Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A05190na 1ON66766730140.0
TBLA0A051801.50ON67663320870.0
CAGL0K05753g1.50ON66059418970.0
Kpol_2000.921.50ON63758918930.0
NCAS0A004201.50ON67959818450.0
Suva_2.6881.50ON66160318390.0
CAGL0B01012g1.50ON62359118350.0
TPHA0B047501.50ON63959918200.0
Smik_4.7901.50ON66359718180.0
YDR508C (GNP1)1.50ON66359718080.0
Smik_3.531.50ON63359617880.0
YCL025C (AGP1)1.50ON63359617840.0
Skud_4.7841.50ON66359717800.0
KAFR0D04120na 1ON64860717780.0
Skud_3.381.50ON63359617710.0
Suva_3.1891.50ON63359617620.0
TPHA0E036601.50ON64759417490.0
NCAS0B085801.50ON62759417360.0
KAFR0D041401.50ON63759617370.0
KAFR0D04130na 2ON64459517330.0
TDEL0C065101.50ON64260617250.0
NDAI0A006401.50ON64159217210.0
NDAI0F043901.50ON66767117040.0
KAFR0D00510na 2ON61759416770.0
KAFR0D00520na 1ON59859316510.0
KNAG0F002701.50ON63454216450.0
SAKL0C01232gsingletonON61353116210.0
SAKL0C01650g1.50ON61359516130.0
KLTH0F01584g1.50ON59658516030.0
KAFR0D005001.50ON61759216000.0
KNAG0C005901.50ON63467115940.0
Kpol_2002.441.50ON62760215880.0
Kwal_33.132041.50ON60756715740.0
ZYRO0F17446g1.50ON63359415570.0
AFR698C1.50ON60952715490.0
KLLA0C01606g1.50ON62057415380.0
Ecym_10561.50ON60653115320.0
KLTH0F01606gna 1ON60459414820.0
Kwal_33.13215na 1ON59852814390.0
AGR039Cna 3ON58652014100.0
SAKL0D02948gna 3ON59459114020.0
YBR068C (BAP2)3.284ON60958613610.0
SAKL0D02926g3.285ON58352813531e-180
Ecym_26643.285ON57552713501e-179
NDAI0A074903.284ON59659513481e-179
NCAS0A106803.284ON59358313251e-175
AGR040C3.285ON57357813181e-175
NCAS0I015303.284ON59559813111e-173
Skud_4.3003.284ON60460513091e-173
CAGL0H08393g3.284ON61260413091e-173
Smik_2.2013.284ON60959513071e-173
YDR046C (BAP3)3.284ON60460513051e-172
Smik_4.2843.284ON60459713051e-172
CAGL0L07546g3.284ON63459713051e-172
Skud_2.1913.284ON60959612971e-171
KAFR0A011203.284ON59260612961e-171
KNAG0J022003.284ON60759012961e-171
NDAI0A056203.284ON57156712921e-171
Suva_4.3073.284ON60959412931e-170
Suva_2.2033.284ON60461012881e-170
KNAG0H011503.284ON61759212831e-169
SAKL0D02970g3.284ON60159712801e-169
TPHA0M012003.284ON60759112751e-168
Kpol_1065.133.284ON59659712551e-165
Ecym_2663na 3ON58955212381e-162
TPHA0A039603.284ON61559512261e-160
ZYRO0G12342g3.284ON62054512181e-159
Kpol_1052.163.284ON61358212141e-159
AGR038C3.284ON58059012101e-158
KAFR0C004003.284ON58253112091e-158
Ecym_26623.284ON58958312021e-157
Smik_2.2023.285ON61754212021e-157
TBLA0I020003.284ON66460911911e-154
Suva_4.3083.285ON61854511861e-154
TBLA0G031203.284ON67361611871e-154
TBLA0I020103.285ON62852011801e-153
Skud_2.1923.285ON61954511731e-152
YBR069C (TAT1)3.285ON61954511701e-152
KLTH0C05170g3.284ON59853711621e-151
Kwal_27.105383.284ON60256011551e-150
Kpol_1052.143.285ON60256711231e-145
KNAG0J022103.285ON58150811181e-145
NCAS0I015203.285ON61456711031e-142
NDAI0A075003.285ON61956310611e-135
SAKL0H08184gna 4ON59856010541e-135
Kwal_27.126811.244ON59360410471e-134
Ecym_8297na 4ON56951810171e-130
ADL272Wna 4ON56449910151e-129
NDAI0B052201.244ON61157910081e-128
SAKL0G14014g5.158ON60557510041e-127
TPHA0B010901.244ON60659510041e-127
KLTH0E15642g1.244ON5965319991e-127
Suva_11.2731.244ON6015519931e-126
Skud_11.2751.244ON6025809891e-125
ZYRO0D03762g1.244ON6005949881e-125
TPHA0A002405.158ON6036009871e-125
KNAG0C02140singletonON5985809781e-123
KLLA0A06886gsingletonON5875779741e-123
Smik_16.1155.158ON6035999731e-123
CAGL0L03267g1.244ON5975459721e-122
KAFR0E018505.158ON5605589691e-122
YKR039W (GAP1)1.244ON6025799681e-122
Skud_7.5255.158ON6035999681e-122
KLTH0B02046g5.158ON5895879611e-121
KNAG0G009005.158ON6136159611e-121
TDEL0C00930singletonON5955989581e-120
Kpol_543.791.244ON6055739561e-120
NCAS0B079001.244ON6195519561e-120
Kpol_1010.325.158ON5995979511e-119
SAKL0D04664g1.244ON5935349501e-119
KLLA0A11770g5.158ON5815429461e-119
CAGL0B03773g5.158ON6056079481e-119
NDAI0D021605.158ON5875989441e-118
YGR191W (HIP1)5.158ON6036089411e-118
Kwal_33.154075.158ON5875879391e-118
Suva_7.4855.158ON6035299381e-117
KLLA0F01012gna 4ON5565209311e-117
NDAI0C029505.158ON6095399341e-117
Kpol_543.78singletonON6055969331e-117
Kwal_33.14276na 5ON5965469311e-116
Ecym_60211.244ON6005989221e-115
AGR319W5.158ON6265989241e-115
TBLA0B077605.158ON6586359211e-114
Suva_2.716singletonON6035329141e-114
SAKL0D00836gna 5ON6015899111e-113
NCAS0A071105.158ON5925889021e-112
Ecym_47895.158ON5886059011e-112
KLLA0A06930g1.244ON5875519001e-112
NCAS0D018705.158ON5955528961e-111
AFR230C1.244ON6045388901e-110
Smik_11.3021.244ON5535318771e-109
TPHA0A047005.158ON5694838691e-108
NCAS0A089201.368ON5995358571e-105
Kpol_534.221.368ON5926008501e-104
Ecym_27161.368ON5925878461e-104
Skud_15.1381.368ON5925568381e-103
NDAI0G060301.368ON5995878381e-103
TBLA0C012101.368ON6005358381e-103
Smik_15.1461.368ON5935638361e-102
YOL020W (TAT2)1.368ON5925418281e-101
KLTH0H13398g1.368ON5875418261e-101
Suva_15.1481.368ON5925568171e-100
AEL030W1.368ON5825908123e-99
CAGL0D02178g1.368ON5775898106e-99
TPHA0A025001.368ON5906007984e-97
KLLA0A10813g1.368ON5845947836e-95
KLTH0C08052gna 6ON5995957672e-92
TDEL0B00130singletonON5845877513e-90
YLL061W (MMP1)na 7ON5835977452e-89
KAFR0F04410singletonON5805917426e-89
TDEL0E05700singletonON5845917427e-89
Sklu_YGOB_Anc_1.3681.368ON5415117388e-89
Smik_12.2na 7ON5835917303e-87
Kwal_34.16254singletonOFF4814877014e-84
Kwal_YGOB_34.162541.368ON4914877015e-84
TDEL0H04510singletonON5845907061e-83
TPHA0G03770singletonON6045767071e-83
Kwal_56.22951na 6ON5965397052e-83
SAKL0D04048gna 6ON5865446973e-82
Suva_16.18na 6ON5835656947e-82
KAFR0B00220singletonON5855656947e-82
KLLA0B06776gna 6ON5885876885e-81
Smik_6.483na 6ON5905986833e-80
YPL274W (SAM3)na 6ON5875986824e-80
TDEL0E00250singletonON5875996641e-77
ZYRO0D17952gna 6ON5855376552e-76
AER405Cna 6ON4974916432e-75
Suva_5.41.83ON5905636413e-74
Suva_16.31singletonON5865866405e-74
SAKL0C02662g1.83ON5485656313e-73
Smik_5.241.83ON5905576292e-72
SAKL0C02640gsingletonON5485086226e-72
YNL270C (ALP1)1.83ON5735806202e-71
TPHA0B044701.84ON5996006188e-71
YEL063C (CAN1)1.83ON5905576179e-71
Kwal_33.134011.83ON5595556114e-70
Skud_5.261.83ON5905636091e-69
KNAG0C05920singletonON5995296082e-69
Kpol_2000.641.84ON6105396041e-68
TBLA0A054601.84ON6085836022e-68
NDAI0A006101.83ON5655565957e-68
SAKL0C02684gsingletonON5885395951e-67
KAFR0D039401.83ON5975945924e-67
Skud_14.701.83ON5735225888e-67
TBLA0A054501.83ON6065325908e-67
NDAI0F041901.84ON5995105882e-66
TDEL0C061801.83ON5835145862e-66
NCAS0B085701.83ON5325265832e-66
KNAG0F004801.84ON5975975872e-66
ZYRO0F16632g1.84ON6075205873e-66
YNL268W (LYP1)1.84ON6115435873e-66
Ecym_4758na 6ON5875655854e-66
Kwal_33.134111.84ON5605615825e-66
TDEL0C061701.84ON5734995819e-66
CAGL0J08162g1.84ON5975945821e-65
Smik_14.671.83ON5735725792e-65
NCAS0A006101.84ON6075095793e-65
Ecym_10881.84ON5675245764e-65
KLLA0C02365g1.84ON5795365766e-65
KLLA0C02343g1.83ON5815075741e-64
Ecym_10871.83ON5705725731e-64
Smik_14.681.84ON6115075752e-64
KNAG0C007901.83ON5795105722e-64
KLTH0F02420g1.84ON6215285734e-64
Skud_14.711.84ON6126105724e-64
KLTH0F02398g1.83ON5555505668e-64
NCAS0A006001.83ON5445305641e-63
CAGL0J08184g1.83ON5725465634e-63
NDAI0F042001.83ON5665295616e-63
KNAG0L02460singletonON5885695627e-63
SAKL0C02728g1.84ON5625105591e-62
Suva_14.731.83ON4974925532e-62
CAGL0A01199gna 8ON6135595593e-62
TPHA0B044801.83ON6035275574e-62
Suva_14.751.84ON6115115566e-62
KAFR0D007001.83ON5745745512e-61
TBLA0A07060na 8ON6255175542e-61
SAKL0G14916gna 8ON5815885512e-61
Kpol_2000.651.83ON5955055504e-61
KLLA0E16281gna 8ON6055835452e-60
YPL265W (DIP5)na 8ON6085995357e-59
AFR668W1.83ON5564985317e-59
Skud_16.12na 8ON6076035303e-58
KAFR0B06430singletonON5935325293e-58
ZYRO0F16654g1.83ON5805645251e-57
Smik_6.473na 8ON6065475215e-57
TPHA0M00130singletonON6115335181e-56
AFR667C1.84ON5635395125e-56
Suva_16.40na 8ON6065285121e-55
Ecym_2480na 8ON5865435031e-54
Kwal_26.9612singletonON5435435002e-54
ACL135Wna 8ON5885394961e-53
NDAI0F04210singletonON1701344632e-53
Ecym_80357.44ON5635344923e-53
KNAG0L02470singletonON6385594944e-53
NDAI0I02660na 8ON5945924925e-53
KNAG0E003907.44ON5995914909e-53
KNAG0L00110na 9ON5715224862e-52
YOR348C (PUT4)7.44ON6275844874e-52
CAGL0M00154gsingletonON5505754826e-52
Kwal_33.15545na 8ON5765674829e-52
Kpol_358.3na 8ON5755694811e-51
KLTH0B01166gna 8ON5775834802e-51
NCAS0J00140na 9ON5585424782e-51
KAFR0C051607.44ON5845724775e-51
CAGL0E05632g7.44ON5985284741e-50
NCAS0D02260na 8ON5976064742e-50
Smik_15.5327.44ON6315584708e-50
Kwal_8.590na 10ON6295414709e-50
KAFR0F02250singletonON5545514614e-49
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A05190
         (667 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...  1165   0.0  
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   808   0.0  
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   735   0.0  
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   733   0.0  
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   715   0.0  
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   712   0.0  
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   711   0.0  
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   705   0.0  
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   704   0.0  
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   701   0.0  
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   693   0.0  
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   691   0.0  
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   690   0.0  
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   689   0.0  
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   686   0.0  
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   683   0.0  
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   678   0.0  
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   673   0.0  
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              673   0.0  
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              672   0.0  
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   669   0.0  
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   667   0.0  
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   660   0.0  
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      650   0.0  
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   640   0.0  
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   638   0.0  
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   629   0.0  
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   625   0.0  
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   622   0.0  
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      620   0.0  
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   618   0.0  
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   616   0.0  
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   610   0.0  
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   604   0.0  
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   601   0.0  
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   597   0.0  
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   594   0.0  
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   575   0.0  
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   558   0.0  
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   547   0.0  
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   544   0.0  
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   528   0.0  
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   525   e-180
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   524   e-179
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   523   e-179
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   514   e-175
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   512   e-175
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              509   e-173
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   508   e-173
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   508   e-173
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   508   e-173
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   507   e-172
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   507   e-172
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   507   e-172
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   504   e-171
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   503   e-171
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   503   e-171
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            502   e-171
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   502   e-170
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   500   e-170
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              498   e-169
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   497   e-169
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   495   e-168
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   488   e-165
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   481   e-162
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              476   e-160
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   473   e-159
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   472   e-159
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   470   e-158
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                470   e-158
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   467   e-157
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   467   e-157
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   463   e-154
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   461   e-154
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              461   e-154
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   459   e-153
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   456   e-152
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   455   e-152
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   452   e-151
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   449   e-150
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   437   e-145
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   435   e-145
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              429   e-142
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   413   e-135
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   410   e-135
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   407   e-134
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   396   e-130
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   395   e-129
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   392   e-128
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   391   e-127
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   391   e-127
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   389   e-127
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   387   e-126
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   385   e-125
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   385   e-125
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   384   e-125
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   381   e-123
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   379   e-123
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   379   e-123
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   379   e-122
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   377   e-122
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   377   e-122
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   377   e-122
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   374   e-121
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   374   e-121
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   373   e-120
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   372   e-120
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   372   e-120
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   370   e-119
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   370   e-119
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   369   e-119
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   369   e-119
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    368   e-118
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   367   e-118
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   366   e-118
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   365   e-117
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   363   e-117
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    364   e-117
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   363   e-117
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   363   e-116
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   359   e-115
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   360   e-115
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   359   e-114
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   356   e-114
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   355   e-113
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   352   e-112
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   351   e-112
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   351   e-112
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   349   e-111
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   347   e-110
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   342   e-109
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   339   e-108
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   334   e-105
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   332   e-104
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   330   e-104
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   327   e-103
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   327   e-103
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   327   e-103
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   326   e-102
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   323   e-101
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   322   e-101
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   319   e-100
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   317   3e-99
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   316   6e-99
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   311   4e-97
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   306   6e-95
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   300   2e-92
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                293   3e-90
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   291   2e-89
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              290   6e-89
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   290   7e-89
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   288   8e-89
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    285   3e-87
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   274   4e-84
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   274   5e-84
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   276   1e-83
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   276   1e-83
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   276   2e-83
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   273   3e-82
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   271   7e-82
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      271   7e-82
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   269   5e-81
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   267   3e-80
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   267   4e-80
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                260   1e-77
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   256   2e-76
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   252   2e-75
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   251   3e-74
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   251   5e-74
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   247   3e-73
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   246   2e-72
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   244   6e-72
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   243   2e-71
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   242   8e-71
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   242   9e-71
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   239   4e-70
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   239   1e-69
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            238   2e-69
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   237   1e-68
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   236   2e-68
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   233   7e-68
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   233   1e-67
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   232   4e-67
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   231   8e-67
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   231   8e-67
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   231   2e-66
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   230   2e-66
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            229   2e-66
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                230   2e-66
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   230   3e-66
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   230   3e-66
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   229   4e-66
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   228   5e-66
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   228   9e-66
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   228   1e-65
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   227   2e-65
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              227   3e-65
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   226   4e-65
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   226   6e-65
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   225   1e-64
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   225   1e-64
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   226   2e-64
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              224   2e-64
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   225   4e-64
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   224   4e-64
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   222   8e-64
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   221   1e-63
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   221   4e-63
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            220   6e-63
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             221   7e-63
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   219   1e-62
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   217   2e-62
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   219   3e-62
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   219   4e-62
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   218   6e-62
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   216   2e-61
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   218   2e-61
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   216   2e-61
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   216   4e-61
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   214   2e-60
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   210   7e-59
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   209   7e-59
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   208   3e-58
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   208   3e-58
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   206   1e-57
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   205   5e-57
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     204   1e-56
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   201   5e-56
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   201   1e-55
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   198   1e-54
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   197   2e-54
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   195   1e-53
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}             182   2e-53
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   194   3e-53
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             194   4e-53
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   194   5e-53
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   193   9e-53
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   191   2e-52
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   192   4e-52
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   190   6e-52
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   190   9e-52
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   189   1e-51
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   189   2e-51
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      188   2e-51
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   188   5e-51
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   187   1e-50
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              187   2e-50
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   185   8e-50
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   185   9e-50
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              182   4e-49
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   182   6e-49
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         176   6e-49
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   181   1e-48
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   182   2e-48
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   181   2e-48
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   179   3e-48
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   178   8e-48
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   178   1e-47
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     179   1e-47
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   178   1e-47
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      177   2e-47
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            176   5e-47
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   174   2e-46
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    173   3e-46
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   174   3e-46
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   174   3e-46
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   174   4e-46
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   174   5e-46
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   172   1e-45
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   172   1e-45
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     167   1e-45
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     167   1e-45
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   170   6e-45
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     169   3e-44
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   168   3e-44
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   167   4e-44
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   167   8e-44
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              166   2e-43
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   166   2e-43
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   166   2e-43
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   165   3e-43
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   163   2e-42
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   162   4e-42
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...   150   1e-41
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   160   3e-41
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   158   7e-41
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   152   2e-38
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   149   6e-38
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   150   1e-37
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)     135   2e-36
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   145   3e-36
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            144   6e-36
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   144   1e-35
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   142   3e-35
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   142   4e-35
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   142   6e-35
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   141   1e-34
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   140   2e-34
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   140   2e-34
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   139   3e-34
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   139   3e-34
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   138   7e-34
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   138   8e-34
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   137   2e-33
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                137   2e-33
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   137   2e-33
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   135   4e-33
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   136   5e-33
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   134   2e-32
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...   124   1e-31
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   132   1e-31
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   132   1e-31
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   130   3e-31
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   130   3e-31
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   123   3e-31
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   129   1e-30
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   127   6e-30
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   125   2e-29
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   124   6e-29
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)     114   2e-27
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)    115   3e-27
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   114   6e-26
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   112   3e-25
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   109   2e-24
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   105   1e-22
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   104   2e-22
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          98   2e-22
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   103   3e-22
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...    94   3e-19
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...    92   1e-18
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      82   3e-18
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...    91   4e-18
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...    89   1e-17
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...    84   4e-16
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          72   1e-13
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...    77   1e-13
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...    77   1e-13
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...    76   2e-13
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...    75   3e-13
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...    74   8e-13
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...    72   4e-12
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...    71   7e-12
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...    70   8e-12
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...    70   1e-11
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...    68   4e-11
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...    65   4e-10
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    62   1e-09
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...    55   3e-07
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...    52   6e-06
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              45   4e-05
NDAI0G02760 Chr7 (629341..644226) [14886 bp, 4961 aa] {ON} Anc_8...    33   2.4  

