAAG----------FKGVCYVFCYAAFSYGGIEVM 280

Query: 322 GITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL--SSTDSYVSASP 379
            +TA E  NPRKS+P A KKV  R               VPYN  +L  SS +S   ASP
Sbjct: 281 VLTASEQENPRKSIPNACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASP 340

Query: 380 FIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNG 438
            +IA+ + G K++PHI NAVIL ++IS  NS++Y   R+L  LS    APKF     R G
Sbjct: 341 LVIAVASHGVKIVPHIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQG 400

Query: 439 VPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHR 498
            P I    T     +A++  S   ++ F WLL I+G++  F W SI +SH+RF   +  +
Sbjct: 401 RPLICFAITLLVALIAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQ 460

Query: 499 GMSRDDLPYKAALMPGLAYYGAFF---VTLIILIQGF-TAFAP-----KFDSTAFLTAYI 549
           G+S   + YK+       Y+G++F   +++++LI  F  A AP     + ++  F   Y+
Sbjct: 461 GLSLGQIGYKSQ----TGYWGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYL 516

Query: 550 SCFLFLFIYIVAQCYFRTRLWR 571
           +  + L  Y   + Y +   WR
Sbjct: 517 AFPILLGAYFGYKVYHKD--WR 536

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  238 bits (607), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 143/484 (29%), Positives = 234/484 (48%), Gaps = 22/484 (4%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G  + + +KR LKPRH                     I   GP+G ++ +   G+ +   
Sbjct: 71  GSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGT 130

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
              LGE+    PV  +F  + +RF+          +Y   W     LE+      +++W 
Sbjct: 131 VHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWN 190

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG 274
             +    W++IF+ +IV +N F  + +GE EF  +++K I + GFII C+ ++CG G   
Sbjct: 191 SSIDPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGGGPDH 250

Query: 275 P-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
             +G +YW  PG    G          F G +S L+ A+++  G E+  + +GE  +P K
Sbjct: 251 EFIGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGIEMTCLASGE-TDP-K 298

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLP 393
            +P AIK+V  R               VPY +  L    S V  SPF+IAI+    KVLP
Sbjct: 299 GLPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVLP 357

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGA 452
            I NAVIL +++S  NS ++  SR L  ++   L P +F    R G P + ++  + FG 
Sbjct: 358 SIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGL 417

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           LA++  S      FNWL+ I G+A    WLSI++SH+RF   +K +G S D+L + +A+ 
Sbjct: 418 LAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLDELEFVSAVG 477

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAP-------KFDSTAFLTAYISCFLFLFIYIVAQCYF 565
              + Y A    LI++ Q + +  P       K  +  F   Y+   + +FI+++ + Y+
Sbjct: 478 IWGSVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCALIMVFIFVIHKIYY 537

Query: 566 RTRL 569
           R ++
Sbjct: 538 RCQM 541

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  238 bits (606), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 154/483 (31%), Positives = 244/483 (50%), Gaps = 23/483 (4%)

Query: 100 AQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLG 159
           A + R LK RH                     +  AGP G LI +    T++  +  SLG
Sbjct: 81  APLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLG 140

Query: 160 EMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFW----TF 215
           E+A   PV+  +  +A+RF+ + +G A  + Y     +   LE+      + +W     +
Sbjct: 141 ELAVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKY 200

Query: 216 KVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP 275
           K+   A++++FWV+IV +N F V+ +GE E   + IKVI IIGFII  + ++ G G    
Sbjct: 201 KL---AFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHE 257

Query: 276 V-GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 334
           V G +YW  PGP+  G    DK    F G  S  + AAF++ G+EL+G+ A E   PRKS
Sbjct: 258 VIGGKYWNDPGPF-VGNAPSDK----FKGVCSVFVTAAFSFAGSELIGLAAAETREPRKS 312

Query: 335 VPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSA-SPFIIAIQNSGTKVLP 393
           +P+A K+V  R               VP N+  L +     +A SPF+IA+     +VLP
Sbjct: 313 IPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVIAMDMHRIRVLP 372

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGA 452
            I N VILT +IS  NS+VY  SR +  L+     PK F    R G P  A+ FT+ FG 
Sbjct: 373 SIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGL 432

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           L ++  +      F+WLL I+G++ FF WL+I+++H+RF   LK +G + ++L + +   
Sbjct: 433 LCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTG 492

Query: 513 PGLAYYGAFFVTLIILIQGFTA-FAPKFDSTA-------FLTAYISCFLFLFIYIVAQCY 564
              + Y    + ++++ Q + A + P  D T+       F   Y+S  + + +Y+  + +
Sbjct: 493 FIGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIW 552

Query: 565 FRT 567
            R 
Sbjct: 553 SRN 555

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  238 bits (606), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 150/483 (31%), Positives = 241/483 (49%), Gaps = 16/483 (3%)

Query: 92  DATGVVE-EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTL 150
           D T  ++ ++ +K+ LK RH                     +   GP   +I Y+ +  +
Sbjct: 79  DGTASIQSKSYMKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSFI 138

Query: 151 VFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQV 209
           V+ + Q+ GEMA   P +  +F  + S F+S  +G A  +++   W     LEL      
Sbjct: 139 VYFMIQAAGEMAVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSLT 198

Query: 210 IEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG 269
           I++WT  +    ++ IF+V +++++F  VK YGE EF     K++ I GFII+ + + CG
Sbjct: 199 IQYWT-DLNGDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNCG 257

Query: 270 -AGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEA 328
            AG  G +G +YW  PG +  G        +RF G    L+   F+Y GTEL  ++  E 
Sbjct: 258 GAGNDGYIGGKYWHTPGSFAEG-----GPTSRFKGICYVLVAGYFSYGGTELYVLSVNEQ 312

Query: 329 ANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYN-DPKLSSTDSYVSASPFIIAIQNS 387
           A PRK+ P A KK   R               VP+N D  + +  S   ASP+++A    
Sbjct: 313 AEPRKATPAAAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHASPYVLAASIH 372

Query: 388 GTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLF 446
           G KV+PHI NAVIL +++S ANS++Y   R+L  L+    APK      R G P +A+L 
Sbjct: 373 GVKVVPHIINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLL 432

Query: 447 TAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLP 506
            A FG +A++ +S   +  F WL  I G++  F W  I  SH+RF   +K +    D++ 
Sbjct: 433 CAVFGCIAFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVG 492

Query: 507 YKAALMPGLAYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISCFLFLFIYIVA 561
           YKA      +++G+ F  L+++ Q + A +P        + +F   Y++  +++F YIV 
Sbjct: 493 YKATAGIYGSWFGSIFGVLVLIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVY 552

Query: 562 QCY 564
             Y
Sbjct: 553 SVY 555

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  236 bits (603), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 155/498 (31%), Positives = 248/498 (49%), Gaps = 22/498 (4%)

Query: 89  EDIDA-TGVVEEAQVKRE-LKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIF 146
           ED++A  GV  + +V R+ ++PRH                     I  AG  G+LI Y  
Sbjct: 26  EDVEAGAGVQGKKEVLRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGIGGTLIGYGI 85

Query: 147 MGTLVFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSV 205
           +G ++    QS+GE+    P ++  F  +  RF+    G +  +++   W I   LEL  
Sbjct: 86  IGVMLVCCMQSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWMIVLPLELVT 145

Query: 206 VGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLC 265
               I++W   +  + ++S+F+ LI ++N F    Y E EF   S+KV+ IIGFII  + 
Sbjct: 146 GSMTIKYWNASLSPSLFVSVFYALICVVNSFGSGGYAEAEFIFNSLKVVVIIGFIILGVL 205

Query: 266 MVCGA-GITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGIT 324
           +  G  G +G +GFRY   PG +       +KN         +L+NAAF+  G E + ++
Sbjct: 206 IDTGCVGTSGTIGFRYLIDPGMF-------NKNYNIIKATAGTLVNAAFSCGGVEFLALS 258

Query: 325 AGEAA--NPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFI 381
           A E    N  KS+ RA  +VS+R               VP+N P L  S  + + +SP++
Sbjct: 259 AAEQNRDNMPKSIGRACNQVSIRIFVFYLLSISVVGLLVPHNSPILMGSGSNMIHSSPYV 318

Query: 382 IAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVP 440
            A+  +G  V+PHI NAVIL  +IS ANS +Y  SR L+ L+    APK+F K  ++G P
Sbjct: 319 AAVAMNGITVVPHIINAVILIAVISVANSAMYSSSRTLHSLAEQNFAPKYFTKLNKHGQP 378