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score = 1165 bits (3014), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 578/667 (86%), Positives = 578/667 (86%)

Query: 1   MQTPKDYEITSEHEVEYFDQPSLHNRSTHHSSKDATNVQFAPGXXXXXXXXXXXXXXXXX 60
           MQTPKDYEITSEHEVEYFDQPSLHNRSTHHSSKDATNVQFAPG                 
Sbjct: 1   MQTPKDYEITSEHEVEYFDQPSLHNRSTHHSSKDATNVQFAPGDSDNDDSDNESTNNNQS 60

Query: 61  XXPHGASKFLPQVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKS 120
             PHGASKFLPQVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKS
Sbjct: 61  SSPHGASKFLPQVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKS 120

Query: 121 NLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPL 180
           NLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMS               PL
Sbjct: 121 NLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPL 180

Query: 181 AQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVY 240
           AQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVY
Sbjct: 181 AQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVY 240

Query: 241 CIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCC 300
           CIQWLCVCPLELVTSSMTIKYWTTKVDPD                GAKGYAEAEFFFNCC
Sbjct: 241 CIQWLCVCPLELVTSSMTIKYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCC 300

Query: 301 KVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXX 360
           KVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMD         
Sbjct: 301 KVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDTFVTAAFAF 360

Query: 361 XXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGG 420
                  LTAAEQSNPRKAIPSAAKKVAYR               VPYNSDQLMGSSSGG
Sbjct: 361 GATEFIALTAAEQSNPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGG 420

Query: 421 NSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDY 480
           NSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDY
Sbjct: 421 NSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDY 480

Query: 481 VDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRR 540
           VDRNGRPLRSMLC        FCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRR
Sbjct: 481 VDRNGRPLRSMLCAAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRR 540

Query: 541 GMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYL 600
           GMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYL
Sbjct: 541 GMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYL 600

Query: 601 AMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWK 660
           AMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWK
Sbjct: 601 AMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWK 660

Query: 661 RVVDFWC 667
           RVVDFWC
Sbjct: 661 RVVDFWC 667

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/633 (63%), Positives = 458/633 (72%), Gaps = 42/633 (6%)

Query: 69  FLPQVKNERFRNWLDSFKRAETPNASS---------------------------STADEN 101
           F+  +KN+R RN+L+ FKRAE  + SS                           S+   N
Sbjct: 52  FISNIKNKRIRNFLEGFKRAEHHDESSLANVDRITIAPSKDEPTEYPGNNQYQRSSPFSN 111

Query: 102 AVENYSMQEFD---NDLENKKS----NLHIRDDELDYATVNVDSQPVEQQDENAQLKQTI 154
            +E+      D   +DLENK+        I+D+EL      +  Q  +++D NA+L+QTI
Sbjct: 112 GLEDDQKVGPDIYIDDLENKQQVELIGTTIQDEEL------LPGQ--KKEDSNAELRQTI 163

Query: 155 KPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYS 214
           KPRHVIMMS               PLA AGPAPLVIGYGIMGTC+YCIIQACGE+AVAY 
Sbjct: 164 KPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYCIIQACGEMAVAYG 223

Query: 215 KVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXX 274
            + GSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT+SMTI+YWTTKVDPD     
Sbjct: 224 NLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQYWTTKVDPDVFVVI 283

Query: 275 XXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDP 334
                      GAKGYAEAEF FN CKV+M+ GFFI+AICI+TGAAGTDGYIGAKYWNDP
Sbjct: 284 FYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAGTDGYIGAKYWNDP 343

Query: 335 GAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXX 394
           GAFRGQTKIERFKGVMD                LTAAEQSNPRKAIPSAAKK+ YR    
Sbjct: 344 GAFRGQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKIIYRVLVI 403

Query: 395 XXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVA 454
                      VPY+SDQL+GS      ASPYVLA SLHGV V QHF+NAVIL+SV+SV 
Sbjct: 404 FLNTIILIGFLVPYDSDQLLGSGGSATKASPYVLAISLHGVRVAQHFVNAVILISVISVG 463

Query: 455 NSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFT 514
           NSAFYSSSRLL+ LAQ G APK FDYVDR GRPL +M C        FCATSPKET+VFT
Sbjct: 464 NSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCSAVIAVIAFCATSPKETEVFT 523

Query: 515 WLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLAL 574
           WL+AI+GLSQ+FTWFAIC+SH+RFRR M+VQGRSLGE+G+ +QTG+LGS YAAIM+ LAL
Sbjct: 524 WLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGYLSQTGILGSLYAAIMMILAL 583

Query: 575 VAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHR 634
           +AQFWVALVPM THT DA +FF NYLAMPIL+  Y G+K+W+RD+RLFIRAK+IDLISHR
Sbjct: 584 IAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKIWKRDWRLFIRAKDIDLISHR 643

Query: 635 IIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            I+DEELLRQEDEEY+EKLRNGPKWKRV  FWC
Sbjct: 644 TIYDEELLRQEDEEYREKLRNGPKWKRVAAFWC 676

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/594 (61%), Positives = 422/594 (71%), Gaps = 24/594 (4%)

Query: 79  RNWLDSFKRAET-PNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVD 137
           R ++DSFKRAE  PN   + A+              DLEN  +   I  + LD     V 
Sbjct: 86  RRFIDSFKRAEQQPNQQHNLAE--------------DLENDLTT-AISMNSLD----RVQ 126

Query: 138 SQPV---EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGI 194
           ++P    + + E   LK++IKPRHV+M+S                L  AGPA LVIGY I
Sbjct: 127 NKPTGNGQMKFEEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAI 186

Query: 195 MGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 254
           MG+C+YCIIQA GE+AV YS + G FNT+PS LVDPGF FAVAWVYC+QWLCVCPLELVT
Sbjct: 187 MGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVT 246

Query: 255 SSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAIC 314
           +S+TIKYWTT V+PD                GA+GYAEAEFFFNCCK++M+IGF+I+ I 
Sbjct: 247 TSLTIKYWTTTVNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGII 306

Query: 315 INTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQS 374
           IN G AG DGY+GAKYW+DPGAFRG   I+RFKG+M                 LTAAEQS
Sbjct: 307 INAGGAGNDGYLGAKYWHDPGAFRGTNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQS 366

Query: 375 NPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHG 434
           NPRKAIPSAAKKV YR               VP++SDQLMG+      ASPYVLA S+HG
Sbjct: 367 NPRKAIPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHG 426

Query: 435 VHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCX 494
           V VV HFINAVIL+SV SVANSAFYSSSRLLLGLAQ GYAPK+FDYVDR GRP R+M C 
Sbjct: 427 VRVVPHFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCA 486

Query: 495 XXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGF 554
                  FCA SPKE  VFTWLLAISGLSQ+FTW AICVSHIRFRR M VQGRSLGE+GF
Sbjct: 487 ALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGF 546

Query: 555 RAQTGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYVGFK 613
           +AQ GV GSYYA IM+ LAL+AQFWVA+ P+ N   LDAE FF+NYLAMPIL+A Y G+K
Sbjct: 547 KAQLGVYGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYK 606

Query: 614 LWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           LW+RD+RLFIRAK+IDL S+R +FDEELL+QEDEEYKEKL+NGP WKRVVDFWC
Sbjct: 607 LWKRDWRLFIRAKDIDLDSYRQVFDEELLKQEDEEYKEKLKNGPMWKRVVDFWC 660

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/589 (62%), Positives = 419/589 (71%), Gaps = 7/589 (1%)

Query: 79  RNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDS 138
           R+++DSFKRA+  +      D +   + S    D  L   K      DD +  +    + 
Sbjct: 56  RSFIDSFKRADRNSNPLHDLDNDITTSISRTSMDAALNKTKF-----DDAISSSISETNK 110

Query: 139 QPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTC 198
               Q +++  LK+TIKPRHVIM+S                L++AGPA LVIGY IMGTC
Sbjct: 111 G--HQNEKSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTC 168

Query: 199 LYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMT 258
           LYCIIQA GELAV YS +NG FN +PSFLVDP   F+VAWVYC+QWLCVCPLELVT+SMT
Sbjct: 169 LYCIIQAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMT 228

Query: 259 IKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTG 318
           IKYWTTKVDPD                GA+GYAEAEFFFNCCKV+MM GFFI+ I I  G
Sbjct: 229 IKYWTTKVDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAG 288

Query: 319 AAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRK 378
            AG DGY+GAKYW+DPGAF G   I+RFKGVMD                LTAAEQSNPRK
Sbjct: 289 GAGNDGYLGAKYWHDPGAFNGDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRK 348

Query: 379 AIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVV 438
           AIPSAAKKV YR               VPYNSDQL+GS   G  ASPYV+A S HGV VV
Sbjct: 349 AIPSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKASPYVIAVSSHGVRVV 408

Query: 439 QHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXX 498
            HFINAVILLSVLSV NSAFYSSSRLLL LAQ GYAPKWFDYVDR GRP R+ML      
Sbjct: 409 PHFINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFG 468

Query: 499 XXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQT 558
              FCATSPKET+VF+WLLAISGLSQ+FTW  ICVSHIRFRR MQVQGRSLGE+G+ +Q+
Sbjct: 469 VIAFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQS 528

Query: 559 GVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRD 618
           GV GS YAAIMLFLAL+AQFWVA+ P+    LDAENFFQNYLAMPIL+A Y G+++W+RD
Sbjct: 529 GVYGSAYAAIMLFLALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWKRD 588

Query: 619 FRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           ++LFIRAK+IDL +HR IFDE +LRQEDEEYKEKLRNGP W+R + FWC
Sbjct: 589 WKLFIRAKDIDLDTHRQIFDENILRQEDEEYKEKLRNGPMWRRFLAFWC 637

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/598 (59%), Positives = 422/598 (70%), Gaps = 16/598 (2%)

Query: 74  KNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYAT 133
           K  R RN++DSFKRAE    + +    N+         ++DLEN    L+  D       
Sbjct: 94  KPSRIRNFMDSFKRAEQHPTNVNNNGANS---------ESDLENMI--LYNEDGTPKPLP 142

Query: 134 VNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYG 193
            + D+Q +    ++ +LK+TIKPRHV+M+S                L QAGPA L+IG+G
Sbjct: 143 HHHDAQ-INDNSKSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFG 201

Query: 194 IMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELV 253
           IMG+CLYCIIQA GELAVAYS + G FN +PSFLVD  F FAVAW+Y IQWLCVCPLELV
Sbjct: 202 IMGSCLYCIIQAVGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELV 261

Query: 254 TSSMTIKYWTTKVDPDX-XXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMA 312
           T+SMTIKYWTTKVDPD                 GA GYAEAEF FN CK+MMMIGFFI+ 
Sbjct: 262 TASMTIKYWTTKVDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILG 321

Query: 313 ICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAE 372
           I +  G AGTDGYIGAKYW+DPGA RG T I+RFKG M                 +TA+E
Sbjct: 322 ITVICGGAGTDGYIGAKYWHDPGALRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASE 381

Query: 373 QSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASL 432
           QSNPRKAIPSAAKK+ YR               VPYNSDQL+GS+  G  ASPYVLA S 
Sbjct: 382 QSNPRKAIPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAIST 441

Query: 433 HGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSML 492
           HGV VV HFINAVIL+SVLSVANSA+YSSSR+LL LA+ GYAPK + Y+DR GRPL  M 
Sbjct: 442 HGVRVVPHFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMA 501

Query: 493 CXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGEL 552
                    FCATSPKE +VF WLLAISGLSQ+FTW AIC+SHIRFRR M VQGRS+GEL
Sbjct: 502 TAAIFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGEL 561

Query: 553 GFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMN---THTLDAENFFQNYLAMPILLALY 609
           GFR+Q G  GS YAAIM+F+ L+AQFWVALVP+N   T  LDA+NFF+NYLAMPILLA Y
Sbjct: 562 GFRSQVGWYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFY 621

Query: 610 VGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            G+K+W++D++LFIRAKNIDLISHR IFDEEL++QE++EY+E+LR GPKW+RV DFWC
Sbjct: 622 FGYKIWKKDWKLFIRAKNIDLISHRNIFDEELIKQEEDEYRERLRTGPKWRRVYDFWC 679

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  712 bits (1839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/603 (58%), Positives = 425/603 (70%), Gaps = 19/603 (3%)

Query: 74  KNERFRNWLDSFKRAE-----TPNASSSTADENA--VENYSMQEFDNDLENKKSNLHIRD 126
           K    R ++DSFKRAE     +P++S+S          N S  + DN+L  K S      
Sbjct: 69  KASHLRRFIDSFKRAEGSHPNSPDSSNSIGGGATPISTNDSSSQLDNELNPKGS------ 122

Query: 127 DELDYATVNVDSQPVEQQDENAQ-LKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGP 185
               + T +   QP ++QD+N + LK+TIKPRH++MMS                L  AGP
Sbjct: 123 ----FVTESGIKQPSQEQDQNQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGP 178

Query: 186 APLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWL 245
           A LVIGY IMG+C+YCIIQACGELAV YS + G FNT+PSFLVDP   F+VAWVYC+QWL
Sbjct: 179 AGLVIGYAIMGSCIYCIIQACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWL 238

Query: 246 CVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMM 305
           CVCPLELVT+SMTIKYWT KVDPD                GAKGYAEA+FFFNCCK++M+
Sbjct: 239 CVCPLELVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMI 298

Query: 306 IGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXX 365
           IGFFI+AI I+ G AGTDGYIG++YW++PGAFRG T I+RFKGV+               
Sbjct: 299 IGFFILAIIIDCGGAGTDGYIGSRYWHNPGAFRGNTGIQRFKGVVATFVTAAFAFGMSEQ 358

Query: 366 XXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASP 425
             +TA+EQSNPRKAIPSAAKK+ YR               VPY SDQL+G+S     ASP
Sbjct: 359 LAMTASEQSNPRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATKASP 418

Query: 426 YVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNG 485
           YV+A + HGV VV HFINAVILLSVLSVAN AFYSSSR+L+ LA+ G APK FDY+DR G
Sbjct: 419 YVIAVASHGVRVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREG 478

Query: 486 RPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQ 545
           RP  +ML         FCA+SPKE DVFTWLLAISGLSQ+FTW  IC+SHIRFRR M+VQ
Sbjct: 479 RPAVAMLVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQ 538

Query: 546 GRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPI 604
           GRSLGE+G+++Q G+ GS YA +M+ LAL+AQFWVA+ P+     L A++FF+NYLAMPI
Sbjct: 539 GRSLGEVGYKSQVGIWGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSFFENYLAMPI 598

Query: 605 LLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVD 664
           L+ALYV +K+W++D+ LFI A  IDL++ R IFDEELL+QEDEEY+EKLRNGP WKRVVD
Sbjct: 599 LIALYVFYKVWKKDWTLFIPADKIDLVTDRQIFDEELLKQEDEEYQEKLRNGPYWKRVVD 658

Query: 665 FWC 667
           FWC
Sbjct: 659 FWC 661

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/591 (59%), Positives = 411/591 (69%), Gaps = 12/591 (2%)

Query: 77  RFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNV 136
           +FR ++DSFKRAE  N S  T+  +   + S +  D D   + ++L ++++++     N 
Sbjct: 45  QFRRFVDSFKRAEQQNNSEITSAASC--DGSSENLDKD-GKEVADLEVQENQVLTEKSN- 100

Query: 137 DSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMG 196
                    +N +LKQTIKPRHVI++S                L  AGPA L+IGY IMG
Sbjct: 101 --------QKNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMG 152

Query: 197 TCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSS 256
           TCLYCIIQA GELAV+YS ++G FN +PSFLVDP F F+VAWVYCIQWLCVCPLELVT+S
Sbjct: 153 TCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTAS 212

Query: 257 MTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICIN 316
           MTIKYWTT V+ D                GA+GYAEAEFFFNCCK++MMIGFFI+ I IN
Sbjct: 213 MTIKYWTTTVNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVIN 272

Query: 317 TGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNP 376
           TG AG DGYIG +YW+ PGAF G   I+ FKG+M                 LTAAEQSNP
Sbjct: 273 TGGAGNDGYIGDRYWHTPGAFAGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNP 332

Query: 377 RKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVH 436
           RKAIPSAAKKV YR               VPY+SDQLMGS      ASPYVLA S HGV 
Sbjct: 333 RKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKASPYVLAVSTHGVK 392

Query: 437 VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXX 496
           VV HFINAVILLSVLSV NSAFYSSSRLL  LAQ G APK+FDYVDR GRP R+M+C   
Sbjct: 393 VVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGV 452

Query: 497 XXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRA 556
                FCA SPKE  VFTWLLAISGLSQ+FTWFAIC+SHIRFR+ M VQ RSLGE+GF+A
Sbjct: 453 FAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKA 512

Query: 557 QTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWR 616
           QTGV GSYY   ML + L+AQFWVA+ P+    LDA+ FF+NYLAMPIL+  YVG+K+W+
Sbjct: 513 QTGVWGSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYKIWK 572

Query: 617 RDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +D+ LFIRA NIDL  HR IFDEELL+QEDEEY+EKL+NG   KR+  FWC
Sbjct: 573 KDWSLFIRANNIDLDKHRQIFDEELLKQEDEEYREKLKNGGYLKRIAAFWC 623

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/599 (59%), Positives = 428/599 (71%), Gaps = 22/599 (3%)

Query: 77  RFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHI--------RDDE 128
            F++++DSF+R +          +NA     + + +ND+    S+  +         DDE
Sbjct: 55  HFKSFVDSFRRGDHA--------KNA-----LHDLENDITTSISHASLVHAVSKAREDDE 101

Query: 129 LDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPL 188
           +  +  + + + V    E+  L++TIKPRHVIM+S                L+ AGPAPL
Sbjct: 102 IMQSVASAEHRKVNNT-ESDDLQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPL 160

Query: 189 VIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVC 248
           VIGY IMG+CLYCIIQA GE+AV YS +NG FN +PSFL+DP   F+VAWVYC+QWLCVC
Sbjct: 161 VIGYSIMGSCLYCIIQAAGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLCVC 220

Query: 249 PLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGF 308
           PLELVT+S+TIKYWTTKVDPD                GA+GYAEAEFFFN CKV+MMIGF
Sbjct: 221 PLELVTASLTIKYWTTKVDPDVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLMMIGF 280

Query: 309 FIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXL 368
           FI+ I I  G AG DGY+GAKYW++PGAFRG+  ++RFKGVMD                L
Sbjct: 281 FILGIIITAGGAGNDGYLGAKYWHEPGAFRGEHAVDRFKGVMDTFVAAAFAFGATEFIAL 340

Query: 369 TAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVL 428
           TAAEQSNPRKAIPSAAKKV YR               VPY+SDQL+GSS  G  ASPYVL
Sbjct: 341 TAAEQSNPRKAIPSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLLGSSGSGVKASPYVL 400

Query: 429 AASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPL 488
           A SLHGV VV HFINAVILLSVLSV NSAFYSSSRLLL L+Q GYAPKWFDYVDR GRP 
Sbjct: 401 AVSLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPA 460

Query: 489 RSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRS 548
           R+ML         FCATSPKETDVF WLLAISGLSQ+FTWFAIC+SH+RFR  M+VQGRS
Sbjct: 461 RAMLMSALFGVIAFCATSPKETDVFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRS 520

Query: 549 LGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLAL 608
           +GE+GF +QTGV GS YAA M+ LAL+AQFWVA+ P+N   LDA+NFFQ+YLAMPIL+AL
Sbjct: 521 IGEVGFHSQTGVYGSLYAATMMILALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIAL 580

Query: 609 YVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           Y G+KL+ RD++L+I+A  IDLISHR IFDE +L+QEDEEYKEKLRNGP W+R+ DFWC
Sbjct: 581 YFGYKLYYRDWKLYIKADKIDLISHRQIFDENILKQEDEEYKEKLRNGPAWRRIADFWC 639

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/597 (57%), Positives = 418/597 (70%), Gaps = 17/597 (2%)

Query: 78  FRNWLDSFKRAETPNASSSTADENAV-----ENYSMQEFDNDLENKKSNLHIRDDELDYA 132
            R ++DSFKRAE  +A+SS +  +        N S  + DN+L  K S          Y 
Sbjct: 77  LRRFIDSFKRAEGSHANSSDSSNSNTTTPIFTNDSSSQLDNELNRKSS----------YI 126

Query: 133 TVN-VDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIG 191
           TV+ +   P EQ+ +   LK++IKPRH +MMS                L  AGP  L+IG
Sbjct: 127 TVDGIKQAPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIG 186

Query: 192 YGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLE 251
           Y IMG+C+YCIIQACGELAV YS + G FNT+P FLVDP   F+VAW++C+QWLCVCPLE
Sbjct: 187 YAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLE 246

Query: 252 LVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIM 311
           LVT+SMTIKYWT KVDPD                GAKGYAEA+FFFNCCK++M+IGFFI+
Sbjct: 247 LVTASMTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFIL 306

Query: 312 AICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAA 371
           AI I+ G AGTDGYIG+KYW DPGAFRG T I+RFKG++                 +TA+
Sbjct: 307 AIIIDCGGAGTDGYIGSKYWRDPGAFRGDTPIQRFKGIVATFVTAAFAFGMSEQLAMTAS 366

Query: 372 EQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAAS 431
           EQSNPRKAIPSAAKK+ YR               VPY SDQL+G++     ASPYV+A S
Sbjct: 367 EQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVS 426

Query: 432 LHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
            HGV VV HFINAVILLSVLSVANSAFY+SSR+L+ LA+ G APK FDY+DR GRP  +M
Sbjct: 427 SHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAM 486

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
           L         FCA+S KE DVFTWLLAISGLSQ+FTW  IC+SHIRFRR M+VQGRSLGE
Sbjct: 487 LVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGE 546

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYV 610
           +G+++Q GV GS YA +M+ LAL+AQFWVA+ P+     L A++FF+NYLAMPIL+ALY+
Sbjct: 547 VGYKSQVGVWGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYI 606

Query: 611 GFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            FK+W+ D+ LFI A  +DL+SHR IFDEELL+QEDEEYKE+LRNGP WKR+VDFWC
Sbjct: 607 FFKVWKNDWSLFIPANKVDLVSHRNIFDEELLKQEDEEYKERLRNGPYWKRIVDFWC 663

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/597 (56%), Positives = 416/597 (69%), Gaps = 17/597 (2%)

Query: 78  FRNWLDSFKRAE-----TPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYA 132
            R ++DSF+RAE     +P++S+S          S  + DN+L  K S          Y 
Sbjct: 77  LRRFIDSFRRAEGSHANSPDSSNSNGTTPISTKDSSSQLDNELNRKSS----------YI 126

Query: 133 TVN-VDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIG 191
           TV+ +   P EQ+ +   LK++IKPRH +MMS                L  AGP  L+IG
Sbjct: 127 TVDGIKQSPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIG 186

Query: 192 YGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLE 251
           Y IMG+C+YCIIQACGELAV YS + G FNT+P FLVDP   F+VAW++C+QWLCVCPLE
Sbjct: 187 YAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLE 246

Query: 252 LVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIM 311
           LVT+SMTIKYWTT V+PD                GAKGYAEA+FFFNCCK++M++GFFI+
Sbjct: 247 LVTASMTIKYWTTSVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFIL 306

Query: 312 AICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAA 371
           AI I+ G AGTDGYIG+KYW DPGAFRG T I+RFKGV+                 +TA+
Sbjct: 307 AIIIDCGGAGTDGYIGSKYWRDPGAFRGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTAS 366

Query: 372 EQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAAS 431
           EQSNPRKAIPSAAKK+ YR               VPY SDQL+G++     ASPYV+A S
Sbjct: 367 EQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVS 426

Query: 432 LHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
            HGV VV HFINAVILLSVLSVAN AFY+SSR+L+ LA+ G APK FDY+DR GRP  +M
Sbjct: 427 SHGVRVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAM 486

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
           L         FCA+S KE DVFTWLLAISGLSQ+FTW  IC+SHIRFRR M+VQGRSLGE
Sbjct: 487 LVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGE 546

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYV 610
           +G+++Q GV GS YA +M+ LAL+AQFWVA+ P+     L A++FF+NYLAMPI +ALY+
Sbjct: 547 VGYKSQVGVWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYI 606

Query: 611 GFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            +K+W++D+ LFI A  +DL+SHR IFDEELL+QEDEEYKE+LRNGP WKRV+DFWC
Sbjct: 607 FYKVWKKDWSLFIPADKVDLVSHRNIFDEELLKQEDEEYKERLRNGPYWKRVLDFWC 663

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/596 (56%), Positives = 414/596 (69%), Gaps = 12/596 (2%)

Query: 72  QVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDY 131
           Q      R + DSFK+A+        + E  VE   M    NDL +  S    +  EL+ 
Sbjct: 50  QHNTSALRRFFDSFKKADQ-------SAEERVETAQM----NDLASAISPSSRQRQELE- 97

Query: 132 ATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIG 191
              + D+      +++  LK+TI+PRHV+M++                L  AGPA L+IG
Sbjct: 98  KNESSDNIGARTGNKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIG 157

Query: 192 YGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLE 251
           YGIMG+ LYCIIQACGE+A+ YS + G +N +PSFLVD GF FAVAWVYC+QWLCVCPLE
Sbjct: 158 YGIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLE 217

Query: 252 LVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIM 311
           LVT+SMTIKYWTT V+PD                GA+GYAEAEFFFNCCK++MM GFFI+
Sbjct: 218 LVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFIL 277

Query: 312 AICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAA 371
            I I+ G AG DG+IG KYW+DPGAF G+  I+RFKGV+                 +T A
Sbjct: 278 GIIIDVGGAGNDGFIGGKYWHDPGAFNGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTA 337

Query: 372 EQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAAS 431
           EQ+NPRKA+P AAK++ YR               VPYNS+QL+GSS GG  ASPYV+A +
Sbjct: 338 EQANPRKAVPGAAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVA 397

Query: 432 LHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
            HGV VV HFINAVILLSVLS+ANS+FYSS+R+LL L++ GYAP+ F Y+D+ GRPL +M
Sbjct: 398 SHGVRVVPHFINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAM 457

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
                     FCA SPKE  VFTWLLAISGLSQ+FTW AIC+SHIRFRR M+VQGRSLGE
Sbjct: 458 GVSALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGE 517

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVG 611
           LGFR+QTGV GS YA IM+ L L+ QFWVA+ P+    LDA+ FF+NYLAMPIL+ALYVG
Sbjct: 518 LGFRSQTGVWGSTYACIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVG 577

Query: 612 FKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +K+W++D++LFIRA  IDLISHR IFDEEL++QEDEE++E+L+NGP WKRVV FWC
Sbjct: 578 YKIWKKDWKLFIRADKIDLISHRQIFDEELIKQEDEEFRERLKNGPCWKRVVAFWC 633

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/596 (56%), Positives = 411/596 (68%), Gaps = 12/596 (2%)

Query: 72  QVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDY 131
           Q      R + DSFKRA+          ++ VE   M +  + +    S+   ++ E + 
Sbjct: 50  QHNTSAVRRFFDSFKRADQ-------GPQDEVEATQMNDLTSAIS--PSSRQAQELEKNE 100

Query: 132 ATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIG 191
           ++ N+ +    + D    LK+TI+PRHV+M++                L  AGPA L+IG
Sbjct: 101 SSDNIGANTGHKSDS---LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIG 157

Query: 192 YGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLE 251
           Y IMG+ LYCIIQACGE+A+ YS + G +N +PSFLVD GF FAVAWVYC+QWLCVCPLE
Sbjct: 158 YAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLE 217

Query: 252 LVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIM 311
           LVT+SMTIKYWTT V+PD                GA+GYAEAEFFFNCCK++MM GFFI+
Sbjct: 218 LVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFIL 277

Query: 312 AICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAA 371
            I I+ G AG DG+IG KYW+DPGAF G+  I+RFKGV                  +T A
Sbjct: 278 GIIIDVGGAGNDGFIGGKYWHDPGAFNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTA 337

Query: 372 EQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAAS 431
           EQSNPRKAIP AAK++ YR               VPYNSDQL+GS+ GG  ASPYV+A +
Sbjct: 338 EQSNPRKAIPGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVA 397

Query: 432 LHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
            HGV VV HFINAVILLSVLS+ANS+FYSS+RL L L++ GYAPK F Y+DR GRPL +M
Sbjct: 398 SHGVRVVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAM 457

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
                     FCA SPKE  VFTWLLAISGLSQ+FTW AIC+SH+RFRR M+VQGRSLGE
Sbjct: 458 GVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGE 517

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVG 611
           LGF++QTGV GS YA IM+ L L+AQFWVA+ P+    LDA+ FF+NYLAMPIL+ALYVG
Sbjct: 518 LGFKSQTGVWGSAYACIMMILILIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVG 577

Query: 612 FKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +K+W +D++LFIRA  IDL SHR IFDEEL++QEDEEY+E+LRNGP WKRVV FWC
Sbjct: 578 YKVWHKDWKLFIRADKIDLDSHRQIFDEELIKQEDEEYRERLRNGPYWKRVVAFWC 633

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/597 (56%), Positives = 414/597 (69%), Gaps = 17/597 (2%)

Query: 78  FRNWLDSFKRAET--PNASSSTADENAV---ENYSMQEFDNDLENKKSNLHIRDDELDYA 132
           F  ++DSF+RAE   PN+  ST    +       S    DN+L  K S          Y 
Sbjct: 77  FHRFIDSFRRAEGSHPNSPDSTNLNGSTPISTKDSSSRLDNELNPKSS----------YI 126

Query: 133 TVN-VDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIG 191
           TV+ +     EQ+ +   LK++IKPRH +MMS                L  AGP  L+IG
Sbjct: 127 TVDGIKQSSQEQEPKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIG 186

Query: 192 YGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLE 251
           Y IMG+C+YCIIQACGELAV YS + G FNT+PSFLVDP   F+VAW++C+QWLCVCPLE
Sbjct: 187 YAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLE 246

Query: 252 LVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIM 311
           LVT+SMTIKYWT KV+ D                GAKGYAEA+FFFNCCK++M+ GFFI+
Sbjct: 247 LVTASMTIKYWTVKVNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFIL 306