Query: 441 FIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGM 500
              +  +A FG ++++      +  F WLL+I+G++  F W +I I+HIRF   +K RG 
Sbjct: 379 MRCLFISALFGLISFVAEYRDQEAIFIWLLSISGLSTIFTWTTICIAHIRFRDAIKSRGQ 438

Query: 501 SRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISCFLFL 555
           S + L YK+      +Y       +I+++Q + +  P     K +   F   Y++  + L
Sbjct: 439 SLETLGYKSITGVAGSYIATVINLVILVVQFWVSLFPLESNGKPNIVQFFQNYMAVPVAL 498

Query: 556 FIYIVAQCYFRTRLWRTL 573
             YI  + Y  T+ W  L
Sbjct: 499 LFYIGHKVY--TKNWSLL 514

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  236 bits (603), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 147/484 (30%), Positives = 236/484 (48%), Gaps = 26/484 (5%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G  +   +KR LK RH                     +   GP+  LI +   GT +   
Sbjct: 61  GSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGT 120

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
              LGE+    PV  +F  +++RF+          +Y   W     LE+      +EFWT
Sbjct: 121 IHGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWT 180

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG 274
             V    W+++F+ LI+ +N F V+ +G+ +F  + IK++ I GFII CL ++ G G T 
Sbjct: 181 TSVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTH 240

Query: 275 P-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
             +G RYW  PG    G          F G  + ++ A+++  G+E+  + +GE  +P K
Sbjct: 241 EFIGARYWHDPGALANG----------FKGVAAVMVTASYSLGGSEMTCLASGE-TDP-K 288

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLP 393
            +P AIK++  R               VPY + +L    S V+ SPF+IAI+    +VLP
Sbjct: 289 EIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLG-GSNVNNSPFVIAIKMHNIRVLP 347

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGA 452
           HI N VIL +I+S  NS ++  SR L  ++   L P+ F    R G P   +L  + FG 
Sbjct: 348 HIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGL 407

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAAL- 511
           LA++  S+     F WL+ + G+A    WLSI++SHIRF   +K +G S D+L + +A+ 
Sbjct: 408 LAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVG 467

Query: 512 MPGLAYYGAFFVTLIIL--------IQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQC 563
           M G  Y G   V +++         I+G+    P+  + AF   Y+   + LF+++  + 
Sbjct: 468 MWGSVYSGVMNVVVLVAQFYVSLWPIEGWK--DPRGRTEAFFQNYLCALILLFMFVAHKI 525

Query: 564 YFRT 567
           Y+R+
Sbjct: 526 YYRS 529

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  235 bits (599), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 148/475 (31%), Positives = 228/475 (48%), Gaps = 18/475 (3%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
           +  VKR LK RH                     +   GP+  L+ +  +G + F++ +S+
Sbjct: 48  KTGVKRALKDRHISLLALGGIIGPGCLVGAGNALAKGGPLALLLGFSIIGIIAFTIMESI 107

Query: 159 GEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVP 218
           GEM T  P    FT  A RF SD   A CGY Y   +    A E + +  + +FW  +VP
Sbjct: 108 GEMITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVVFFAVMANEYNTLSSIFQFWGPQVP 167

Query: 219 LAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPV-G 277
           L  +I IFW          V  +GE E+W++  K++ ++ F I+    + G     P  G
Sbjct: 168 LYGYILIFWAAFQAFQMAGVGAFGEIEYWLSWFKILGLVAFYIFSTIYISGGIKDRPAFG 227

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
           F YW +PG    G          F G     +  +  Y GTE V  +A E+ NP +++P 
Sbjct: 228 FHYWNNPGALSHG----------FKGIAEVFVFCSTFYSGTESVAYSASESKNPNRAIPL 277

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFN 397
           AI++   R               VPYND  L++    +  SP  IAI  +G +   H+ N
Sbjct: 278 AIRQTFWRILVVYIGIGFFYGVTVPYNDHNLNAGTKALK-SPISIAITRAGWEGGTHLVN 336

Query: 398 AVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYM 456
           A IL T ISA N ++++GSR +  L+   LAPKF   T R GVP  A+    A G ++ M
Sbjct: 337 AFILVTCISAINGSLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFNALGLVSLM 396

Query: 457 ETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLA 516
             S G   A+++++N++GV  F  W +I ++H+RF +    +G +  +LPYKA   P   
Sbjct: 397 NVSVGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYKALFYPYTQ 456

Query: 517 YYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYI----SCFLFLFIYIVAQCYFRT 567
             G      + LIQG+T+F P F +  F+ AY+    +  L++ I ++    F+T
Sbjct: 457 IIGIAANIFLALIQGWTSFVP-FKAGDFVDAYVLLPAAAVLYIGISLLKTHSFKT 510

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  233 bits (595), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 166/515 (32%), Positives = 256/515 (49%), Gaps = 24/515 (4%)

Query: 59  KSDEDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXX 118
            S E+ +++K  + H+               D +A   + E  + R LKPRH        
Sbjct: 10  NSSEEISISKKQQDHLIYETTSYGVNEVYTIDPEAN--IRE-DLTRALKPRHINMISIAG 66

Query: 119 XXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRF 178
                        +   GP    I Y  +G +V+     L EM+T++P++ SF  +A +F
Sbjct: 67  IIGTGLYLSTSTSLHKGGPASLFINYSLIGGIVYLTLLCLAEMSTYMPISGSFCTYAKKF 126

Query: 179 VSDPFGAACGYMYWFSWAITFALELSVVGQVIEFW---TFKVPLAAWISIFWVLIVIMNF 235
            SD F  A  + YWF+ A++ A +L+ +  V+++W   +   P  A   IFW  ++ +N 
Sbjct: 127 GSDSFAMALMWNYWFNDAVSVASDLTALQLVMDYWNTDSNHFPYWAASLIFWFFVLSLNV 186

Query: 236 FPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP-VGFRYWR-HPGPWGPGIIS 293
             V+ YGE E+W+A +KVIAII F I  + +  G       +GF+ W     P+  G   
Sbjct: 187 IHVRFYGEAEYWLAMLKVIAIIIFFIMSIIVNVGHNPQHEYIGFKNWTVGEAPFVDG--- 243

Query: 294 KDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXX 353
                  F G+ S  ++A+F Y GTE + +T+GE+ NP ++ P+ +K V  R        
Sbjct: 244 -------FKGFASLFVSASFAYGGTESITLTSGESDNPLRNTPKIVKTVFWRILFFYIGT 296

Query: 354 XXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVY 413
                  VPYN P LSS    V  SPF I  + +GT       NAVI+T++ISA N  ++
Sbjct: 297 TFFIAMNVPYNYPGLSSGS--VVTSPFTIVFKMAGTAGAGSFMNAVIMTSVISACNHALF 354

Query: 414 VGSRILYGLSSAKLAPKFF--QKTRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLN 471
            GSRI+Y +      PK    +  R  VP++AVL T A G L +  +  G    + WL N
Sbjct: 355 AGSRIMYNMGLEGYLPKSIVSRTNRYKVPYVAVLITWAVGGLCFGASFIGAGTLWTWLQN 414

Query: 472 ITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQG 531
           I GV+   AWL I+I+ IRF Q L+ +  +  +L +K    P   Y+    VT IIL+QG
Sbjct: 415 IVGVSNQLAWLCIAITSIRFRQGLEAQNKTH-ELKFKNWTYPFGPYFLVVAVTFIILVQG 473

Query: 532 FTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
           +++FAP ++ + F + YI  F+F F +I+   Y R
Sbjct: 474 WSSFAP-WNVSNFFSVYIELFVFPFCFIIWWLYKR 507

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  234 bits (597), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 182/567 (32%), Positives = 270/567 (47%), Gaps = 49/567 (8%)

Query: 2   DNKDNASIELHSYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKSD 61
           + K + SI   +  E  E  E +S+  +  D  R    R  RF    R +E        D
Sbjct: 4   EKKLDYSIVQETQLEPGEFDELNSYVSQ-SDTSRVGGTRWERFKDSFREAE------TVD 56

Query: 62  EDATLTKASKRHVRXXXXXXXXXXXXEEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXX 121
            D +LT A K  +                     +   A +KR LK RH           
Sbjct: 57  LDPSLTPAEKMAI---------------------LTANAPLKRTLKSRHLQMIGIGGAIG 95

Query: 122 XXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSD 181
                     +  AGP G LI +   GT+++ +  ++GE+A   PV   +T +ASRFV +
Sbjct: 96  TGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGELAVTFPVAGGYTTYASRFVDE 155

Query: 182 PFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPL-AAWISIFWVLIVIMNFFPVKV 240
            FG A   +Y   W IT  LE+      + +W        A++++F+V+IV +N F VK 
Sbjct: 156 SFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRDAFVALFYVVIVGINLFGVKG 215

Query: 241 YGEFEFWVASIKVIAIIGFIIYCLCMVC-GAGITGPVGFRYWRHPGPWGPGIISKDKNEA 299
           YGE EF  + IKVIA+IGFII  + +VC G    G +G R W +PG +  G         
Sbjct: 216 YGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNPGAFANG--------- 266

Query: 300 RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXX 359
            F G  S  + AAF++ G+ELVG+ A E ANPRKS+P A K+V  R              
Sbjct: 267 -FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILALLMVGL 325

Query: 360 XVPYNDPKL---SSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGS 416
            VPY   +L   SS D+  +ASPF+I+IQN+G K LP + N VIL  ++S  N  V+  S
Sbjct: 326 LVPYTSDRLIGQSSVDA--AASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCAVFGCS 383

Query: 417 RILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGV 475
           R +  L++    PK F    R G P + ++ T  FG L+++  S      F+WLL ++G+
Sbjct: 384 RSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLLALSGL 443

Query: 476 AGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAF 535
           +  F W  I + HIR  + L  +  +  +L + A      + Y    + LI++ Q + A 
Sbjct: 444 SSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQFWIAL 503

Query: 536 AP---KFDSTAFLTAYISCFLFLFIYI 559
            P   K  + AF  AY+S  +++  YI
Sbjct: 504 FPIGGKPSAAAFFEAYLSFPIYIVFYI 530

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  234 bits (596), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 142/445 (31%), Positives = 216/445 (48%), Gaps = 15/445 (3%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G      +K+ LK RH                     +   GP+  +I +   GT +   
Sbjct: 66  GSFHSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWTVAGTQMVGT 125

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
              LGE+    PV  +F  + +RF+          +Y   W     LE+      +E+W 
Sbjct: 126 IHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWG 185

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG 274
             VP  AW++IF+  I ++N   V+ +GE EF  + IKV+ IIGFII C+ ++CG G   
Sbjct: 186 SSVPPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCVVLICGGGPKH 245

Query: 275 P-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
             VG +YW  PGP   G          F G  +  + A+++  GTE+  + +GE  +P K
Sbjct: 246 EFVGAKYWSDPGPLANG----------FKGVAAVFVIASYSLGGTEMACLASGE-TDP-K 293

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLP 393
            +P AIK+V  R               VPY +  L    S V  SPF+IAI+  G K LP
Sbjct: 294 ELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMGGSS-VDNSPFVIAIRLHGIKALP 352

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGA 452
            + NAVIL +++S  NS ++  SR L  ++   L P+ F    R G P + +L   AFG 
Sbjct: 353 SVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNLAFGL 412

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           LA++  S+   + F WL+ I G+A    WLSI++SHIRF   +K +G+S D+L + +A+ 
Sbjct: 413 LAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEFVSAVG 472

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAP 537
              + Y A    LI++ Q + +  P
Sbjct: 473 VYGSVYSATINVLILVAQFYVSLWP 497

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  234 bits (596), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 148/480 (30%), Positives = 230/480 (47%), Gaps = 18/480 (3%)

Query: 99  EAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSL 158
           +  +K+ +K RH                     +   GP   +I YI +  + + + Q+ 
Sbjct: 63  DRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQAA 122

Query: 159 GEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217
           GEMA   P +  SF  + S F+S P G A  +++   W     LEL      I++W   +
Sbjct: 123 GEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYWNDSI 182

Query: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM-VCGAGITGPV 276
               WI IF+V ++ ++ F VK YGE EF   + K++ I GFII+ + +   GAG  G +
Sbjct: 183 NADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDGYI 242

Query: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336
           G +YW++PG +     +   +  RF      L+ A F+Y GTEL  ++  E ANPR+S P
Sbjct: 243 GAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRSTP 297

Query: 337 RAIKKVSVRXXXXXXXXXXXXXXXVPY-NDPKLSSTDSYVSASPFIIAIQNSGTKVLPHI 395
           +A K+   R               VP+ ND  + +  S   ASP+++A    G KV+PHI
Sbjct: 298 KAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHASPYVLAASIHGVKVVPHI 357

Query: 396 FNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALA 454
            NAVIL  + S  NS++Y   R+   L+    APK      R G P IA+   A  G +A
Sbjct: 358 INAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACAVVGVIA 417

Query: 455 YMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPG 514
           +   S+  +  F WL  I  ++  F W +I +SHIRF   +K +G   ++L YKA     
Sbjct: 418 FAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTGVW 477

Query: 515 LAYYGAFFVTLIILIQGFTAFAP---KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571
            + +G  F  L+ + Q + A +P      +  F  +Y++  L+LF       YF   LW+
Sbjct: 478 GSMWGFGFCVLVFIAQFWVALSPPGGTISAEGFFESYLAFPLWLFF------YFAYMLWK 531

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  233 bits (594), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 139/478 (29%), Positives = 238/478 (49%), Gaps = 18/478 (3%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           E A +++ +KPRH                     I  AG  G+LI Y+ +G +V    QS
Sbjct: 21  EPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLIIGVMVVCCMQS 80

Query: 158 LGEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
           +GE+    P +   F  +  +F+    G    +++   W +   LEL      I++W   
Sbjct: 81  VGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVTASMTIKYWNSN 140

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGA-GITGP 275
           +  + ++S F++LI I+NFF    Y E EF    +KV+ +  FI+  + ++ G  G +GP
Sbjct: 141 LSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLGIVIITGGLGNSGP 200

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAA--NPRK 333
           +GF+Y + PG +       + N   F     +L+NAAF+  G E + ++A E    N  K
Sbjct: 201 IGFQYLKTPGAF-------NTNYNVFKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPK 253

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVS-ASPFIIAIQNSGTKVL 392
           S+ RA ++VS+R               VPY+ P L  + S  +  SP++ AI   G +++
Sbjct: 254 SIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAAIALHGVRIV 313

Query: 393 PHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQ-KTRNGVPFIAVLFTAAFG 451
           PHI NAVIL  ++S ANS +Y  SR L+ L+    AP++F    ++G P   ++ +A  G
Sbjct: 314 PHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRCLVVSAIVG 373

Query: 452 ALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAAL 511
            ++++      +  F WLL+I+G++  F W +I I+HIRF   LK +G S D L Y++  
Sbjct: 374 LISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLGYRSNT 433

Query: 512 MPGLAYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAYISCFLFLFIYIVAQCY 564
               +Y       ++I++Q + +  P     K D+  F   Y++  + + +Y+  + Y
Sbjct: 434 GVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLYLGHKLY 491

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  234 bits (596), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 150/521 (28%), Positives = 250/521 (47%), Gaps = 20/521 (3%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           +E QV R+LK RH                     +   GP   LI+Y+ M   V+ +   
Sbjct: 63  QEHQVARKLKSRHIQLIALGGAIGTGLFIGSGGALSVCGPAPLLISYMIMSFFVWCIMNF 122

Query: 158 LGEMATFIPVTSSFTVFA--SRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTF 215
           L EM   +P++   ++FA    +++ P    CG   +++ ++    E++    +I++WT 
Sbjct: 123 LTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFYAMSMIAPSEITATAILIQYWT- 181

Query: 216 KVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP 275
               A +ISIF V+ V +   PV  +GE EFWV+ IK+  I G +I  + +  G      
Sbjct: 182 DANSAIFISIFIVVTVSLTMLPVHFFGESEFWVSIIKLFCITGLVILGIVIFFGGAPNQD 241

Query: 276 --VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGT-ELVGITAGEAANPR 332
             +GF YW+HPG + P ++    N  +FL   +++I + F+Y    E+V   A EA +PR
Sbjct: 242 KVLGFHYWKHPGAFNPHLVPG--NTGKFLACWTAIIKSGFSYVLVPEVVVSCAAEAKDPR 299

Query: 333 KSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL----SSTDSYVSASPFIIAIQNSG 388
           +++PR  ++   R               V Y++ +L    ++ +S  +ASPF+I IQ  G
Sbjct: 300 RNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRLLNAIAAGESNAAASPFVIGIQEVG 359