Query: 312 AICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAA 371
           AI I+ G AGTDGYIG++YW DPGAFRG T I+RFKGV+                 +TA+
Sbjct: 307 AIIIDCGGAGTDGYIGSRYWRDPGAFRGDTSIQRFKGVVATFVTAAFAFGMSEQLAMTAS 366

Query: 372 EQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAAS 431
           EQSNPRKAIPSAAKK+ YR               VPY SDQL+G++     ASPYV+A S
Sbjct: 367 EQSNPRKAIPSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSATKASPYVIAVS 426

Query: 432 LHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
            HGV VV HFINAVILLSVLSVANSAFY+SSR+L+ LA+ G APK FDY+DR GRP  +M
Sbjct: 427 SHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAM 486

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
           +         FCA+S KE DVFTWLLAISGLSQ+FTW  IC+SHIRFR+GM+VQGRSLGE
Sbjct: 487 IVSAVFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGE 546

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYV 610
           +G+++Q GV GS YA +++ LAL+ QFWVA+ P+     L A++FF+NYLAMPIL+ALY+
Sbjct: 547 VGYKSQVGVWGSAYAVVLMVLALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYI 606

Query: 611 GFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            +K+W+RD+ LFI A  IDL+SHR IFDEELL+QEDEEYK++LRNGP WKRV+DFWC
Sbjct: 607 FYKVWKRDWSLFIPADKIDLVSHRNIFDEELLKQEDEEYKDRLRNGPFWKRVLDFWC 663

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/607 (56%), Positives = 419/607 (69%), Gaps = 25/607 (4%)

Query: 64  HGASKFLP--QVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSN 121
           +G  K LP   +K    R  +DSF+RAE  +A ++            ++ +N+L    S 
Sbjct: 64  NGKKKILPSFNIKQPHLRKLIDSFRRAEDIDAPTN------------RDIENELTTTLSP 111

Query: 122 LHIRDDELDYATVNVDSQP-VEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPL 180
           L         AT +    P  E++D++  L++TIKPRHV++MS                L
Sbjct: 112 LS--------ATKDPQFAPHAEEKDDH--LQKTIKPRHVLLMSLGTGIGTGLLVGNGSAL 161

Query: 181 AQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVY 240
            +AGP  LVIGY IMG+CLYCIIQACGE+AVAYS + G+FN +PSFLVD  F F+VAWVY
Sbjct: 162 HKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVY 221

Query: 241 CIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCC 300
           C+QWLCV PLELVT+SMTI+YWTT V+ D                GAKGYAEAEFFFN C
Sbjct: 222 CLQWLCVMPLELVTASMTIQYWTTTVNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSC 281

Query: 301 KVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXX 360
           KV+MM GFFI+AI INTG AG DGYIGAKYW++PGAFRG   I+RFK VM          
Sbjct: 282 KVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSTFTTAAFAF 341

Query: 361 XXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGG 420
                  + A+EQSNPR+AIPSAAK + YR               VPYNS +LMGS S  
Sbjct: 342 GASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAA 401

Query: 421 NSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDY 480
             ASPYV+A + HGV VV HFINAVILLSVLSVANSAFYSS R+L  L+Q GYAP WF+Y
Sbjct: 402 TKASPYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNY 461

Query: 481 VDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRR 540
           +DR GRP R+M+         FCA S KE DVFTWLLAISGLSQ+FTW AICVSHIRFRR
Sbjct: 462 IDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRR 521

Query: 541 GMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYL 600
            M+VQGRS+ E+GF++Q GV GS YAAIM+ LAL+A+FWV++ P+    LDA+NFF+NYL
Sbjct: 522 AMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYL 581

Query: 601 AMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWK 660
           AMPIL+ LY G+K+ +RD++LFIRAK+IDL+SHR I+D EL++QE+EE+KE+LRNGP WK
Sbjct: 582 AMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYDGELIKQEEEEFKERLRNGPFWK 641

Query: 661 RVVDFWC 667
           +VV FWC
Sbjct: 642 KVVAFWC 648

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  686 bits (1771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/596 (55%), Positives = 403/596 (67%), Gaps = 12/596 (2%)

Query: 72  QVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDY 131
           Q      R + DSFKRA+      S       E   M +  + +     N    +     
Sbjct: 50  QHNTSAVRRFFDSFKRADQGGQDES-------EAVQMNDLTSAISPSSRNAQGLEKNDST 102

Query: 132 ATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIG 191
             +N  +      +++  LK+TI+PRHV+M++                L  AGPA L+IG
Sbjct: 103 DKINPPAG-----NKSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIG 157

Query: 192 YGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLE 251
           Y IMG+ LYCIIQACGELA+ YS + G +N +PSFLVD GF FAVAWVYC+QWLCVCPLE
Sbjct: 158 YAIMGSILYCIIQACGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLE 217

Query: 252 LVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIM 311
           LVT+SMTIKYWTT V+PD                GA+GYAEAEFFFNCCK++MM GFFI+
Sbjct: 218 LVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFIL 277

Query: 312 AICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAA 371
           +I I+ G AG DG+IG KYW+DPGAF G+  I+RFKGV+                 +T A
Sbjct: 278 SIIIDVGGAGNDGFIGGKYWHDPGAFNGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTA 337

Query: 372 EQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAAS 431
           EQSNPRKAIP AAK++ YR               VPYNSDQL+GS  GG  ASPYV+A +
Sbjct: 338 EQSNPRKAIPGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIA 397

Query: 432 LHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
            HGV VV HF+NAVILLSVLS+ANS+FYSS+RL L L++ GYAPK+F Y+DR GRPL +M
Sbjct: 398 SHGVRVVPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAM 457

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
                     FCA SPKE  VFTWLLAISGLSQ+FTW AIC SHIRFRR M+VQGRSLGE
Sbjct: 458 GVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGE 517

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVG 611
           LGF++QTGV GS YA IM+ L L+ QFWVA+ P+    LDA+ FF+NYLAMPIL+ALYVG
Sbjct: 518 LGFKSQTGVWGSMYACIMMLLILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVG 577

Query: 612 FKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +K+W +D++LFIRA  IDL SHR IFDEEL++QEDEEY+E+LRNGP WKRV  FWC
Sbjct: 578 YKIWTKDWKLFIRADKIDLESHRQIFDEELIKQEDEEYRERLRNGPYWKRVAAFWC 633

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/596 (55%), Positives = 401/596 (67%), Gaps = 12/596 (2%)

Query: 72  QVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDY 131
           Q      R +LDSFKRA+          E   E   M +  + +       H  + E D 
Sbjct: 50  QHNTSAVRRFLDSFKRADQDQ-------EQEAEVAQMNDLTSAISPSSRQAH--ELEKDE 100

Query: 132 ATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIG 191
            T  +      + D    LK+TI+PRHV+M++                L  AGPA L+IG
Sbjct: 101 TTDKIAPHTGHKSDS---LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIG 157

Query: 192 YGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLE 251
           Y IMG+ LYCIIQACGE+A+ YS + G +N +PSFLVD GF FAVAWVYC+QWLCVCPLE
Sbjct: 158 YAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLE 217

Query: 252 LVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIM 311
           LVT+SMTIKYWTT V+PD                GA+GYAEAEFFFNCCK++MM GFFI+
Sbjct: 218 LVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFIL 277

Query: 312 AICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAA 371
            I I+ G AG DGYIG KYW++PGAF G   I+RFKGV+                 +T A
Sbjct: 278 GIIIDVGGAGNDGYIGGKYWHEPGAFNGVHAIDRFKGVVATLVTAAFAFGGSEFIAITTA 337

Query: 372 EQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAAS 431
           EQSNPRKAIP AAK++ YR               VPYNSDQL+GSS GG  ASPYV+A +
Sbjct: 338 EQSNPRKAIPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKASPYVIAIA 397

Query: 432 LHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
            HGV V  HF+NAVILLSVLS+ANS+FYSS+RL L L++ GYAPK F Y+DR GRPL +M
Sbjct: 398 SHGVRVAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAM 457

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
                     FCA SPKE  VFTWLLAISGLSQ+FTW AIC+SHIRFRR M+VQGRSLGE
Sbjct: 458 CVSALFAVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGE 517

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVG 611
           LGF++QTGV GS Y+ IM+ L L+ QFWVA+ P+    LDA+ FF+NYLAMPIL+ LYVG
Sbjct: 518 LGFKSQTGVWGSIYSCIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVG 577

Query: 612 FKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +K+W +D++LFIRA  IDL SHR IFDEEL++QED+EY+E+LR GP W+RV+ FWC
Sbjct: 578 YKMWNKDWKLFIRADKIDLTSHRQIFDEELIKQEDDEYRERLRTGPYWRRVLAFWC 633

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/594 (55%), Positives = 408/594 (68%), Gaps = 10/594 (1%)

Query: 74  KNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYAT 133
           K    + ++DSFK+   PN+    A E         +++  LEN  +   +     +   
Sbjct: 64  KKSNIKRFIDSFKQPIRPNSDYIDAAE--------LDYEQALENGITT-SVSPSAPNLRK 114

Query: 134 VNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYG 193
           +N    P +  D N  LKQTI+PRHV+M+S                L  AGPA LVIGY 
Sbjct: 115 LNQLRTPTDAND-NKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYS 173

Query: 194 IMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELV 253
           IMG+ +YCIIQA GE+A+AYS + G +N +PSFLV+ GF FA+AWVYCIQWL VCPLELV
Sbjct: 174 IMGSIIYCIIQATGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELV 233

Query: 254 TSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAI 313
           T+S+TIKYWTT V+ D                GAKGYAEAEFF NCCKV+MMIGFFI++I
Sbjct: 234 TASLTIKYWTTSVNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSI 293

Query: 314 CINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQ 373
            I  G AG DGY+G  YW+ PGAFRG + I+ FKG+                  LTAAEQ
Sbjct: 294 TITAGGAGNDGYLGGLYWHTPGAFRGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQ 353

Query: 374 SNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLH 433
           SNPR AIPSAAKKV YR               VP++S +L+GS     SASPYVLAASLH
Sbjct: 354 SNPRAAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASLH 413

Query: 434 GVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLC 493
           GV VV HFINAVIL+SVLSV NSAFYSSSRLL+ LA+ GYAPKWFDY+DR GRP R+ML 
Sbjct: 414 GVRVVPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLM 473

Query: 494 XXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELG 553
                   FCA SPKET+VFTWLLAISGLSQ+FTW AIC+SHIRFR  M+VQGRSLGE+G
Sbjct: 474 SALFGVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVG 533

Query: 554 FRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFK 613
           + AQTGV GS+YA  M+FL  +AQFWVA+ P+ +  L A+NFF+NYLAMPIL+ LY+G+K
Sbjct: 534 YLAQTGVWGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYK 593

Query: 614 LWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           ++ +D+ L I+A++IDL SHR IFDE+LL++ED EY+++L+NGP W+RVVDFWC
Sbjct: 594 IYYKDWTLLIKAEDIDLQSHRQIFDEDLLKEEDFEYRQRLKNGPFWRRVVDFWC 647

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/594 (56%), Positives = 409/594 (68%), Gaps = 27/594 (4%)

Query: 75  NERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATV 134
           N RFR ++DSFK+AE P   S   D  A         D+D+E K                
Sbjct: 60  NTRFRRFIDSFKKAEGPQPGSLDHDVLAG--------DSDIEGKPR-------------- 97

Query: 135 NVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGI 194
              ++P E+ D+  +LK+TIKPRHV+M+S                LA +GPA LVIGY I
Sbjct: 98  ---TEP-EKDDDARELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAI 153

Query: 195 MGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 254
           MG+C+YCIIQA GELAV Y+K+ G FN +PS L+DP F FAVAWVYCIQWLCVCPLELVT
Sbjct: 154 MGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVT 213

Query: 255 SSMTIKYWTTKVDPDXXXXXXXXXXX-XXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAI 313
           +SMTIKYWTTKVDPD                 GA GYAEAEFFFN  K++M+ GFFI+ I
Sbjct: 214 ASMTIKYWTTKVDPDVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGI 273

Query: 314 CINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQ 373
            +  G AG DGYIG + W++PG+FRG   ++RFKGV+                 +TA+EQ
Sbjct: 274 VVICGGAGNDGYIGTRLWHNPGSFRGDKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQ 333

Query: 374 SNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLH 433
           SNPRKAIPSAAKK+ YR               VPY+SDQL+GSS     ASPYVLA SLH
Sbjct: 334 SNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKASPYVLAISLH 393

Query: 434 GVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLC 493
           GV VV HFINAVILLSVLSV NSAFYSSSR LL L+Q+GYAP + +YVDRNGRPL++   
Sbjct: 394 GVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYCV 453

Query: 494 XXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELG 553
                   FCATSPKE  VF WLLAISGLSQ+FTWF+IC+SH+RFRR M+VQGRS+GE+G
Sbjct: 454 SALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVG 513

Query: 554 FRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFK 613
           F++Q G+ GS Y+ +M+ L L+AQFW ALVP+     D + FF+NYLAMPI + LY GFK
Sbjct: 514 FKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIVLYFGFK 573

Query: 614 LWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +W++D+RLFIRA++IDL+SHR IFDEELL+QEDEEY+ KLR+GP W+RV DFWC
Sbjct: 574 IWKKDWRLFIRAEDIDLVSHREIFDEELLKQEDEEYRRKLRDGPMWRRVYDFWC 627

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  673 bits (1737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/596 (55%), Positives = 409/596 (68%), Gaps = 25/596 (4%)

Query: 73  VKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYA 132
           +     R ++DSF+RAE         DE   E+   +       +K   LH +       
Sbjct: 66  ITKPHVRKFVDSFRRAED--------DEETAEDLENELVSTLSPSKSKQLHGQ------- 110

Query: 133 TVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGY 192
                    +  D++A L+++I+PRHV+MMS                L++AGP  LVIGY
Sbjct: 111 ---------KNGDDDAHLQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGY 161

Query: 193 GIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLEL 252
           GIMG+CLYCIIQACGE+AV YS + G+FN +PSFLVD G  F VAWVYC+QWLCV PLEL
Sbjct: 162 GIMGSCLYCIIQACGEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLEL 221

Query: 253 VTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMA 312
           VT+SMTI YWTTKV+ D                GAKGYAEAEFFFN CKV+MM GFFI+A
Sbjct: 222 VTASMTIDYWTTKVNSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILA 281

Query: 313 ICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAE 372
           I INTG AG DGYIGAKYW++PGAFRG   I+RFK VM                 + A+E
Sbjct: 282 IVINTGGAGNDGYIGAKYWHNPGAFRGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASE 341

Query: 373 QSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSAS-PYVLAAS 431
           QSNPR+AIPSAAK + YR               VPY+S +L+GS    +S + PYV+A +
Sbjct: 342 QSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQASPYVIAVA 401

Query: 432 LHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
            HGV VV HFINAVILLSVLSVANSA+YSS R+L  LAQ GYAPKWF+Y+DR GRP R+M
Sbjct: 402 SHGVRVVPHFINAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAM 461

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
           L         FC+ S KE DVF WLL+I+GLSQ+FTW AIC+SHIRFRR M+VQGRS+ E
Sbjct: 462 LVTTIFGVIAFCSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDE 521

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVG 611
           +GF++Q GV GS YAAIM+ LAL+A+FWV++ P+    LDA+NFF+NYLAMPIL+ LY G
Sbjct: 522 IGFKSQVGVWGSGYAAIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFG 581

Query: 612 FKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +K++++D++LFIRAK+IDLISHR IFD EL+RQE+EEYKEKLRNGPKWKRVV FWC
Sbjct: 582 YKIYKKDWKLFIRAKDIDLISHRTIFDGELVRQEEEEYKEKLRNGPKWKRVVAFWC 637

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/595 (57%), Positives = 411/595 (69%), Gaps = 21/595 (3%)

Query: 73  VKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYA 132
           VK    + ++DSFKRAE          E   E   M+    +L    S L     E D A
Sbjct: 71  VKEPHLKRFIDSFKRAE----------EGTEETKHME---TELTTTLSPLSAAIKEHDVA 117

Query: 133 TVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGY 192
                   +  ++E+A L+++I+PRHV+M S                L +AGPA LVIGY
Sbjct: 118 --------ITSKEEDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGY 169

Query: 193 GIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLEL 252
            IMGTCLYCIIQACGE+AV+YS + G+FN +P+FLVD GF FAVAWVYCIQWLCV PLEL
Sbjct: 170 AIMGTCLYCIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLEL 229

Query: 253 VTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMA 312
           VT+SMTI YWTTKV+ D                GAKGYAEA+FFFN CKV+M+ GFFI+A
Sbjct: 230 VTASMTIDYWTTKVNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILA 289

Query: 313 ICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAE 372
           I IN G AGT GYIGAKYW+DPGAFRG   I+RFK VM                 + A+E
Sbjct: 290 IIINAGGAGTSGYIGAKYWHDPGAFRGDRSIDRFKDVMATFTTAAFAFGASEFIAIGASE 349