Query: 389 TKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFT 447
            +VLPHI NA ILT+  S   S +Y  SR+L+ ++     PK F  T R G P+ +    
Sbjct: 360 IRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAVNGAVPKIFATTNRFGTPYYSTAAA 419

Query: 448 AAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPY 507
           + F  LAY+  S      F WL NI  ++GF  W+ + + ++RF + ++H  ++ D +P+
Sbjct: 420 SVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWMLVCVVYLRFRKVIEHANLT-DKMPF 478

Query: 508 KAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
           +   M  LAY    F  ++ L  G+  F A  ++ + F   Y +  L   +YI A  Y++
Sbjct: 479 RKRFMKPLAYLSCGFFAILSLTNGYAVFVADNWNVSDFFACYTTLGLAAVLYIGAAIYYK 538

Query: 567 TRLWRTLXXXXXXXXXXXXXXXIWEEG-----PQTFWDKFW 602
           T   R L                 E+G     P+ + +K W
Sbjct: 539 TIKLRDLDEVAAEIIPKIAMADEEEKGEVPIVPKNWLEKVW 579

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  234 bits (597), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 151/482 (31%), Positives = 250/482 (51%), Gaps = 20/482 (4%)

Query: 101 QVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160
           ++K+ ++PRH                     +  AGP G +I Y  MG+L++ + Q+ GE
Sbjct: 115 KLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGPAGLVIGYGIMGSLIYCIIQACGE 174

Query: 161 MA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPL 219
           MA  ++ +   F  + +  +   F  A  ++Y   W     LEL      I++WT KV  
Sbjct: 175 MAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWLCVCPLELVTASMTIKYWTTKVDP 234

Query: 220 AAWISIFWVLIVIMNFFP-VKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT-GPVG 277
             ++ IF+V I+ +N     + Y E EF   S K++ +IGF I  + ++CG   T G +G
Sbjct: 235 DVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGTDGYIG 294

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
            RYW  PG +       ++   RF G V++L+ AAF++  +E + +TA E +NPR+++P 
Sbjct: 295 GRYWHDPGAF-----RGERAVDRFKGVVATLVTAAFSFGQSEFIAVTASEQSNPRRAIPS 349

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSY-VSASPFIIAIQNSGTKVLPHIF 396
           A KK+  R               VPYN  +L    S  + ASP+++A+ N G +V+PH  
Sbjct: 350 AAKKIIYRALCIYLASIILLGFLVPYNSSQLLGAQSNGIKASPYVLAVANHGVRVVPHFI 409

Query: 397 NAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAY 455
           NAVI+ +++S +NS  Y   R+L  LS    APK F    R G P + ++  + F  +A+
Sbjct: 410 NAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFSYVDRAGRPTMGIIVASLFAVIAF 469

Query: 456 METSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAAL-MPG 514
             TS      F WLL ++G++  F W+SI +SH+RF + +  +G S  +  + + + + G
Sbjct: 470 CATSPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFRRAMTVQGRSLGECGFLSQVGIYG 529

Query: 515 LAYYGAFFVTLIILIQGF-TAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRL 569
            AY  +FFV  +IL+  F  A  P    K D+ +F   Y++  +++ +YI  +CY  T+ 
Sbjct: 530 SAY--SFFVLALILVGQFWVALKPVGSKKVDANSFFENYLAAPIWIALYIGYKCY--TKD 585

Query: 570 WR 571
           WR
Sbjct: 586 WR 587

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  233 bits (595), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 146/483 (30%), Positives = 231/483 (47%), Gaps = 22/483 (4%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G  + + +KR LKPRH                     I   GP+G ++ +   G+ +   
Sbjct: 71  GSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGT 130

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
              LGE+    PV  +F  + +RF+          +Y   W     LE+      +++W 
Sbjct: 131 IHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWN 190

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG 274
             +    W++IF+V+IV +N F V+ +GE EF  ++IK I + GFII C+ ++ G G   
Sbjct: 191 SSIDPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPDH 250

Query: 275 P-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
             VG +YW  PG    G          F G +S L+ A+++  G E+  + +GE  +P K
Sbjct: 251 EYVGAKYWYDPGCLANG----------FPGILSVLVVASYSLGGIEMTCLASGE-TDP-K 298

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLP 393
            +P AIK+V  R               VPY +  L    S V  SPF+IAI+    KVLP
Sbjct: 299 GLPSAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVLP 357

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGA 452
            I N VIL +++S  NS ++  SR L  ++   L P +F    R G P + ++  + FG 
Sbjct: 358 SIVNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGL 417

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           LA++  S    + FNWL+ I G+A    WLSI++SHIRF   +K +G   D+L + +A+ 
Sbjct: 418 LAFLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELEFVSAVG 477

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAP-------KFDSTAFLTAYISCFLFLFIYIVAQCYF 565
              + Y A    LI+L Q + +  P          +  F   Y+   + LFI+I  + Y+
Sbjct: 478 IWGSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVLFIFIAHKIYY 537

Query: 566 RTR 568
           + +
Sbjct: 538 KCQ 540

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  232 bits (592), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 155/482 (32%), Positives = 242/482 (50%), Gaps = 18/482 (3%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           +  ++K+ LK RH                     ++  GPVG LIAY+F+G +V     +
Sbjct: 40  DRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIA 99

Query: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFAL----ELSVVGQVIEFW 213
           + E+A+F+P T +    A +F+ +  G      + F W  T++     ELS    ++ +W
Sbjct: 100 IAEVASFMPATGATIRHAEQFIDESVG------FTFGWISTYSSLMPGELSATAVIMRYW 153

Query: 214 TFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT 273
           T   P A +I+IF VL V+ N + ++ YGE E+    +K+I I   II  L +  G G+ 
Sbjct: 154 TDISP-AVFITIFGVLFVVTNIYTIRFYGEVEYVFGWLKLILIFILIISGLVIDLG-GVK 211

Query: 274 GP--VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 331
           G   +GF YWR PGP+   I+    +  +F+G+ S+L +  ++Y G + + I AGE  N 
Sbjct: 212 GQERLGFHYWRDPGPFAEYIVGG--SIGKFVGFWSALSSVVYSYSGIQNIAILAGETKNS 269

Query: 332 RKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKV 391
           R ++    K V +R               VPYND  ++S      +SPF+IA+  +G KV
Sbjct: 270 RHAIYHGAKNVFLRIIVLYLVTVFVLTLIVPYNDALIASGTGTAKSSPFVIAMNRAGIKV 329

Query: 392 LPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAF 450
           LPHI NA++LT+  SA N  +  GSR L+ L++   APK F KT + G+P++ V+F + F
Sbjct: 330 LPHIVNALVLTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFISCF 389

Query: 451 GALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAA 510
             LAYM  S      F W   +        W+ IS +HI   + LK +G SR DLPY   
Sbjct: 390 LPLAYMSCSESSSTVFGWFQELVSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYSTP 449

Query: 511 LMPGLAYYGAFFVTLIILIQGFTAFAP-KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRL 569
           + P  A++      + +L  GF  F    FD  +F T Y    L + ++   + + +TR 
Sbjct: 450 IAPYAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTRY 509

Query: 570 WR 571
            R
Sbjct: 510 LR 511

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  233 bits (595), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 160/484 (33%), Positives = 243/484 (50%), Gaps = 15/484 (3%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           +   +K+ ++PRH                     + N GP   +I Y  + ++++ V QS
Sbjct: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136

Query: 158 LGEMAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
             E+A  +  +   F  + S  V   FG +  ++Y   W     LEL      I++W   
Sbjct: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCG-AGITGP 275
           +   A+++IF+V++V +NF     Y E EF+    KV+ IIGF I  + + CG AG  G 
Sbjct: 197 INPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGGAGNDGY 256

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSV 335
           +G RYW  PG +         +  RF G V+ L+NAAF Y G E   +TA E  NP+KS+
Sbjct: 257 LGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYN-DPKLSSTDSYVSASPFIIAIQNSGTKVLPH 394
             A KK+  R               VP+N D  L S  S   ASPF+IA+ + G +V+PH
Sbjct: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371

Query: 395 IFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGAL 453
             NAVIL +++S ANS +Y  SRIL  LS    AP+F     R G P + +L +  FG L
Sbjct: 372 FINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431

Query: 454 AYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMP 513
           +++  S   +  F WLL I+G++  F W SIS+SH+R  + +  +G S D+L Y A    
Sbjct: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491

Query: 514 GLAYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRL 569
             AYY    +  I++ Q + A +P    K D+  F   Y++  + +F+Y+  + +  TR 
Sbjct: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIW--TRD 549

Query: 570 WRTL 573
           WR L
Sbjct: 550 WRLL 553

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  233 bits (594), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 142/483 (29%), Positives = 233/483 (48%), Gaps = 22/483 (4%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G  + + +KR LKPRH                     I   GP+G ++ +   G+ +   
Sbjct: 72  GSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGT 131

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
              LGE+    PV  +F  + +RF+          +Y   W     LE+      +++W 
Sbjct: 132 IHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWN 191

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG 274
             +    W++IF+ +IV +N F  + +GE EF  +++K I + GFII  + ++CG G   
Sbjct: 192 SSIDPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIVLICGGGPDH 251

Query: 275 P-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
             +G +YW  PG    G          F G ++ L+ A+++  G E+  + +GE  +P K
Sbjct: 252 EFIGAKYWHDPGCLANG----------FPGVLAVLVVASYSLGGIEMTCLASGE-TDP-K 299

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLP 393
            +P AIK+V  R               VPY +  L    S V  SPF+IA++    KVLP
Sbjct: 300 GLPGAIKQVFWRILFFFLASLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAMKLHHIKVLP 358

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGA 452
            I NAVIL +++S  NS ++  SR L  ++   L P +F    R G P + ++  + FG 
Sbjct: 359 TIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGL 418

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           LA++  S    + FNWL+ I G+A    WLSI++SHIRF   +K +G S D+L + +A+ 
Sbjct: 419 LAFLVKSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVG 478

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAP-------KFDSTAFLTAYISCFLFLFIYIVAQCYF 565
              + Y A    LI++ Q + +  P       K  +  F   Y+   + LFI++V + Y+
Sbjct: 479 IWGSAYSALINCLILIAQFYCSLWPIGGWSSGKERAKLFFQNYLCALIMLFIFVVHKIYY 538

Query: 566 RTR 568
           + +
Sbjct: 539 KCQ 541

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  234 bits (598), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 153/479 (31%), Positives = 244/479 (50%), Gaps = 16/479 (3%)

Query: 101 QVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160
           ++K+ +KPRH                     +  AGP G L+ +  MGT ++ + Q++GE
Sbjct: 148 ELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGE 207

Query: 161 MAT-FIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPL 219
           MA  +  +   F  + S  V   FG +  ++Y   W     LEL      I++WT KV  
Sbjct: 208 MAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTKVDP 267

Query: 220 AAWISIFWVLIVIMNFFPVKV-YGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT-GPVG 277
             ++ IF+VLI+ +N       Y E EF   S K++ +IGF I  + ++CG     G +G
Sbjct: 268 DVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDGYIG 327

Query: 278 FRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 337
            +YW  PG +       +    RF G +++L+NAAF +  +E +G+TA E +NPRK++P 
Sbjct: 328 GKYWHEPGAF-----RGEHAIDRFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPS 382

Query: 338 AIKKVSVRXXXXXXXXXXXXXXXVPYN-DPKLSSTDSYVSASPFIIAIQNSGTKVLPHIF 396
           A KK+  R               VPY+ D  L S+   V ASP+++A+   G KV+PH  
Sbjct: 383 AAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVKVVPHFI 442

Query: 397 NAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAY 455
           NAVIL +++S ANS  Y  SR+L  L+    APK F    R G P + +   + FG +A+
Sbjct: 443 NAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAF 502

Query: 456 METSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGL 515
             TS      F WLL I+G++  F W++I +SH+RF + +  +G S  +L +++ +    
Sbjct: 503 CATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWG 562

Query: 516 AYYGAFFVTLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLW 570
           + Y A  +  I++ Q + A AP    K D+  F   Y++  + L +Y   + Y  T+ W
Sbjct: 563 SSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIY--TKNW 619

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  233 bits (593), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 160/575 (27%), Positives = 257/575 (44%), Gaps = 55/575 (9%)

Query: 6   NASIELHSYHESLETQEASSWDKKLKDKVRNEWARDRRFLHRHRGSEGEVEYAKSDEDAT 65
           N ++E+    +   + E  S D KL  K  NE+  +        GS              
Sbjct: 5   NLAMEMDIERKGSSSTETCS-DSKLNTKSHNEYTYESGKCSLLNGS-------------- 49

Query: 66  LTKASKRHVRXXXXXXXXXXXXEEDIDA-----TGVVEEAQVKRELKPRHXXXXXXXXXX 120
            T+  KR+V             +  ID+      G  + + +KR LK RH          
Sbjct: 50  -TEERKRNV------------VQRVIDSFKPPVDGSFDPSNMKRALKSRHLIMIAIGSSI 96

Query: 121 XXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVS 180
                      +   GP+  +I +   GT +      LGE+   +PV  +F  +++RF+ 
Sbjct: 97  GTGLFVGSGKALATGGPLALIIGWTLAGTQMIGTIHGLGELTVRLPVVGAFADYSTRFLD 156

Query: 181 DPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKV 240
                    +Y   W     LE+      + FWT  V    W+++F+ +IV +N   V+ 
Sbjct: 157 PSVSFVISSIYVMQWFFVLPLEIIASCITMRFWTQSVDPIIWVALFYTMIVSINLLGVRG 216

Query: 241 YGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP-VGFRYWRHPGPWGPGIISKDKNEA 299
           +GE EF  +S+KVI I GFII C+ ++ G G T   VG RYW  PGP   G         
Sbjct: 217 FGEAEFIFSSVKVITICGFIILCIVLILGGGPTHQYVGSRYWHDPGPLANG--------- 267

Query: 300 RFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXX 359
            F G  + ++ A+++  G+E+  + +GE  +P K +P AIK++  R              
Sbjct: 268 -FKGVAAVMVTASYSLGGSEMTCLASGE-TDP-KELPHAIKQIFWRILFFFLVSLTLVGF 324

Query: 360 XVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRIL 419
            VPY +  L    S    SPF++A+     KV+PHI N VIL +I+S  NS ++  SR L
Sbjct: 325 LVPYTNENLLGGSS-AENSPFVLALYLHHVKVVPHIVNGVILVSILSVGNSCIFASSRTL 383

Query: 420 YGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGF 478
             ++   L P  F    R G P + +L  + FG LA++   +   N F+WL+ I G+A  
Sbjct: 384 CSMAHQGLIPHIFGYVDRGGRPLVGILANSIFGLLAFLVKFSSISNVFSWLMAIAGLATC 443

Query: 479 FAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP- 537
             WLSI++SH+RF   +K +  S D+L + +++    + Y      L ++ Q + A  P 
Sbjct: 444 VVWLSINVSHVRFRLAMKAQNKSLDELQFVSSVGVWGSVYAGVLNFLTLVAQFYIALWPV 503

Query: 538 ------KFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
                 K  + AF   Y+   + + ++   +CYFR
Sbjct: 504 EGWKDSKSRAEAFFKNYLCALILIAMFAAHKCYFR 538

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  233 bits (593), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 146/483 (30%), Positives = 233/483 (48%), Gaps = 22/483 (4%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G  +   +KR LK RH                     I   GP+  +I +   G+ +   
Sbjct: 78  GSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGT 137

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
              LGE+    PV  +F  +++RF+          +Y   W     LE+      +++W 
Sbjct: 138 IHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYWN 197

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG 274
             +    W++IF+  IV +N F  + +GE EF  +S+KV+ I GFII C+ ++CG G   
Sbjct: 198 QSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDH 257

Query: 275 P-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
             VG +YW  PG    G          F G +S L+ A+++  GTE+V + +GE  +P K
Sbjct: 258 DFVGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGTEMVCLASGE-TDP-K 305

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLP 393
            +P AIK+   R               VPY +  L    S V+ SPF+IAI+    KVLP
Sbjct: 306 ELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSS-VNNSPFVIAIKLHQIKVLP 364

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGA 452
            I NAVIL +I+S  NS ++  SR L  ++   L P+FF    R G P   ++  + FG 
Sbjct: 365 SIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGL 424

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           LA++  S+     F+WL+ I G+A    WLSI+ISHIRF   +K +G S D+L + +A+ 
Sbjct: 425 LAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVG 484

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAP-------KFDSTAFLTAYISCFLFLFIYIVAQCYF 565
              + Y A   +LI++ Q + A  P          +  F  +Y+   + + +++  + ++
Sbjct: 485 IWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIFY 544