Query: 373 QSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASL 432
           QSNPR+AIPSAAK + YR               VPY+S +LMGS SGG  ASPYVLA S 
Sbjct: 350 QSNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISS 409

Query: 433 HGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSML 492
           HGV VV HFINAVILL+VLSV+NSAFYSS R+L  L+Q GYAP+WF+Y+DR GRP R+M+
Sbjct: 410 HGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMI 469

Query: 493 CXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGEL 552
                    FCA S KE +VFTWLLAISGLSQIFTW AIC+SHIRFRR M VQGRS+ EL
Sbjct: 470 ISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISEL 529

Query: 553 GFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGF 612
           GFR+Q GV GS YAA MLFLAL+A+FWV++ P+    LDA++FF+NYLAMPIL+  Y G+
Sbjct: 530 GFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGY 589

Query: 613 KLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           K++ RD++LFIRAKNIDLI+HR IFD E++RQE+EEY+E+L+NGP WKR+V FWC
Sbjct: 590 KIYNRDWKLFIRAKNIDLITHRNIFDAEIIRQEEEEYREQLKNGPTWKRLVHFWC 644

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/606 (55%), Positives = 412/606 (67%), Gaps = 16/606 (2%)

Query: 63  PHG-ASKFLPQVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSN 121
           PHG   +     K   F N++D F+R    N+++             ++ +N+L    S 
Sbjct: 52  PHGNTGRNDGSAKGNIFVNFIDGFRRQTNHNSAA-------------EDLENELTTCVSP 98

Query: 122 LHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLA 181
             + D +    + +VD   +E + +   LK++IKPRHV+M+S                L 
Sbjct: 99  ATLSDYKKSGDSGSVDE--LEGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALN 156

Query: 182 QAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYC 241
            AGPA L IGY IMG+C+YCIIQA GE+AV YS + G FN +PSFLV P   FAVAWVY 
Sbjct: 157 DAGPAGLAIGYAIMGSCIYCIIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYW 216

Query: 242 IQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCK 301
           +QW CVCPLELVT+SMTIKYWTTKV+PD                GA+GYAEAEFFFNCCK
Sbjct: 217 LQWACVCPLELVTASMTIKYWTTKVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCK 276

Query: 302 VMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXX 361
           V+M+ GFFI+ I IN G AG DGYIG KYW+DPGAFRG   I+RFKGV            
Sbjct: 277 VLMITGFFILGIIINCGGAGNDGYIGGKYWHDPGAFRGDKAIDRFKGVAATLVTAAFAFG 336

Query: 362 XXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGN 421
                 LTA+EQSNPRKAIP+AAKK+ YR               VP+NSDQLMGS S   
Sbjct: 337 GSEFIALTASEQSNPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKT 396

Query: 422 SASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYV 481
            ASPYV+A S HGV VV HF+NAVILLSVLSV NSAFYSSSR+L+ L+Q GYAPK+F+Y+
Sbjct: 397 KASPYVIAISSHGVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYI 456

Query: 482 DRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRG 541
           DR GRP R+M+         FCA S KE DVFTWLLAISGLSQIFTW AIC+SHIRFRR 
Sbjct: 457 DREGRPARAMVIGALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRA 516

Query: 542 MQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLA 601
           M VQGRSLGE+GF+++ GV GSYYAA M+FL L+AQFWV L P+  + LDA++FF++YLA
Sbjct: 517 MHVQGRSLGEIGFKSELGVWGSYYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSFFESYLA 576

Query: 602 MPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKR 661
           M +L+A YVG+  W++D+ LFIRAK+IDL  HR IFDE++LRQEDEE KEKLRNGP WKR
Sbjct: 577 MLMLIAFYVGYMFWKKDWTLFIRAKDIDLDHHRQIFDEDVLRQEDEETKEKLRNGPLWKR 636

Query: 662 VVDFWC 667
           +++FWC
Sbjct: 637 ILNFWC 642

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/592 (57%), Positives = 411/592 (69%), Gaps = 24/592 (4%)

Query: 77  RFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNV 136
           +F+N++DSFKRA+    S+       +E+   + F+  LE  +                 
Sbjct: 73  KFQNFIDSFKRADKEQPST-------LEHDLTKTFEGTLEPSEDG--------------- 110

Query: 137 DSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMG 196
            +QP E   ++ +LK +IKPRHVIM+S                LA +GPA LVIGY IMG
Sbjct: 111 -TQPAEVAGKSEELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMG 169

Query: 197 TCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSS 256
           +C+YCIIQA GE+AV YSK+ G FN++PSFL++P   F+VAWVYCIQWLCVCPLELVT+S
Sbjct: 170 SCIYCIIQATGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTAS 229

Query: 257 MTIKYWTTKVDPDXXXXX-XXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICI 315
           MTIKYWTTKVDPD                 GA GYAEAEFFFN CK++M++GFFI+ I +
Sbjct: 230 MTIKYWTTKVDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIIL 289

Query: 316 NTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSN 375
             G AG DGYIG +YW+DPGAFRG+  I+RFKGV+                 +TA+EQSN
Sbjct: 290 ICGGAGDDGYIGGRYWHDPGAFRGEHAIDRFKGVVSTLVNAAFAFGLSEMIGVTASEQSN 349

Query: 376 PRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGV 435
           PRKAIPSAAKK+ YR               VP+NSDQL+GSS GG  ASPYVLA S HGV
Sbjct: 350 PRKAIPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGV 409

Query: 436 HVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXX 495
            VV HFINAVILLSVLSVANSAFYSSSRLLLGLA+ GYAPK F YVDR GRP   M    
Sbjct: 410 RVVPHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAA 469

Query: 496 XXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFR 555
                 FCATSPKE  VF WLLAISGLSQ+FTW AIC+SHIRFRR M VQGRSLGE+GF+
Sbjct: 470 LVNVISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFK 529

Query: 556 AQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLW 615
           +Q GV GS+YA IM+ L L+AQFWVA+ P+    LD + FF+NYLA PIL+ALY G+K++
Sbjct: 530 SQCGVWGSWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIY 589

Query: 616 RRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            +D+RLFIRAK+IDL  +R +FDEEL+RQE+EEYKEK+RN P W+++ +FWC
Sbjct: 590 TKDWRLFIRAKDIDLDINRDVFDEELIRQEEEEYKEKMRNAPIWQKIYEFWC 641

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/671 (53%), Positives = 440/671 (65%), Gaps = 53/671 (7%)

Query: 4   PKDYEITSE--HEVEYFDQPSLHNRSTHHSSKDATNVQFAPGXXXXXXXXXXXXXXXXXX 61
           PK+ EI++E  +EVEYF+   +       S+   TN                        
Sbjct: 43  PKEKEISTEQENEVEYFENTKIQEGGIDDSTITQTN-----------------------D 79

Query: 62  XPHGASKFLPQVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSN 121
                +K        R RN++DSFK AE  N+                  + D  +  SN
Sbjct: 80  YEQNITK-----PTSRVRNFIDSFKPAEVKNSP-----------------EKDTASITSN 117

Query: 122 LHIRDDELDYATVNVDSQ----PVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXX 177
             + D+E+  +  N+D Q    P + ++++ +LK+TIKPRHV+M+S              
Sbjct: 118 EMMIDEEI-LSLSNLDGQRVPPPRKIENKSDELKKTIKPRHVLMISLGTGIGTGLLVGLG 176

Query: 178 XPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVA 237
             L  AGPA L++G+GIMGTCLYCIIQA GE+AVAYS + G FN +PSFLVDP F F+VA
Sbjct: 177 SSLVAAGPAGLLLGFGIMGTCLYCIIQAVGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVA 236

Query: 238 WVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXX-XXXXXXXXXXXGAKGYAEAEFF 296
           WVY +QWLCVCPLELVT+SMTIKYWTTKVDPD                 GA GYAEAEF 
Sbjct: 237 WVYALQWLCVCPLELVTASMTIKYWTTKVDPDVFVIIFYVLILAINIVGGAAGYAEAEFI 296

Query: 297 FNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXX 356
           FN CK++MMIGFFI+ I I  G AG DGYIG KYW++PGAFRG+  I+RFKGVM      
Sbjct: 297 FNSCKILMMIGFFILGIIIICGGAGNDGYIGGKYWHEPGAFRGEHAIDRFKGVMATLVNA 356

Query: 357 XXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGS 416
                      +TA+EQSNPRKAIPSAAKK+ YR               VPY+SDQL+GS
Sbjct: 357 AFAFGMSEFIGVTASEQSNPRKAIPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGS 416

Query: 417 SSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPK 476
           S GG  ASPYVLA S HGV VV HFINAVIL+SVLSVANSAFYSSSR+LL LA+ GYAPK
Sbjct: 417 SGGGVKASPYVLAVSTHGVKVVPHFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPK 476

Query: 477 WFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHI 536
            F Y+DR GRPL  M          FCATSPKE +VF WLLAISGLSQ+FTW AICVSH+
Sbjct: 477 IFCYIDREGRPLVGMAMASLFGVIAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHV 536

Query: 537 RFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFF 596
           RFRR M VQG+S+GELGFR+Q G  GS YAAIM+   L+AQFWVA+ P+    LDA+NFF
Sbjct: 537 RFRRAMHVQGKSIGELGFRSQVGAWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFF 596

Query: 597 QNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNG 656
           +NYLAMPILLALY G+K++ +++ +FIRAK+IDL+SHR IFDEE+++QE+EEY+EKLRNG
Sbjct: 597 ENYLAMPILLALYFGYKIYTKNWTIFIRAKDIDLVSHRNIFDEEIIKQEEEEYREKLRNG 656

Query: 657 PKWKRVVDFWC 667
           P W+RV DFWC
Sbjct: 657 PMWRRVYDFWC 667

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/594 (54%), Positives = 393/594 (66%), Gaps = 25/594 (4%)

Query: 75  NERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATV 134
           + RFRN++DSFK  ET +   +  D N + ++      +  ++ K  +   DDEL     
Sbjct: 48  HSRFRNFIDSFKPPETTHHIET--DMNPILSH-----QSVFDDAKVEISQVDDEL----- 95

Query: 135 NVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGI 194
                       N +LK+TI+PRHV+MMS                LA AGPA LVIGY I
Sbjct: 96  ------------NEKLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAI 143

Query: 195 MGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 254
           M +C+YCIIQA GE+AV Y  + G FN +P FLVDP  NF++AW+YCIQW CVCPLELVT
Sbjct: 144 MASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVT 203

Query: 255 SSMTIKYWTTKVDPDXXXXXXXXXXXXXXX-XGAKGYAEAEFFFNCCKVMMMIGFFIMAI 313
           +SMTI+YWTTKV+ D                 GA+GYAE EF  N CK++MMIGFFI+ I
Sbjct: 204 ASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGI 263

Query: 314 CINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQ 373
            I  G AG DG+IG KYW DPGAFRG     RFKGV+                 +TA+EQ
Sbjct: 264 VIICGGAGNDGFIGGKYWRDPGAFRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQ 323

Query: 374 SNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLH 433
           SNPRKAIPSAAKKV YR               VPY+S +L+GSSS    ASPYVLA S H
Sbjct: 324 SNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTH 383

Query: 434 GVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLC 493
           GV VV HFINAVIL+SV SVA+SAFYSSSR+LL LA+ GYAPK F +VDR GRP    L 
Sbjct: 384 GVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLV 443

Query: 494 XXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELG 553
                   FCA S KET+VF WLLAISGLSQ+FTW  IC+SHIRFRR M+VQGRS+ E+G
Sbjct: 444 GAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIG 503

Query: 554 FRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFK 613
           +++Q GV GS YA +M+ L ++ Q WV +VP+   + D + FFQ+YLAMP+ + LY+G+K
Sbjct: 504 YKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYK 563

Query: 614 LWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +W+RD+RLFIRAK+IDLISHR I D E+LRQE EEY+EKLRNGP W+RV DFWC
Sbjct: 564 IWKRDWRLFIRAKDIDLISHRHIHDPEILRQEREEYQEKLRNGPVWRRVYDFWC 617

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/593 (52%), Positives = 392/593 (66%), Gaps = 33/593 (5%)

Query: 76  ERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVN 135
           E  ++++DSFK+ +  N +    ++N + N    +F++ L N                  
Sbjct: 38  ENLKDFVDSFKKID-DNNNQYEIEKNEINNIKSDQFNDKLNN------------------ 78

Query: 136 VDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIM 195
                        QL++TI+PRHVIM+S                L  AGPA L+IGY IM
Sbjct: 79  -------------QLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIM 125

Query: 196 GTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTS 255
            +C+YCIIQACGE+AV Y  + G FN +PSFLVD  +NFAVAWVYCIQWLCVCPLELVT+
Sbjct: 126 ASCIYCIIQACGEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTA 185

Query: 256 SMTIKYWTTKVDPDXXXXXXXXXXXXXXX-XGAKGYAEAEFFFNCCKVMMMIGFFIMAIC 314
           SMTIKYW  KVDPD                 GA+GYAEAEFFFN CK++M+ GFFI+ I 
Sbjct: 186 SMTIKYWNEKVDPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGII 245

Query: 315 INTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQS 374
           +  G AGT GYIG  YWN+PGAFRG T   RFKG++                 +TA+EQS
Sbjct: 246 LICGGAGTSGYIGVSYWNNPGAFRGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQS 305

Query: 375 NPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHG 434
           NPRKAIPSAAKKV YR               VPYNS +L+GS S    ASPYV+A + HG
Sbjct: 306 NPRKAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHG 365

Query: 435 VHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCX 494
           + +  HFINAVIL+SVLSVANS+FYSSSR+LL LA+ GYAPK F Y+DR GRPL  ++  
Sbjct: 366 IRIAPHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAA 425

Query: 495 XXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGF 554
                  FCA+SPKET+VF+WLLAISGLSQ+FTW  IC+SHIRFRR M++QGRSL ELG+
Sbjct: 426 SLLATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGY 485

Query: 555 RAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKL 614
           ++Q GV GS YAA ++FL L+ QFWVAL P+N++  +  NFF+ YLAMPILL  Y G+K 
Sbjct: 486 KSQVGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKT 545

Query: 615 WRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           W++D+ LFIRAK+IDLISHR I+DE++L+QE  +YKE L+NG  W ++  FWC
Sbjct: 546 WKKDWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYKENLKNGSLWLKIYAFWC 598

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/542 (57%), Positives = 373/542 (68%), Gaps = 1/542 (0%)

Query: 125 RDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAG 184
           R DE    T +++S   E   EN+ LKQTIK RHV+++S                L  AG
Sbjct: 93  RVDE-KQTTSDLESGLGEVPGENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAG 151

Query: 185 PAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQW 244
           P  LVIGY IMG+CLYCIIQACGELAV YS +  +FN +P+FLVD  F FAVAWVYC+QW
Sbjct: 152 PGGLVIGYSIMGSCLYCIIQACGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQW 211

Query: 245 LCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMM 304
           LCVCPLELVT+SMTIKYWTT V+PD                GA+GYAEAEFFFN CKV+M
Sbjct: 212 LCVCPLELVTASMTIKYWTTSVNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLM 271

Query: 305 MIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXX 364
           M GFFI+ I I  G AGT GYIGAKYW+ PGAF G   I+ FKGVM              
Sbjct: 272 MAGFFILGIIITCGGAGTSGYIGAKYWHSPGAFNGNRPIDHFKGVMATFTTAAFAFGASE 331

Query: 365 XXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSAS 424
              LTAAEQSNPRKAIP AAK + YR               VPYNS  L+GS S    AS
Sbjct: 332 FISLTAAEQSNPRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKAS 391

Query: 425 PYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRN 484
           PYV+A + HGV VV HFINAVILLSVLSV NSAFYSSSRLL  LAQ GYAPK F Y+D+ 
Sbjct: 392 PYVVAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKR 451

Query: 485 GRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQV 544
           GRPL +M+C        FCA SPKE  VFTWLLAISGLSQ+FTW AIC+SH+RFRR ++V
Sbjct: 452 GRPLVAMVCSTLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKV 511

Query: 545 QGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPI 604
           QG SLGE+GF++Q G+ GS YAA ML LAL+AQFWVAL P+  + LDA NFFQNYLAMPI
Sbjct: 512 QGHSLGEIGFKSQVGIYGSLYAATMLILALIAQFWVALAPIGGNGLDARNFFQNYLAMPI 571

Query: 605 LLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVD 664
           LL LY G+K+ +RD++ +I A  IDL+SHR +FDE++L+QE  E +++ +N    +++ +
Sbjct: 572 LLVLYFGYKIRKRDWKFWIPAHRIDLVSHRKVFDEDILKQEVAEIEQEKKNLSTGRKIQE 631

Query: 665 FW 666
           F+
Sbjct: 632 FF 633

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/531 (56%), Positives = 364/531 (68%), Gaps = 1/531 (0%)