Query: 566 RTR 568
           R +
Sbjct: 545 RYK 547

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  231 bits (590), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 144/482 (29%), Positives = 243/482 (50%), Gaps = 15/482 (3%)

Query: 101 QVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160
           ++ R LK RH                     +   GP   LIAYI +   V+S+   + E
Sbjct: 54  KIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTE 113

Query: 161 MATFIPV--TSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVP 218
           M   IP+   +S    A  +++ P    CG+  +++ A+    E++    ++++WT    
Sbjct: 114 MVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEITACALLVQYWT-DAN 172

Query: 219 LAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP--V 276
            A +ISIF V+ +++   PVKV+GE EFWV+SIK++ I+G II  + +  G G      +
Sbjct: 173 SAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDHVL 232

Query: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGT-ELVGITAGEAANPRKSV 335
           GF YW++PG + P +   + N  RFL   +++I + F++    E V   + E   PR+++
Sbjct: 233 GFHYWKNPGAFNPHL--AEGNTGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRRNM 290

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL----SSTDSYVSASPFIIAIQNSGTKV 391
           P+A ++   R               V +N+ +L     S  S  +ASPF+I IQ +G K+
Sbjct: 291 PKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQEAGIKI 350

Query: 392 LPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAF 450
           LPHI NA ILT+  S     +Y  SR LY ++    APK F K  R G P+ +    + F
Sbjct: 351 LPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLASLF 410

Query: 451 GALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAA 510
             LAY+  S      FNWL NI  ++GF +W+ +S+++IRF + +    ++ D +P++  
Sbjct: 411 SFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVINALDLN-DRVPFRRP 469

Query: 511 LMPGLAYYGAFFVTLIILIQGFTAFAP-KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRL 569
               LAY    F  ++ L  G+  F    ++ + F  +Y++    +F+Y+V   Y++   
Sbjct: 470 FQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSDFFASYVTIGFVIFLYLVGSFYYKQWT 529

Query: 570 WR 571
           +R
Sbjct: 530 FR 531

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  229 bits (584), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 143/461 (31%), Positives = 233/461 (50%), Gaps = 18/461 (3%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           +  ++K+ LK RH                     ++  GPVG LIAY+F+G +V     +
Sbjct: 44  DRTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIA 103

Query: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFAL----ELSVVGQVIEFW 213
           + E+A+F+P T +    A +F+ +  G      + F W  T++     ELS    ++++W
Sbjct: 104 IAEVASFMPATGATIRHAEQFIDESVG------FTFGWISTYSSLMPGELSATAVIMKYW 157

Query: 214 TFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT 273
           T   P A +I++F VL V  N + ++ YGE E+    +K++ I   II  L +  G G+ 
Sbjct: 158 TDVSP-AVFITVFGVLFVATNIYTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLG-GVK 215

Query: 274 GP--VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 331
           G   +GF YWR PGP+   +++   +  +F+G+ +++ +  ++Y G + + I AGE  N 
Sbjct: 216 GQERLGFHYWRDPGPFANYLVAG--HIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNS 273

Query: 332 RKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKV 391
           R ++    K V +R               VPYND  +++      +SPF+IA+  +G KV
Sbjct: 274 RYAIFHGAKNVFLRIIVLYLVTVFVLTLIVPYNDKLIATGTGTAKSSPFVIAMNRAGIKV 333

Query: 392 LPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAF 450
           LPHI NA+ILT+  SA N  +  GSR L+ L++   AP+ F KT + G+P++ V+F ++F
Sbjct: 334 LPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISSF 393

Query: 451 GALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAA 510
             LAYM  S      F W   +        W+ IS +HI   + LK +G SR DLP    
Sbjct: 394 LPLAYMSCSESSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCSTR 453

Query: 511 LMPGLAYYGAFFVTLIILIQGFTAFA-PKFDSTAFLTAYIS 550
           + P  A++      + +   GF  F    FD  +FL   +S
Sbjct: 454 IAPFAAWFSGIMSVIFLFTGGFYNFMHGHFDIESFLLDTLS 494

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  231 bits (589), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 150/503 (29%), Positives = 252/503 (50%), Gaps = 21/503 (4%)

Query: 88  EEDI------DATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSL 141
           E+DI      D   +    +V R LK RH                     + + GP   L
Sbjct: 44  EQDIERGSLSDIDTIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLL 103

Query: 142 IAYIFMGTLVFSVTQSLGEMATFIPVT--SSFTVFASRFVSDPFGAACGYMYWFSWAITF 199
           I+Y  M   V+++   + EM   IP++  SS    A  +++ P    CG+  +++ ++  
Sbjct: 104 ISYSVMSFFVWAIMNQMTEMVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMSMVV 163

Query: 200 ALELSVVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGF 259
             E++    +IE+WT     A +++IF +L  +++  PVK++GE EF V+ IK++ I+G 
Sbjct: 164 PTEITACALLIEYWT-DANAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILGL 222

Query: 260 IIYCLCMVCGAGITGP--VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-Q 316
           I+  + +  G G      +GF YW  PG +   ++    +   FL    ++I + F +  
Sbjct: 223 ILVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSYLV--KGSTGAFLAVWKAIIKSGFAFVM 280

Query: 317 GTELVGITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL----SSTD 372
             E+    + EAA PRK++PRA ++   R               V Y++  L    SS  
Sbjct: 281 IPEITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSGK 340

Query: 373 SYVSASPFIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFF 432
           +  +ASPF+I IQ +G ++LPHI NA ILT+  S + S +Y  SR+L+ L+    APKFF
Sbjct: 341 ANAAASPFVIGIQEAGIRILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKFF 400

Query: 433 QK-TRNGVPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRF 491
            K  + GVP+ +V  T+ FG LAY+  S      FNWL NI  ++GF  W+ +SI+++RF
Sbjct: 401 SKVNKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLRF 460

Query: 492 MQTLKHRGMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYIS 550
            +   +  ++ D +PY+      LAY  A F  L+ +  GF  F A  ++ + F T Y++
Sbjct: 461 RKITDYLKIN-DRVPYRRRGQRALAYASAIFFALLAITNGFYVFIAGNWNVSDFFTCYVT 519

Query: 551 CFLFLFIYIVAQCYFRTRLWRTL 573
                 ++I +  Y++   +R +
Sbjct: 520 IGFVGVLFIGSSIYYKEWTFRDM 542

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  230 bits (587), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 151/485 (31%), Positives = 247/485 (50%), Gaps = 17/485 (3%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           ++  + R LK RH                     +   GP   LIAY  M   V+SV   
Sbjct: 47  QKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGALSICGPAPLLIAYAVMSLFVWSVMNQ 106

Query: 158 LGEMATFIPVTSSFTVFA--SRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTF 215
           + EM T IP+    T+++    +V+ P    CG+  +++ A+    E++    ++++WT 
Sbjct: 107 MTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQAMIAPAEVTACALLVQYWTD 166

Query: 216 KVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP 275
             P A +ISIF VL V +   PVKV+GE EFWV+SIK++ I+G II  + +  G G    
Sbjct: 167 ANP-AIFISIFLVLSVAITMLPVKVFGESEFWVSSIKILTIVGLIIVGVVIFFGGGPAQE 225

Query: 276 --VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGT-ELVGITAGEAANPR 332
             +GF YW+ PG + P ++  +    +FL + +++I + F++    E+V   A EA  PR
Sbjct: 226 HVLGFHYWKKPGAFKPYLV--EGGTGKFLAFWTAIIKSGFSFVLVPEIVSSCAAEAVAPR 283

Query: 333 KSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL----SSTDSYVSASPFIIAIQNSG 388
           +++PRA K+   R               V Y++ +L    +S  S  +ASPF+I I+ +G
Sbjct: 284 RNMPRACKRFIYRLALFYVFGILVVGVIVGYDNDRLLNAIASGQSSAAASPFVIGIKEAG 343

Query: 389 TKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFT 447
            +VLPHI NA ILT+  S     +Y  SR L+ ++    AP+      + GVP+     T
Sbjct: 344 IRVLPHIINAAILTSAYSCGTGLLYGASRTLHSMACKGDAPRILTTVNKYGVPYYCTGIT 403