Query: 137 DSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMG 196
           D      + +N +LK+TIK RHV+M+S                L   GPA LVIGY IMG
Sbjct: 84  DGSDAGDKGDN-KLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMG 142

Query: 197 TCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSS 256
           +CLYCIIQA GELAV Y+ ++G FN +PS L+DP   F+VAWVYC+QWLCV PLELVT+S
Sbjct: 143 SCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTAS 202

Query: 257 MTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICIN 316
           +TIKYWTT V+PD                GA+GYAEAEFFFN  KV+M+ GF I+ I +N
Sbjct: 203 ITIKYWTTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIVN 262

Query: 317 TGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNP 376
            G AG DGYIG KYWNDPG+F G   I+ FKGV+                 LTAAEQ+NP
Sbjct: 263 CGGAGNDGYIGGKYWNDPGSFSGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANP 322

Query: 377 RKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVH 436
           RK+IPSAAKK+ YR               VP+NS++LMGS      ASPYV+A + HGV 
Sbjct: 323 RKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASPYVIAIASHGVK 382

Query: 437 VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXX 496
           VV H INAVILLSV+S+ NSAFYSSSRLLL LA+ GYAP +  YVDR GRP  +M+    
Sbjct: 383 VVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISSV 442

Query: 497 XXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRA 556
                F A SPKE  VFTWLLAISGLSQ+FTW AIC+SHIRFRR M+VQGRSLGELGF++
Sbjct: 443 FGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKS 502

Query: 557 QTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWR 616
           Q GV GSYYA  M+ L L+ QFW A+ P+    LDAE FF+NYLAMPIL+ALY G+K+W+
Sbjct: 503 QVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWK 562

Query: 617 RDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           RD+ L+I A  IDLIS+R IFDE++L+QED EY+EKLRN    +R  +FWC
Sbjct: 563 RDWTLYIPASKIDLISNRRIFDEDVLKQEDAEYREKLRNSGWLRRAAEFWC 613

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/595 (53%), Positives = 390/595 (65%), Gaps = 8/595 (1%)

Query: 80  NWLDSFKRAETPNASSSTADE-NAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDS 138
           N L   K      +S  T +E + +E  S+Q  D +    + NL  R     +      +
Sbjct: 20  NELKDVKSGAVVGSSDFTNNETDYLEKTSVQNSDFEYLENEGNLFRRFAN-SFKRAPGSN 78

Query: 139 QPVEQQDENA------QLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGY 192
            P ++   +A      +LK+TIK RHV+M+S                L   GPA LVIGY
Sbjct: 79  NPDKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGY 138

Query: 193 GIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLEL 252
            IMG+CLYCIIQA GELAV Y+ ++G FN +PS L+DP   F+VAWVYC+QWLCV PLEL
Sbjct: 139 AIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLEL 198

Query: 253 VTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMA 312
           VT+S+TIKYWTT V+PD                GA+GYAEAEFFFN CKV+M+ GFFI+ 
Sbjct: 199 VTASITIKYWTTSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILG 258

Query: 313 ICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAE 372
           I +N G AG DGYIG KYWNDPG+F G   I+ FKGV+                 LTAAE
Sbjct: 259 IIVNCGGAGNDGYIGGKYWNDPGSFSGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAE 318

Query: 373 QSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASL 432
           Q+NPRK+IPSAAKKV YR               VP+NS++LMGS      ASPYV+A + 
Sbjct: 319 QANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASPYVIAIAS 378

Query: 433 HGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSML 492
           HGV VV HFINAVILLSVLSV NSAFYSSSRLLL LA+ GYAP +  YVDR GRP  +M+
Sbjct: 379 HGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMI 438

Query: 493 CXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGEL 552
                    F A SPKE  VFTWLLAISGLSQ+FTW AIC+SHIRFRR M+VQGRSLGEL
Sbjct: 439 ISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGEL 498

Query: 553 GFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGF 612
           GF++Q GV GSYYA  M+ L L+ QFW A+ P+    LDAE FF+NYLAMPIL+ALY G+
Sbjct: 499 GFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGY 558

Query: 613 KLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           K+W+RD+ L+I A  IDLIS+R IFDE++L+QED E++EKLRN    +R  +FWC
Sbjct: 559 KVWKRDWTLYIPASKIDLISNRRIFDEDVLKQEDAEFREKLRNSGWLRRAAEFWC 613

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/585 (52%), Positives = 387/585 (66%), Gaps = 11/585 (1%)

Query: 83  DSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVE 142
           +S ++   P +     D   +  +  Q   N    K++  H R  ++D      + QPV 
Sbjct: 23  ESIEKVSLPASDYQYHDGQVLSRF--QRLTNSF--KRAGEHGRGGDVD-----AEGQPVA 73

Query: 143 QQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCI 202
            ++   +LKQTI  RH+ M+S                L   GPA L IGY IMG+C+YCI
Sbjct: 74  PRE--TKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCI 131

Query: 203 IQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYW 262
           IQA GE+AV+YS ++G+FN +PS L+DP   F+VAWVYC+QWLCV PLELVT+++TIKYW
Sbjct: 132 IQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYW 191

Query: 263 TTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGT 322
           TT V+PD                GA+GYAEAEFFFN CKV+M+ GFFI+ I +N G AG 
Sbjct: 192 TTAVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGN 251

Query: 323 DGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPS 382
           DGY+G KYW+DPGA  G   I  FKG++                 LTAAEQ+NPR+AIPS
Sbjct: 252 DGYLGGKYWHDPGALYGTKPIHHFKGIIATMVTAAFAFGATEFIALTAAEQANPRRAIPS 311

Query: 383 AAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFI 442
           AAKK+ YR               VPYNSD+LMGS      ASPYV+A + HGV VV HFI
Sbjct: 312 AAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIAIASHGVKVVPHFI 371

Query: 443 NAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXF 502
           NAVILLSVLSV NSAFYSSSRLLL L++  YAP W +Y+DR GRP+R+ML         F
Sbjct: 372 NAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCIFGLIAF 431

Query: 503 CATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLG 562
            A SPKE  VFTWLLAISGLSQ+FTW  ICVSHIRFR+ + VQG+SLGELG+++QTGV+G
Sbjct: 432 VAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELGYKSQTGVVG 491

Query: 563 SYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLF 622
           SYYA +++   L  QFWVA+ P+ T  LDA NFF+NYLAMPIL+ALY G+++W+RD++L+
Sbjct: 492 SYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFGYRVWKRDWKLY 551

Query: 623 IRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           I  + IDL+SHR +FDE+LL+QED EY+E +RN     RV  FWC
Sbjct: 552 IPLEQIDLVSHRKVFDEDLLKQEDAEYEESIRNSGWLSRVAHFWC 596

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/592 (51%), Positives = 386/592 (65%), Gaps = 25/592 (4%)

Query: 77  RFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNV 136
           RF  ++DSF+RAE                         L N+ + +   +   D A V +
Sbjct: 50  RFDEFIDSFRRAEDVRI---------------------LPNEMNPILSHESVFDTAVVEI 88

Query: 137 DSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMG 196
            +  V+ Q  N +LK+TI+PRHVIM++                L+ AGPA L+IGY IM 
Sbjct: 89  SA--VDNQI-NEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMS 145

Query: 197 TCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSS 256
           TC+YC++QA GE+AV Y  + G F+ +P FL+DPG NFAV+W+YCIQW CVCPLELVT+S
Sbjct: 146 TCIYCVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTAS 205

Query: 257 MTIKYWTTKVDPDXXXXXXXXXXXXXXX-XGAKGYAEAEFFFNCCKVMMMIGFFIMAICI 315
           MTI+YWTTKV+ D                 GA+GYAEAEFF N CK++MM GFFI+ I +
Sbjct: 206 MTIQYWTTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIIL 265

Query: 316 NTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSN 375
             G AG  G+IGA+YW+ PGAFRG   I RFKG++                 +TA+EQ+N
Sbjct: 266 ICGGAGNSGFIGARYWHSPGAFRGDNGINRFKGIVSTLVTAAFAFGGTEFLAITASEQAN 325

Query: 376 PRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGV 435
           PRKAIPSAAKKV YR               VPYNS +L+GSS     ASPYV+A + HG+
Sbjct: 326 PRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKASPYVIAVASHGI 385

Query: 436 HVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXX 495
            VV HFINAVIL+SV SVA+SAFYSSSRLLL LA+ G+APK F YVD+ GRP    +   
Sbjct: 386 RVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGA 445

Query: 496 XXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFR 555
                 FCA S KE DVF WLL+ISGLS++FTW  I +SHIRFRR M+VQGRSL E+GF+
Sbjct: 446 IIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFK 505

Query: 556 AQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLW 615
           +Q GV GS YA +M+ L L+ QFWV +VP+   + DA +FFQ YLAMP+ + LY G+K+W
Sbjct: 506 SQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYKIW 565

Query: 616 RRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            RD+RLFIRAKNIDLI+HR I+D ELLRQE +E +E+ RN P W+++ +FWC
Sbjct: 566 NRDWRLFIRAKNIDLIAHRHIYDPELLRQERKEMRERARNAPLWRKIYNFWC 617

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/671 (49%), Positives = 422/671 (62%), Gaps = 65/671 (9%)

Query: 5   KDYEITSE--HEVEYFDQPSLHNRSTHHSSKDATNVQFAPGXXXXXXXXXXXXXXXXXXX 62
           +DY +++E  +E+EYF+     N +T    +         G                   
Sbjct: 21  QDYNVSTEQENEIEYFETLKGKNAATTREEEYDFTTDSTSGRKR---------------- 64

Query: 63  PHGASKFLPQVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNL 122
            HG   +        FR+++DSFK AE P   ++                          
Sbjct: 65  -HGVKGY--------FRDFIDSFKPAENPQPHTN-------------------------- 89

Query: 123 HIRDDELDYATVNVDSQPVEQQ-----DENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXX 177
                 LD   V V S+ +EQ      D   +LK+TI+PRHVI++S              
Sbjct: 90  ------LDMELVGVTSETIEQHKKDEGDTGDKLKKTIQPRHVILISLGTGIGTGLLVGNG 143

Query: 178 XPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVA 237
             LAQAGPA LVIGYGIMG+ +YCIIQACGE+AV Y  + G FN +P+FL+DPGF+FA A
Sbjct: 144 ATLAQAGPAGLVIGYGIMGSLIYCIIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFATA 203

Query: 238 WVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXX-XXXXXXXXGAKGYAEAEFF 296
           WVYC+QWLCVCPLELVT+SMTIKYWTTKVDPD                 GA+GYAEAEF 
Sbjct: 204 WVYCLQWLCVCPLELVTASMTIKYWTTKVDPDVFVIIFYVFILGINILGGARGYAEAEFI 263

Query: 297 FNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXX 356
           FN CK++MMIGFFI+ I I  G AGTDGYIG +YW+DPGAFRG+  ++RFKGV+      
Sbjct: 264 FNSCKILMMIGFFILGIIIICGGAGTDGYIGGRYWHDPGAFRGERAVDRFKGVVATLVTA 323

Query: 357 XXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGS 416
                      +TA+EQSNPR+AIPSAAKK+ YR               VPYNS QL+G+
Sbjct: 324 AFSFGQSEFIAVTASEQSNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNSSQLLGA 383

Query: 417 SSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPK 476
            S G  ASPYVLA + HGV VV HFINAVI++SVLSV+NSAFYSS R+LL L+Q G+APK
Sbjct: 384 QSNGIKASPYVLAVANHGVRVVPHFINAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAPK 443

Query: 477 WFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHI 536
            F YVDR GRP   ++         FCATSPKE  VFTWLLA+SGLSQIFTW +IC+SH+
Sbjct: 444 IFSYVDRAGRPTMGIIVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTWMSICLSHL 503

Query: 537 RFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFF 596
           RFRR M VQGRSLGE GF +Q G+ GS Y+  +L L LV QFWVAL P+ +  +DA +FF
Sbjct: 504 RFRRAMTVQGRSLGECGFLSQVGIYGSAYSFFVLALILVGQFWVALKPVGSKKVDANSFF 563

Query: 597 QNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNG 656
           +NYLA PI +ALY+G+K + +D+RL+I++++IDL++HR I+DE++LRQE EE  E+L+NG
Sbjct: 564 ENYLAAPIWIALYIGYKCYTKDWRLYIKSQDIDLVAHRQIYDEDILRQEREEETERLKNG 623

Query: 657 PKWKRVVDFWC 667
           P WKR   FWC
Sbjct: 624 PYWKRAYSFWC 634

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/602 (52%), Positives = 388/602 (64%), Gaps = 43/602 (7%)

Query: 71  PQVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELD 130
           P  K    R ++DSFKRAE                               ++   DD+++
Sbjct: 64  PAKKKSNLRRFVDSFKRAE-------------------------------HMIPADDKIN 92

Query: 131 YATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVI 190
             T       +   ++N  LKQTIKPRHVIM+S                L +AGPA LV 
Sbjct: 93  EMTTAEPEAEMASVEDN--LKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVT 150

Query: 191 GYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPL 250
           GY IMGTC+YCIIQ+ GE+AV YSK+NG FN +P+ LV+PGF     WV C   +    +
Sbjct: 151 GYAIMGTCVYCIIQSAGEMAVVYSKLNGGFNAYPTMLVEPGF-----WVCCRLGVLFTMV 205

Query: 251 ELVTSSM-----TIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMM 305
           + ++  +       KYWTT+VDPD                GA+GYAEAEFFFNCCKV+MM
Sbjct: 206 DCLSFGIGYCFDDYKYWTTRVDPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMM 265

Query: 306 IGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXX 365
            GFFI+ I IN G AG DGY+G  YW +PGAFRG   I+ FKGV+               
Sbjct: 266 AGFFILGIIINVGGAGNDGYLGNIYWRNPGAFRGDKGIDHFKGVVATLVTAAFAFGGTEF 325

Query: 366 XXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASP 425
             LTAAEQSNPRKAIPSAAKKV YR               VP+ S +L+GS S   +ASP
Sbjct: 326 IALTAAEQSNPRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATAASP 385

Query: 426 YVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNG 485
           YV+A + HGV VV HFINAVILLSVLSV NSAFYSSSRLLL L++ GYAPKWFDYVDR G
Sbjct: 386 YVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREG 445

Query: 486 RPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQ 545
           RP R+M+         FCATSPKET+VFTWLLAISGLSQIFTW +IC+SHIRFR  M+ Q
Sbjct: 446 RPSRAMIVSALFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQ 505

Query: 546 GRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPIL 605
           GRS+GE+GF+AQTG+ GSYY+  ++ L L+ QFWVA+ P+ T  L A NFF+NYLAMPIL
Sbjct: 506 GRSMGEVGFKAQTGIWGSYYSIFLMILTLIGQFWVAIAPIGTAELSARNFFENYLAMPIL 565

Query: 606 LALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDF 665
           +  Y G+K+W++D+ L+I+A++IDLISHR IFDEELL+QED E KEKL+NGP W+R+V F
Sbjct: 566 IGFYFGYKIWKKDWTLYIKAEDIDLISHRQIFDEELLKQEDYELKEKLKNGPVWRRIVAF 625

Query: 666 WC 667
           WC
Sbjct: 626 WC 627

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/567 (53%), Positives = 378/567 (66%), Gaps = 3/567 (0%)

Query: 104 ENYSMQEFDNDLENKK--SNLHIRDDELDYATVN-VDSQPVEQQDENAQLKQTIKPRHVI 160
           ++Y   E D+    ++     H  D   D A+ N V+      +    +LKQTI  RHV 
Sbjct: 41  DDYKFHEDDSKSRFRRFARTFHRADGLGDGASGNDVEFGAEVARQTETKLKQTITFRHVF 100

Query: 161 MMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSF 220
           MMS                L   GPA LVIGY IMG+CLYCIIQA GELAV+YS ++G+F
Sbjct: 101 MMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAAGELAVSYSSLSGNF 160

Query: 221 NTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXX 280
           N +PS L++  F F+VAW+YC+QWLCV PLELVT+S+TIKYWTT V+PD           
Sbjct: 161 NAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTSVNPDIFVAIFYVLII 220

Query: 281 XXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQ 340
                GA+GYAEAEFFFNCCKV+M+IGFFI+ I +N G AG DGYIG +YWN+PGAF G 
Sbjct: 221 LVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYIGGRYWNNPGAFYGT 280

Query: 341 TKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXX 400
             I  FKG++                 LTAAEQ+NPR+AIPSAAKKV YR          
Sbjct: 281 KPIHHFKGIISTMVTAAFAFGATEFIALTAAEQANPRRAIPSAAKKVVYRILLIFLAPIV 340

Query: 401 XXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYS 460
                VP+NS +LMGS S    ASPYV+A + HGV VV HFINAVILLSVLSV NSAFYS
Sbjct: 341 LIGFLVPHNSPELMGSGSSATHASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYS 400