Query: 448 AAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPY 507
           + F  LAY+  S      FNWL NI  ++GF +W+ +SI++IRF   +    ++ D +P+
Sbjct: 404 SLFCLLAYLNCSNSSSVVFNWLSNIATISGFVSWVLVSIAYIRFRNVIDVLKLN-DRIPF 462

Query: 508 KAALMPGLAYYGAFFVTLIILIQGFTAFAP-KFDSTAFLTAYISCFLFLFIYIVAQCYFR 566
           +      LAY    F +++ L  GF  F    +D++ F  AYI+    L +++ +  Y++
Sbjct: 463 RVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDTSNFFAAYITLGFVLVLFVGSTIYYK 522

Query: 567 TRLWR 571
              WR
Sbjct: 523 E--WR 525

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  229 bits (585), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 147/480 (30%), Positives = 241/480 (50%), Gaps = 15/480 (3%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           +  ++K+ LK RH                     ++ AGP G  +AY+ +G +V     +
Sbjct: 46  DRTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQIA 105

Query: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFAL----ELSVVGQVIEFW 213
           + E+A+F+P T +    A +F+ +  G      + F W  T++     ELS    V+ +W
Sbjct: 106 IAEVASFMPATGATIRHAEQFIDESVG------FTFGWISTYSSLMPGELSATAVVMRYW 159

Query: 214 TFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT 273
           T   P A WI+IF +L V+ N + ++ YGE E++   +K+I II  I+  L +  G    
Sbjct: 160 TDINP-AVWITIFGILFVLTNIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGAKQ 218

Query: 274 GPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
             +GF YWR PGP+   I+  +    +F+G+ ++L +  ++Y G + + I AGE  N R 
Sbjct: 219 ERLGFHYWREPGPFAEYIVKGEI--GKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRH 276

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLP 393
           ++    + V +R               VPYND  +++      +SP++IAIQ +  K+LP
Sbjct: 277 AIFHGARNVFLRIIVLYLIAVLVLTLIVPYNDKLIATGTGTAKSSPYVIAIQRANIKILP 336

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGA 452
           HI NA+ILT+  SA N  +  GSR L+ L+S   APK F  T + G+P++ + F +AF  
Sbjct: 337 HIINAIILTSAWSAGNLAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISAFLP 396

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           L+YM  S+   N F+W   +        W+ IS +HI   + LK +G SR DLP+   L 
Sbjct: 397 LSYMSVSSSSANVFSWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHSTCLG 456

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAP-KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571
           P  A++      + +L  GF  F    FD  +F T Y    L + ++   + + +T+  R
Sbjct: 457 PFAAWFSGIMSLIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIILFTFWKLFKKTKYLR 516

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  230 bits (587), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 152/501 (30%), Positives = 240/501 (47%), Gaps = 33/501 (6%)

Query: 88  EEDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFM 147
           E D    G  +E  + + ++ RH                     +  +GP+G +I YI  
Sbjct: 72  EHDDSTAG--DENDLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVS 129

Query: 148 GTLVFSVTQSLGEMA-TFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVV 206
             +VF + Q+ GE+   +  V  +FT + +  V   FG A  ++Y   W I   L+L   
Sbjct: 130 SLMVFLIIQAAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTA 189

Query: 207 GQVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCM 266
              I+FW   V L  ++   +V++V++N    + Y E EF+    K++ + GF+I  + +
Sbjct: 190 AMTIQFWNVGVNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGIII 249

Query: 267 VCGAGITGPVGF---RYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGI 323
             G    GP G+   +YWR+PG +  G          F G  S    AAF+Y G E + +
Sbjct: 250 TAGGIPNGPDGYIGGKYWRNPGLFANG----------FKGVCSVFCYAAFSYGGVETLVL 299

Query: 324 TAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFII 382
           +A E  NP KS+P A KKV  R               VPY  P L  S+ S   +SPF+I
Sbjct: 300 SAAEQKNPLKSIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHSSPFVI 359

Query: 383 AIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPF 441
           AI + G  V+PH+ NAVIL +++S ANS +YV  R+L  L+    APKF     + G P 
Sbjct: 360 AIASHGVSVVPHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPT 419

Query: 442 IAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMS 501
              L    FG + ++  S   +  F WLL+I+G+   F W+SI +SHIRF   ++ +G  
Sbjct: 420 TCTLVVVLFGMIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGHP 479

Query: 502 RDDLPYKAALMPGLAYYGAF----FVTLIILIQGFTAFAP-----KFDSTAFLTAYISCF 552
             ++ YKA       Y+G++        +++ Q + A AP     K D+T F   Y++  
Sbjct: 480 LTEIAYKAQ----TGYWGSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQNYLAFP 535

Query: 553 LFLFIYIVAQCYFRTRLWRTL 573
           + L  Y+  + Y++   W+ L
Sbjct: 536 VVLCAYLGFKVYYKQ--WQLL 554

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  229 bits (584), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 148/489 (30%), Positives = 238/489 (48%), Gaps = 23/489 (4%)

Query: 88  EEDIDA--TGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYI 145
            ED++     +  + Q K+ L  RH                     +   GP   +I Y+
Sbjct: 61  SEDVEDGIASIRSDTQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLIIGYV 120

Query: 146 FMGTLVFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELS 204
            +  + + + Q+ GEMA   P +  +F  + S F+S  +G A  +++   W     LEL 
Sbjct: 121 LVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLPLELI 180

Query: 205 VVGQVIEFWTFKVPLAAWISIFWVLIVIMNFFP-VKVYGEFEFWVASIKVIAIIGFIIYC 263
                I++W  K+    ++ IF+V +V ++    ++ YGE EF   S K++ +IGFII  
Sbjct: 181 TSSLTIKYWNDKINADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGFIILS 240

Query: 264 LCM-VCGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVG 322
           + +   GAG  G +G +YW  PG +  G        +RF G    L++  F+Y GTEL  
Sbjct: 241 IVINAGGAGNDGYIGGKYWHEPGSFAEG-----DATSRFKGICLVLVSGYFSYGGTELYV 295

Query: 323 ITAGEAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFI 381
           ++  E A PRK+ P A KK   R               VP+N+ +L  +  S   ASP++
Sbjct: 296 LSVNEQAEPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHASPYV 355

Query: 382 IAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVP 440
           +A    G K++PH  NAVIL ++IS ANS+++ G R+L  L++   APK      R G P
Sbjct: 356 LAATIHGVKIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDREGRP 415

Query: 441 FIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGM 500
            +A+  +   G +A++  ++  +  F WL  I G++  F W  I  SH+RF   +K +G 
Sbjct: 416 LVALGISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQGK 475

Query: 501 SRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAP-----KFDSTAFLTAY------I 549
             ++L YKA      + YGAFF  L+++ Q + A AP     K D+ AF  +Y      +
Sbjct: 476 DINELGYKANTGVWGSAYGAFFGVLVLIAQFWVALAPIGNGGKCDAEAFFESYLAFPIWV 535

Query: 550 SCFLFLFIY 558
           +C+    IY
Sbjct: 536 ACYFGYMIY 544

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  229 bits (584), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 145/489 (29%), Positives = 246/489 (50%), Gaps = 29/489 (5%)

Query: 98  EEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQS 157
           E  ++K+ +KP H                     I +AG  G+L+ Y  +G+++    QS
Sbjct: 66  ENEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVGYFIIGSMLVCCMQS 125

Query: 158 LGEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216
           +GE+    P +   F  +  RFV   FG    +++   W I   LEL      I++W   
Sbjct: 126 VGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLELVTASMTIKYWNNS 185

Query: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGA-GITGP 275
           +  + +++IF+ LI+ ++FF  + Y + EF     KV+ I GFII  + +  GA G +G 
Sbjct: 186 LNPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIILGIIISFGAAGTSGY 245

Query: 276 VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAA--NPRK 333
           +G +Y + PG +             F    S+L+NA F+  G E + ++A E A  N  K
Sbjct: 246 IGIKYLKTPGAF--------NTRNTFKSICSTLVNACFSCGGVEFLALSAAEQARGNISK 297

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL-SSTDSYVSASPFIIAIQNSGTKVL 392
           S+ RA  +V VR               VPYN P+L  S+   + +SP++IA+ + G KV+
Sbjct: 298 SIKRACGQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYVIAVASHGVKVV 357

Query: 393 PHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFG 451
           PH+ NAVIL  ++S ANS +Y  SR L+ L+    AP +F K    G PF  ++ +  FG
Sbjct: 358 PHLINAVILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPFRCLVVSGVFG 417

Query: 452 ALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAAL 511
            L+++      ++ F WLL+I+G++  F W  I ++H+RF   +K +  S ++L ++A  
Sbjct: 418 LLSFIAEYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHSLEELGHRA-- 475

Query: 512 MPGLAYYGAFFV----TLIILIQGFTAFAP-----KFDSTAFLTAYISCFLFLFIYIVAQ 562
             G+  YG+++V    +L +++Q + +  P     + D   F   Y++    L +Y+  +
Sbjct: 476 WSGI--YGSYYVIAINSLTLVVQFWVSLFPLDGDGRPDFVNFFQNYMAVPFALCLYVGHK 533

Query: 563 CYFRTRLWR 571
            Y  TR W+
Sbjct: 534 IY--TRSWQ 540

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  227 bits (579), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 145/482 (30%), Positives = 231/482 (47%), Gaps = 22/482 (4%)

Query: 95  GVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSV 154
           G  + + +KR LK RH                     +   GP+  +I +   G+ +   
Sbjct: 56  GSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVGT 115

Query: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214
              LGE+    PV  +F  +++RF+          +Y   W     LE+      I++W 
Sbjct: 116 IHGLGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYWN 175

Query: 215 FKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITG 274
             +    W++IF+ +IV +N F  + +GE EF  ++IK I I GFII C+ ++CG G   
Sbjct: 176 SSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPDH 235

Query: 275 P-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 333
             +G +YW  PG    G          F G +S L+ A+++  GTE+  + +GE  +P K
Sbjct: 236 EFIGAKYWHDPGALAHG----------FPGVLSVLVVASYSLGGTEMTCLASGE-TDP-K 283

Query: 334 SVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLP 393
            +P AIK+V  R               VPY +  L    S V  SPF+IAI+    K LP
Sbjct: 284 ELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIKLHHIKALP 342

Query: 394 HIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGA 452
            I NAVIL +I+S  NS ++  SR L  ++   L P+FF    R G P   ++  + FG 
Sbjct: 343 SIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGL 402

Query: 453 LAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALM 512
           LA++  S+     F+WL+ I G+A    WLSI++SHIRF   +K +  + D+L + +A+ 
Sbjct: 403 LAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAVG 462

Query: 513 PGLAYYGAFFVTLIILIQGFTAFAPK---FDST----AFLTAYISCFLFLFIYIVAQCYF 565
              + Y A    LI++ Q + +  P     DS+     F  +Y+   + L I+ + + Y+
Sbjct: 463 IWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVYY 522

Query: 566 RT 567
           R 
Sbjct: 523 RV 524

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  227 bits (579), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 143/482 (29%), Positives = 239/482 (49%), Gaps = 17/482 (3%)

Query: 101 QVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMGTLVFSVTQSLGE 160
           Q++R LK RH                     +   GP   LI+YI M   V+++   L E
Sbjct: 58  QMQRGLKSRHMQLIALGCAIGTGLFIGTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTE 117

Query: 161 MATFIPV--TSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVP 218
           M    P+   +S    A  +++ P    CG+  +++ A+    E++    +I++WT    
Sbjct: 118 MVVLTPIPGEASMYALARAYLNRPLSFMCGWNLFYAQAMIAPSEITASTLLIQYWT-DAN 176

Query: 219 LAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGP--V 276
            A ++SIF V+ + +   PVKV+GE EFWV+ IK+I I G II  + +  G G      +
Sbjct: 177 SAIFVSIFIVITIAVTALPVKVFGESEFWVSMIKLITITGLIILGVVIFFGGGPNQHHVL 236

Query: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKSV 335
           GF YW+HPG + P I     N  +FL   +++I + F +    E +   + EA  PR+++
Sbjct: 237 GFHYWKHPGAFKPHI--STGNTGKFLAVWTAIIKSGFAFILSPETLTSCSAEADRPRRNM 294

Query: 336 PRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKL----SSTDSYVSASPFIIAIQNSGTKV 391
           PRA  +   R               V Y++  L    +S  S  +ASPF+I I+  G KV
Sbjct: 295 PRAANRFVWRLMLFYIGGALVVGVTVGYDNQNLLSAIASGQSNAAASPFVIGIKEVGIKV 354

Query: 392 LPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAF 450
           LPHI NA ILT   SA  + +Y  SR+L+ ++    APK F +  R GVP+ +++  + F
Sbjct: 355 LPHIINAAILTGAYSAGTAEMYGASRMLHSMALKGNAPKIFARVNRYGVPYYSIIVPSCF 414

Query: 451 GALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAA 510
             LAY+  S      F WL NI+ ++GF +W+ +SI+++RF + + +  ++ D + ++  
Sbjct: 415 CFLAYLNCSNSASQVFTWLTNISTISGFISWVFVSITYVRFRRVIDYLDLN-DRIKFRKP 473

Query: 511 LMPGLAYYGAFFVTLIILIQGFTAFAP-KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRL 569
                AY+   F  ++ L  G+  F    +  + F   YI+    + ++I+   Y++   
Sbjct: 474 FQRIFAYFSGCFFVILSLTNGYAVFTKGNWSVSDFFANYITIGFVVVLFIMGTAYYKE-- 531

Query: 570 WR 571
           WR
Sbjct: 532 WR 533

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  228 bits (580), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 149/483 (30%), Positives = 240/483 (49%), Gaps = 17/483 (3%)

Query: 89  EDIDATGVVEEAQVKRELKPRHXXXXXXXXXXXXXXXXXXXXPIQNAGPVGSLIAYIFMG 148
           +D     +V  A +K+ LK RH                     + NAGP   LI Y  + 
Sbjct: 86  QDDPEGDMVSNAGLKQALKTRHVAMMSLGTGIGTGLLIANGKGLSNAGPAPLLIGYGLVS 145

Query: 149 TLVFSVTQSLGEMATFIP-VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207
              + + Q+ GE+A   P +  SF  + S+ VS PFG A  ++++  W   F +EL  + 
Sbjct: 146 VNTYFMVQAAGELAVAFPTIPGSFNAYTSQLVSRPFGFATTWLFFVQWLTMFPMELIAMT 205

Query: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267
             + FWT +V    ++ IF+V + I++F  V+ YGE EF++   KV+ +IGF+I+ +C+ 
Sbjct: 206 FAVRFWTTRVDADVFVLIFFVFLFIVHFIGVEAYGETEFFLNLFKVLMVIGFVIFAICVA 265

Query: 268 C-GAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAG 326
             GAG +G +G +YW  PG +          E RF G    L++A F+Y GTEL  ++  
Sbjct: 266 AGGAGDSGYIGAKYWHDPGAF-----VSHTAEGRFKGVCYVLVSAYFSYGGTELFVLSVN 320

Query: 327 EAANPRKSVPRAIKKVSVRXXXXXXXXXXXXXXXVPYNDPKLSST----DSYVSASPFII 382
           E  NPRK++P A K    R               VP N P+L  +    +   S SP+++
Sbjct: 321 EQENPRKTIPTATKTTIYRIIFIYLLTMVLVGFTVPNNHPRLMGSPYAKEGVQSVSPYVL 380

Query: 383 AIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPF 441
           A      +VLPH  NAV++  ++S +NS +Y   R++  L+     PK+F    R G P 
Sbjct: 381 AASYHHVRVLPHFINAVVMLALVSMSNSAMYAAPRLICSLAQQGYCPKYFDYIDRRGRPT 440

Query: 442 IAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMS 501
            A++     G +A+  +S   +  F+WL  I G++  F W SI +SH+RF   +K +G  
Sbjct: 441 RALVLCFIIGVIAFASSSEKRETIFSWLSAIAGLSELFTWSSIMLSHVRFRAAIKVQGKD 500

Query: 502 RDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAF-AP----KFDSTAFLTAYISCFLFLF 556
            ++L YK+      + YG FF  L+   Q + A  AP    K  ++ F  +Y++  ++L 
Sbjct: 501 INELGYKSNTGVWGSAYGVFFSLLVFAAQFWVALSAPNSGGKCSASDFFQSYLALPIWLT 560

Query: 557 IYI 559
            Y+
Sbjct: 561 FYV 563

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.138    0.435 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,522,036
Number of extensions: 2001493
Number of successful extensions: 8482
Number of sequences better than 10.0: 368
Number of HSP's gapped: 6864
Number of HSP's successfully gapped: 388
Length of query: 606
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 491
Effective length of database: 40,294,809
Effective search space: 19784751219
Effective search space used: 19784751219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)