Query: 461 SSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAIS 520
           SSRLLL LA   YAP W  ++DR+GRP+R+ML         F A SPKE  VFTWLLAIS
Sbjct: 401 SSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLISFVAASPKEETVFTWLLAIS 460

Query: 521 GLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWV 580
           GLSQ+FTW +ICVSHIRFR+ + VQG+ +GELG+++QTGV GSYYA  ++   L+ QFWV
Sbjct: 461 GLSQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQTGVAGSYYATFIMGCILIGQFWV 520

Query: 581 ALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEE 640
           A+ PM +  LDA +FF+NYLA+P+ + LY GFK+W+RD+RL+I  + IDL SHR  FDEE
Sbjct: 521 AIAPMGSAKLDANSFFENYLALPLFVVLYFGFKIWKRDWRLYIPLEQIDLDSHRKTFDEE 580

Query: 641 LLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           LL+QED EY+E +RN    +R+  +WC
Sbjct: 581 LLKQEDAEYEENIRNKGWLRRIAHYWC 607

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/594 (51%), Positives = 396/594 (66%), Gaps = 23/594 (3%)

Query: 72  QVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDY 131
           ++KN  FRN++DSFKR ET      TA    +EN    +    +  + SN H        
Sbjct: 61  RIKNPLFRNFIDSFKRGET------TARIADLEN----DLTTAVSPQLSNYH-------- 102

Query: 132 ATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIG 191
            ++  D   ++++    +LK+ I  RH++ M+                L  AGPA L+IG
Sbjct: 103 GSIPSDEVVIKKE----ELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIG 158

Query: 192 YGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLE 251
           Y +MGTC+YC+IQA GEL V Y+ + G FN +P+ LV P F F+V W+Y +QWLC+ PLE
Sbjct: 159 YALMGTCVYCVIQAAGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLE 218

Query: 252 LVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIM 311
           LVT+S+TIKYWTTKVDPD                G+KGYAEA+FFFNC K+ M+ GFFI+
Sbjct: 219 LVTASLTIKYWTTKVDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFIL 278

Query: 312 AICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAA 371
            I +  G AG DGY+G KYW++PGAFRG+  I+ FKGV                  L+A+
Sbjct: 279 GIVVACGGAGHDGYLGGKYWHNPGAFRGEKAIDHFKGVSSVFVTSAFAFGGSEFVALSAS 338

Query: 372 EQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAAS 431
           EQ+NPRK+IPSAAK + YR               VP++S QL   SS G   SPYV+A +
Sbjct: 339 EQANPRKSIPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQ-PSSDGKKTSPYVVAIA 397

Query: 432 LHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
           +HGV VV H INAVIL++VLSV+NSAF+ SSRLLL L+Q GYAPKWFDYVDR GRP+R+M
Sbjct: 398 MHGVKVVPHLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAM 457

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
           L         FCATS KETDVF+WLLAISGLS IFT+F+ICVSHIR R  M+VQGRSLGE
Sbjct: 458 LISALFGVICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGE 517

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVG 611
           LGFR+Q G  GS+YA ++L L+L+A+FWVAL P+    LDAE+FF+NYLA PI +  Y G
Sbjct: 518 LGFRSQVGTYGSFYACLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFG 577

Query: 612 FKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDF 665
           + +W++DFR+FIR+K+IDL   R +FDE+L++QEDEEY E++RN P+W++V+ F
Sbjct: 578 YMIWKKDFRIFIRSKDIDLDFKRQVFDEDLIKQEDEEYAEQMRNAPRWRKVIAF 631

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/527 (55%), Positives = 355/527 (67%), Gaps = 2/527 (0%)

Query: 143 QQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCI 202
           Q  ++  LKQTIK RH+IM+S                L   GPA   IG+ IMG C+YC+
Sbjct: 83  QNAKHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCV 142

Query: 203 IQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYW 262
           IQA GELAV Y+ + G FN +PSFL+DP   FA AWVYC+QWLCV PLELVT+S+TIK+W
Sbjct: 143 IQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFW 202

Query: 263 --TTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAA 320
             +  V+PD                GA+GYAEAEFFFN CKV+MMIGFFI+ I INTGA 
Sbjct: 203 PGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAV 262

Query: 321 GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAI 380
           GT GYIG KYW DPG+  G+T  + FKG++                 LTAAEQ+NPRK+I
Sbjct: 263 GTSGYIGGKYWRDPGSLGGRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRKSI 322

Query: 381 PSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQH 440
           P+AAKK+ Y+               VP +S +LMGS+      SPYV+A  +HGV+VV  
Sbjct: 323 PAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGVNVVPS 382

Query: 441 FINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXX 500
           FINAVILLSVLSV NSAFYSSSRLL  LA+  YAPK F Y+DR GRPL +M+        
Sbjct: 383 FINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILFGTI 442

Query: 501 XFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGV 560
            F A SPKE +VF WLLAISGLSQ+FTW  IC+SHIRFRR + VQG S  ELGF+AQTG+
Sbjct: 443 CFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKAQTGI 502

Query: 561 LGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFR 620
           +GSY +AIM+ LAL+ QFWV+LVPM     DAE+FF  YLAMP+ L  Y G+K+W +D+R
Sbjct: 503 IGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIWNKDWR 562

Query: 621 LFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           LFIRA  IDL+SHR IFD ++L+QED EY+ KLRN   W R+ +FWC
Sbjct: 563 LFIRADQIDLVSHRRIFDADVLKQEDIEYRAKLRNSSIWHRIANFWC 609

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/574 (51%), Positives = 373/574 (64%), Gaps = 4/574 (0%)

Query: 95  SSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTI 154
           S + +E A ++     F +  +      HI  +    A + ++       ++ A LK+ I
Sbjct: 50  SQSDEEYAAKSSVWHRFKDSFKRAD---HINTNIHGNAELELNPSQSLLPEKGASLKRDI 106

Query: 155 KPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYS 214
           KPRHV+MMS                LA  GPA L IGY IMG+CLY IIQA GELAVAY 
Sbjct: 107 KPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAGELAVAYP 166

Query: 215 KVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXX 274
            + G+FN +PSFLVDP   FA A +YCIQWLCV PLE++++++TIKYW T ++P+     
Sbjct: 167 TLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTSINPNVWCVI 226

Query: 275 XXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDP 334
                      G+ GYAEA+FFFN CK++M  GFFI+ I IN G AG   YIG KYWNDP
Sbjct: 227 FYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIGGKYWNDP 286

Query: 335 GAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXX 394
           GAF G T I RFK ++                 LTA+EQ+NPRKAIPSAAK+V YR    
Sbjct: 287 GAFNGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPSAAKQVLYRIIAI 346

Query: 395 XXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVA 454
                      VPYNS +LMGS S    +SPYV+A + HGV VV  FINAVIL+SVLSV 
Sbjct: 347 YLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPSFINAVILISVLSVG 406

Query: 455 NSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFT 514
           N +FYSSSR+LL L+++GYAPK+F YVDR GRPL +M+         F + S  E  VFT
Sbjct: 407 NFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVSASSAEESVFT 466

Query: 515 WLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLAL 574
           WL+A+SGLSQ+FTW  IC+SH+RFR+ MQVQ RS+GELGFR+Q GV GSYY   M+ L  
Sbjct: 467 WLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSYYGIFMMILVF 526

Query: 575 VAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISH 633
           + QFWVAL P+  T   DAENFF NYLAMP+ LALY GFK+W++D+RL+I A  IDLISH
Sbjct: 527 IGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKKDWRLYIPASEIDLISH 586

Query: 634 RIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           R IFDEE+L+QEDEEYK K+++   W ++ +FWC
Sbjct: 587 RKIFDEEILKQEDEEYKIKMKHASIWVKLSNFWC 620

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/531 (54%), Positives = 364/531 (68%)

Query: 137 DSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMG 196
           D + ++  +++ +LKQTI+PRHV+M+S                L   GP  L +G+ +MG
Sbjct: 76  DQESLQDNNKHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMG 135

Query: 197 TCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSS 256
           TC+YC+IQA GE+AV Y  ++G FN +PSFLVDPGF FA AW+YCIQWLCV PLELVT+S
Sbjct: 136 TCVYCVIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTAS 195

Query: 257 MTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICIN 316
           +TIKYWTT ++PD                GA+GYAEAEFFFN CKV+M+IGFFI+ I +N
Sbjct: 196 ITIKYWTTAINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVN 255

Query: 317 TGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNP 376
           TGAAG DGYIGAKYW +PG+F G T I+ FKGV+                 LTAAEQ+NP
Sbjct: 256 TGAAGNDGYIGAKYWREPGSFGGHTAIDHFKGVVSTLVNAAFSLGCSEFVALTAAEQANP 315

Query: 377 RKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVH 436
           RK++PSAAKK+ Y+               VP NS +LMGS+      SPYV+A + HGV 
Sbjct: 316 RKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPYVIAVASHGVR 375

Query: 437 VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXX 496
           VV HFINAVILLSVLSV NSAFYSSSRLLL LA+ GYAP  F Y+DR GRPL +M+    
Sbjct: 376 VVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAMMVSIT 435

Query: 497 XXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRA 556
                F A SPKE  VF WLLAISGLSQ+FTW +IC+SHIRFR+ + VQGR    LGF+A
Sbjct: 436 MGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDGLGFKA 495

Query: 557 QTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWR 616
           QTGV GSYY+A+++ L  +AQFW  L+PM +   +AE+FF+ YLA PI +ALY G+K++ 
Sbjct: 496 QTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVALYFGYKIYN 555

Query: 617 RDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           ++++LFI A+ IDL  HR IFD ++L+QED EY+ KLR+   W R+   WC
Sbjct: 556 KNWQLFIPAEKIDLDLHRKIFDADVLKQEDAEYRAKLRDSSMWHRIAALWC 606

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/594 (49%), Positives = 380/594 (63%), Gaps = 26/594 (4%)

Query: 74  KNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYAT 133
           ++  F  ++DSFKR E                   +E++    +   + H R    D+  
Sbjct: 37  RDGLFHRFVDSFKRPE-------------------EEYNGG--DGIHSTHERVSGEDFER 75

Query: 134 VNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYG 193
           +  D        ++  LKQ IKPRHV+M+S                L   GPA L+IGY 
Sbjct: 76  LAPD-----DSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYA 130

Query: 194 IMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELV 253
           I+ T LYC+IQ+  ELA+ Y+ ++G FN +P+ LVD  F F+V+WVYC+QWLC+ PLELV
Sbjct: 131 IVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELV 190

Query: 254 TSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAI 313
           T+SMTIKYW   ++PD                GA GYAEAEFFFN CKV+M+IGFFI+ I
Sbjct: 191 TASMTIKYWNDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGI 250

Query: 314 CINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQ 373
            +N G AG DGY+G+ YW+DPGAFRG   I RFKG++                 LTAAEQ
Sbjct: 251 IVNCGGAGNDGYLGSVYWHDPGAFRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQ 310

Query: 374 SNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLH 433
            NP+K+I SA+KK+ YR               VPYNS +L+GS S    ASP+V+A + H
Sbjct: 311 QNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASH 370

Query: 434 GVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLC 493
           GV VV H INAVILLSVLSVANSA YSSSR+LL L++ G+APK F+YVDR GRP+R +L 
Sbjct: 371 GVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLV 430

Query: 494 XXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELG 553
                   F A SPKE  VFTWLLAISGLS++FTWF+I +SH+RFRR M VQGRSL ELG
Sbjct: 431 SCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELG 490

Query: 554 FRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFK 613
           +++ TGV G+YYA IM+ L L+ QFWVA+ P+ ++ LDA NFF+NYLAMPIL+ LY+G+K
Sbjct: 491 YQSWTGVWGAYYAMIMILLILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYK 550

Query: 614 LWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           LW RD+R+ I A  +DL+SHR IFD E+++ E  E KE+LR+    KR  +FWC
Sbjct: 551 LWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEKEQLRHASWTKRAAEFWC 604

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/528 (53%), Positives = 357/528 (67%)

Query: 140 PVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCL 199
           P+E   ++  LKQ I+PRHV+M+S                L   GPA LVIGY I+ + L
Sbjct: 71  PIESASKHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSML 130

Query: 200 YCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTI 259
           YC+IQ+  ELA+ Y+ + G FN +PS LVD  F F+V+WVYC+QWLCV PLELVT+SMTI
Sbjct: 131 YCVIQSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTI 190

Query: 260 KYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGA 319
           KYW   ++PD                GA GYAEAEFFFNCCKV+M+IGFFI+ I IN G 
Sbjct: 191 KYWNQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGG 250

Query: 320 AGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKA 379
           AG DGY+GA+YW+DPGAFRG   I RFKG++                 LTAAEQ NP+K+
Sbjct: 251 AGNDGYLGARYWHDPGAFRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKS 310

Query: 380 IPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQ 439
           I SA+KK+ YR               VP+NSD+L+GS      ASP+V+A + HGV VV 
Sbjct: 311 IRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVP 370

Query: 440 HFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXX 499
           HFINAVILLSVLSVANSA YSSSR+LL L++ G+AP++ +YVDR GRP+  +L       
Sbjct: 371 HFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCVFGL 430

Query: 500 XXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTG 559
             F A SPKE  VFTWLLAISGLS++FTWF+I +SH+R RR M VQGRS  ELG+ A TG
Sbjct: 431 LSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTG 490

Query: 560 VLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDF 619
           V G+YYA  M+   LV QFWVA+ P+ ++ LDA NFF+NYLAMPIL+ LY+G+K+W RD+
Sbjct: 491 VWGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDW 550

Query: 620 RLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           RL I +  +DL++HR IFD E+LR E  E KE+LR+ P   R+ +FWC
Sbjct: 551 RLLIPSSEVDLVAHRKIFDAEVLRHEQLEEKEQLRHAPWTTRLANFWC 598

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/520 (52%), Positives = 342/520 (65%), Gaps = 3/520 (0%)

Query: 150 LKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGEL 209
           LK  IK RH+ M+S                L   GPA LVIGY    T LYC++QAC EL
Sbjct: 68  LKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCEL 127

Query: 210 AVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPD 269
            VAY+ + G++N +P+FLVD GF FAVA VY +QW  V PLELVT+SMT+KYWT+ V+PD
Sbjct: 128 GVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPD 187

Query: 270 XXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAK 329
                           G++GYAEAEF FN  KV++M GF IMAI +  GA+   GYIG +
Sbjct: 188 VFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGAS-EQGYIGGQ 246

Query: 330 YWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAY 389
           YW+DPGAF G   I+RFKG+                  LTAAEQ+NPR+++P A K+  Y
Sbjct: 247 YWHDPGAFGGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATKRWLY 306

Query: 390 RXXXXXXXXXXXXXXXVPYNSDQLMGSSSG-GNSASPYVLAASLHGVHVVQHFINAVILL 448
           R               VP+NSDQL+ +  G G+ ASP+V+AA+LHGV VV H IN +IL 
Sbjct: 307 RVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINFIILT 366

Query: 449 SVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPK 508
           SV+SV NSA YS+ R+LL LA+ G  PK F YVDR GRPL +++         F A S +
Sbjct: 367 SVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVAASNQ 426

Query: 509 ETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAI 568
           E +VFTWL AI+GLSQ+FTW AI VSH+RFRR M+VQGRSLGELG+RA TG LGSYYA  
Sbjct: 427 EENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSYYAIF 486

Query: 569 MLFLALVAQFWVALVPMNTH-TLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKN 627
              + L+AQFW+A+ P+  H  LD E FFQNYLA P+L+  Y+G+KLW+RDFRL I +  
Sbjct: 487 FNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVIPSSE 546

Query: 628 IDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +DL+SHR IFDEE+L QE+ E KE+LRN   +KR++DFWC
Sbjct: 547 VDLLSHRQIFDEEVLLQEEAERKERLRNSTLFKRLLDFWC 586

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/591 (48%), Positives = 358/591 (60%), Gaps = 34/591 (5%)

Query: 79  RNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDS 138
           RN++DSFKRAE              +    ++ +N LE  ++N        DY       
Sbjct: 36  RNFMDSFKRAEPQG-----------QTIREEKLENGLETVRTN--------DY------- 69

Query: 139 QPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTC 198
                     ++KQT+K RH+ M+S                L   GP  LVIGY    T 
Sbjct: 70  -----NATQKKMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTM 124

Query: 199 LYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMT 258
           LYC+IQAC EL V+Y+ + G++N++PSFLVD GFNFAVAWVY +QW  V PLELVTSSMT
Sbjct: 125 LYCVIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMT 184

Query: 259 IKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTG 318
           IKYW   ++PD                G++GYAE+EF FN CKV+MM+GF IM I +N G
Sbjct: 185 IKYWNDSINPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCG 244

Query: 319 AAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRK 378
           A+ + GYIG KYW+ PGAF G+  I+ FKG+                  LTAAEQ+NPRK
Sbjct: 245 ASKS-GYIGGKYWHTPGAFVGEKAIDHFKGICSVWVQSAFAYGGSEFIALTAAEQTNPRK 303

Query: 379 AIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGS-SSGGNSASPYVLAASLHGVHV 437
           ++P A K+  YR               VPY+S  L+GS     + ASP+V+AA+ HGV V
Sbjct: 304 SVPKATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHASPFVIAAASHGVKV 363

Query: 438 VQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXX 497
           V H INAVIL+SV+SV NSAFYS+ R+LL LA+ G  PK F YVDR GRPL +ML     
Sbjct: 364 VPHIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIF 423

Query: 498 XXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQ 557
               F A S  E  VFTWL AI  LSQ+FTW AI +SHIRFR  M+ QGRSLGELG++A 
Sbjct: 424 GLISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKAN 483

Query: 558 TGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYVGFKLWR 616
           TG  GS+YA     + L AQFWVA+ P+ N   LD  NFFQNYLA P+L+  Y G+KLW 
Sbjct: 484 TGYWGSWYAIAFNIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWY 543

Query: 617 RDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           RD++LFI A  +DL SHR IFD +L++QED E+KE++RN   W R +DFWC
Sbjct: 544 RDWKLFIPADKVDLESHRKIFDADLIKQEDFEHKERIRNSSFWVRALDFWC 594

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/586 (46%), Positives = 341/586 (58%), Gaps = 33/586 (5%)

Query: 83  DSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVE 142
           DSFKRAE     +   +EN           +DLE+                       VE
Sbjct: 56  DSFKRAEGSTTRTKQINENT----------SDLEDG----------------------VE 83

Query: 143 QQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCI 202
               +++LK+++K RHV+MMS                L   GPA L+IGY ++    Y +
Sbjct: 84  SITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYFM 143

Query: 203 IQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYW 262
           IQA GE+AV Y  +  +FN + S  +   F FA  W+YC QWL V PLEL+T+SMTI++W
Sbjct: 144 IQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFW 203

Query: 263 TTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGT 322
             K++PD                G K Y E EF FNCCK++M+ GF I++I IN G AG 
Sbjct: 204 NDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGN 263

Query: 323 DGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPS 382
           DGYIGA YW++PGAF G T I RFK V                  L+  EQSNPRK+ P 
Sbjct: 264 DGYIGATYWHNPGAFAGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPV 323

Query: 383 AAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFI 442
           AAK+  YR               VPYN DQLMG+      ASPYVLAAS+HGV +V H I
Sbjct: 324 AAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHII 383

Query: 443 NAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXF 502
           NAVIL+SV+SVANS+ Y+  RL+  LAQ GYAPK+ DYVDR GRPLR+++         F
Sbjct: 384 NAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAF 443

Query: 503 CATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLG 562
            A S KE  VFTWL AI+GLS++FTW +I +SH+RFR+ M+VQGRSL ELG++A TG+ G
Sbjct: 444 VAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWG 503

Query: 563 SYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRL 621
           S Y      L  VAQFWVAL P+ N    DAE+FFQNYLA PI LA Y G+ ++ RDF L
Sbjct: 504 SIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDFTL 563

Query: 622 FIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
                 IDL  HR I+D EL+RQEDEE KEKLRN    ++   FWC
Sbjct: 564 LNPLDKIDLDFHRRIYDPELMRQEDEENKEKLRNMSLMRKAYHFWC 609

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  525 bits (1353), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 262/528 (49%), Positives = 334/528 (63%), Gaps = 8/528 (1%)

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
           E+     ++K++IK RH++M+S                LA+AGPA LVIGY +    LYC
Sbjct: 62  EECGAATKMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLYC 121

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
           IIQA GEL + YS + G++  + S LVDP   F+V+WVYC+QW+ V PL+LVT++MT++Y
Sbjct: 122 IIQAAGELGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVRY 181

Query: 262 WTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAG 321
           WT   +PD                GAKGYAEAEF FN CKV+M+ GF I+ I IN G AG
Sbjct: 182 WTNA-NPDIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAINCGGAG 240

Query: 322 TDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIP 381
           T GYIGAKYW+ PG+F        FKGV                  LTA+EQ NPRK+IP
Sbjct: 241 TSGYIGAKYWHSPGSFAAG-----FKGVCYVFCYAAFSYGGIEVMVLTASEQENPRKSIP 295

Query: 382 SAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNS-ASPYVLAASLHGVHVVQH 440
           +A KKV YR               VPYNS +LMGSS    S ASP V+A + HGV +V H
Sbjct: 296 NACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASPLVIAVASHGVKIVPH 355

Query: 441 FINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXX 500
            INAVIL+SV+SV NS+ YS+ RLLL L++ GYAPK+ +YVDR GRPL            
Sbjct: 356 IINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAITLLVALI 415

Query: 501 XFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGV 560
            F A S  E D+F WLLAISGLSQIF W +IC+SH+RFR  M  QG SLG++G+++QTG 
Sbjct: 416 AFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGYKSQTGY 475

Query: 561 LGSYYAAIMLFLALVAQFWVALVPMNTH-TLDAENFFQNYLAMPILLALYVGFKLWRRDF 619
            GS++A ++  L L+AQFWVA+ P+     L+AE FFQNYLA PILL  Y G+K++ +D+
Sbjct: 476 WGSWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLGAYFGYKVYHKDW 535

Query: 620 RLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           RL I A  +DL SHR I DEE+LRQED E+ EK+ N   W R+  FWC
Sbjct: 536 RLCIPASEVDLSSHRNISDEEILRQEDYEWNEKMSNSSIWVRLCHFWC 583

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  524 bits (1350), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 259/527 (49%), Positives = 342/527 (64%), Gaps = 8/527 (1%)

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
           E+   ++++K+TIK RH++M+S                LA+AGP  L+IGYG+    LYC
Sbjct: 56  EETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLYC 115

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
           IIQA GEL + YS + G++  + S LVDP   F+V+WVYCIQW+ V PL+LVT+++TIKY
Sbjct: 116 IIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIKY 175

Query: 262 WTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAG 321
           WT   +PD                GAKGYAEAEF FN CKV+MM+GF I+ I IN G AG
Sbjct: 176 WT-DTNPDIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGAG 234

Query: 322 TDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIP 381
            DGYIGA+YW+ PGAF        FKGV                  LTA+EQ NPRK+IP
Sbjct: 235 NDGYIGARYWHTPGAFS-----TGFKGVCYVFCYAAFAYGGIEVMVLTASEQENPRKSIP 289

Query: 382 SAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHF 441
           SA KKV YR               VPY++ +L  + S  + ASP+V+A + HG+ VV H 
Sbjct: 290 SACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSA-SRASPFVIAIASHGISVVPHI 348

Query: 442 INAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXX 501
           INAVIL++V+SV NS+ YS+ RLLL L++ GYAPK F+YVDR GRPL   L         
Sbjct: 349 INAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMFVGLLA 408

Query: 502 FCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVL 561
           F A S  E DVF+WLLAISGLSQ+F W +IC+SH+RFR  M+ QGRSLGE+G+++QTG  
Sbjct: 409 FIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKSQTGYW 468

Query: 562 GSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFR 620
           GS++A I+    LVAQFWVA+ P+ N   L A++FFQ+YLA P+L+ +Y G+K++ +D+R
Sbjct: 469 GSWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYFGYKIYYKDWR 528

Query: 621 LFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           L I A  +DL SHR IFDE+ L+QED ++KEK+R    W ++  FWC
Sbjct: 529 LCIPATEVDLNSHRKIFDEDELKQEDLDWKEKMRTASIWVKIYHFWC 575

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  523 bits (1348), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 272/595 (45%), Positives = 344/595 (57%), Gaps = 40/595 (6%)

Query: 74  KNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYAT 133
           +   F  ++DSF+RAE  +A                  D+DLE+   ++   DD      
Sbjct: 41  RRTHFTKFVDSFRRAEDKHA------------------DSDLEDGSKSITSDDD------ 76

Query: 134 VNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYG 193
                           +K+ +K RHVIMM+                LA AGPAPLV+GYG
Sbjct: 77  ---------------HMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYG 121

Query: 194 IMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELV 253
           ++    Y +IQA GE+AV Y  +  SFNT+ S  V   F FA  W++CIQWL V PLEL+
Sbjct: 122 LVSFVTYFMIQAAGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELI 181

Query: 254 TSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAI 313
           T+SMTIKYW   ++PD                G K Y E EF FN CK++M+ GF I++I
Sbjct: 182 TASMTIKYWNDTINPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSI 241

Query: 314 CINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQ 373
            IN G AG DGYIG KYW +PGAF  ++   RFKGV                  L+  EQ
Sbjct: 242 VINCGGAGRDGYIGNKYWINPGAFASESPAARFKGVAYILVTGYFSYGGTELFSLSVNEQ 301

Query: 374 SNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLH 433
            NPRK+ P+AAK+  YR               VP++SDQLMG+      ASPYVLAASLH
Sbjct: 302 KNPRKSTPAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHASPYVLAASLH 361

Query: 434 GVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLC 493
           GV VV HFINAVIL+SV+SVANSA Y+S RL+  LA+ GYAPKWF+YVDR GRPLR++  
Sbjct: 362 GVKVVPHFINAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCI 421

Query: 494 XXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELG 553
                   F A SP+E   FTWL AI+GLS++FTW +I +SHIRFR  M+VQG+SL ELG
Sbjct: 422 CGLFGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELG 481

Query: 554 FRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTH-TLDAENFFQNYLAMPILLALYVGF 612
           +RA TG+ GS Y+     L  +AQFWVAL P  ++   DAE FF++YLA P+ L  Y G+
Sbjct: 482 YRATTGIWGSVYSVFFNMLVFIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGY 541

Query: 613 KLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            ++ RDF        IDL  HR I+D ELLRQED E KE+LRN     R+  FWC
Sbjct: 542 MIYSRDFTFLTPLDKIDLDFHRRIYDPELLRQEDAETKERLRNSGWLARLRSFWC 596

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  514 bits (1325), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 266/583 (45%), Positives = 345/583 (59%), Gaps = 15/583 (2%)

Query: 100 ENAVENYSMQEFDNDLENKKSNLHIRDDE--------LDYATVNVDSQPVEQQD------ 145
           E  V+  S +   N+LE+   NL   ++         +D      DS   + +D      
Sbjct: 11  EKTVDYSSTEYLPNELESPSFNLDATEESRSGLVHRFVDSFKRAQDSTENDLEDGTKPLG 70

Query: 146 ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQA 205
           + + LK+ +K RHVIMM                 L+  GP  LVIGY ++    Y +IQA
Sbjct: 71  DASHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQA 130

Query: 206 CGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK 265
            GE+AVAY  + G+FN++ S  +   F FA  W++ IQWL V PLEL+T+S+TIKYW  K
Sbjct: 131 AGEMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDK 190

Query: 266 VDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGY 325
           ++ D                G K Y EAEF FN CKV+M+ GF I++I IN G AG DGY
Sbjct: 191 INADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGY 250

Query: 326 IGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAK 385
           IGAKYW DPG+F     +E+FKG+                  L+  EQ NPRK+ P AAK
Sbjct: 251 IGAKYWRDPGSFAEGDSVEKFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQAAK 310

Query: 386 KVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAV 445
           +  YR               VP+N+DQLMGS      ASPYVLAAS+HGV VV HFINAV
Sbjct: 311 QSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPHFINAV 370

Query: 446 ILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCAT 505
           IL+SV+SVANSA Y+S RL+  LA+ GYAPK+ DYVDR GRPLR+++         F + 
Sbjct: 371 ILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGFVSA 430

Query: 506 SPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYY 565
           S KE +VFTWL AI+GLS++FTW  I +SH+RFR+ M++ GRS  E+GFRA TG+ GS Y
Sbjct: 431 SSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWGSMY 490

Query: 566 AAIMLFLALVAQFWVALVPMNTH-TLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIR 624
                 L  +AQFWVAL P + H  +DAE+FFQ+YLA PI L  Y G+ L++RDF   + 
Sbjct: 491 GISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYMLYKRDFTFLVP 550

Query: 625 AKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
              IDL  HR I+D EL+RQEDEE KEK++N   W R+  FWC
Sbjct: 551 LDKIDLNFHRRIYDPELIRQEDEENKEKIKNSSVWVRMFHFWC 593

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  512 bits (1318), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 261/578 (45%), Positives = 351/578 (60%), Gaps = 9/578 (1%)

Query: 90  TPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQ 149
           T + SSS  DE+ V+         D           D       V++  +   +    A+
Sbjct: 5   TSSISSSKKDESYVKVSPNTVGSGDERRTGIMRGFIDSFRRGRDVDLMCKADAEDGTTAK 64

Query: 150 LKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGEL 209
           +K+TIK RH++M++                LA+AGPA L++GY +    LY I++A GEL
Sbjct: 65  MKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAAGEL 124

Query: 210 AVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPD 269
            + YS + G++  + S LVDP   F+V+WVYCIQW+ V PL+LVT++M I+YWT  ++PD
Sbjct: 125 GICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWT-DINPD 183

Query: 270 XXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAK 329
                           GAKGYAEAEFFFN CKV+M+IGF I+ + IN G AGT GYIG K
Sbjct: 184 IFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYIGDK 243

Query: 330 YWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAY 389
           YW++P  F     +  FKG+                  L+A+EQ NPRK+I SA KKV Y
Sbjct: 244 YWHEPRPF-----MNGFKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKSISSACKKVIY 298

Query: 390 RXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLS 449
           R               VP +   L   +S G+ ASP V+A S HGV +V H INAVIL++
Sbjct: 299 RIVLIYLLTTVIVCFLVPADHPSL---ASEGSRASPLVIAVSFHGVKIVPHIINAVILIA 355

Query: 450 VLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKE 509
           V+SV NS+ YS+ RLLL LA+ GYAPK F Y+DR GRPL +           F A SP +
Sbjct: 356 VVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFLAASPAQ 415

Query: 510 TDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIM 569
            DVF WLLAISGLSQ+F W +IC+SHIRFR  M+ QGRS+GE+G++A+TG  GS+ A + 
Sbjct: 416 DDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTGYWGSWIAVVT 475

Query: 570 LFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNID 629
            FL L+AQFWVA+ P+ T  +DA +FFQ+YLA PILL  Y G+K++ +D+R+ I A  +D
Sbjct: 476 AFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKDWRICIPASEVD 535

Query: 630 LISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           LISHR +FDE+ L+QED E+K KL++ P W R+  FWC
Sbjct: 536 LISHRQVFDEDELKQEDLEWKLKLKSSPIWVRIYHFWC 573

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  509 bits (1311), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 268/598 (44%), Positives = 352/598 (58%), Gaps = 15/598 (2%)

Query: 82  LDSFKRAET-PNASSSTADENAVENYSMQEF----DNDLENKKSNLHIRDDELDYATVNV 136
           ++S K+ ET P  +S T+      N + ++F    D      +++ +   D    A VN 
Sbjct: 1   MESSKKNETSPEVNSITSSTLKTPNVT-EKFEPYPDTTAVKHRTHFNRFVDSFKRAEVNH 59

Query: 137 DSQPVE------QQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVI 190
           +   +E      Q D+N  LK+ +K RHVIMMS                L  AGPA LVI
Sbjct: 60  NGIDLEDGTNSIQSDDN--LKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVI 117

Query: 191 GYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPL 250
           GY ++    Y +IQA GE+AV Y  + G FN + S  V   F FA  W++CIQWL V PL
Sbjct: 118 GYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPL 177

Query: 251 ELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFI 310
           EL+T+SMTIKYW  K++ D                G + Y EAEF FN CK++M+ GF I
Sbjct: 178 ELITASMTIKYWNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVI 237

Query: 311 MAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTA 370
           ++I +N G AG DGYIG KYW DPGAF       RFKGV                  L+ 
Sbjct: 238 LSIVVNCGGAGVDGYIGGKYWRDPGAFASDNAASRFKGVAFVLVTAYFSYGGVELFALSV 297

Query: 371 AEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAA 430
            EQ NPR++ P+AAK+  YR               VP+NSDQLMG+      ASPYVLA 
Sbjct: 298 NEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAV 357

Query: 431 SLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRS 490
           S+HGV VV H INAVIL+SV SVANSA Y+S RLL  LA+ GYAPK+F+YVDR GRPLR+
Sbjct: 358 SIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRA 417

Query: 491 MLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLG 550
           ++         FCA S +E  +FTWL AI+GLS++FTW +I +SH+RFR  M+ QG+SL 
Sbjct: 418 LILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLN 477

Query: 551 ELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTL-DAENFFQNYLAMPILLALY 609
           ELG+ + TG+ GS Y      L  +AQFWVAL P  +  +  AE FF++YLA P+ L  Y
Sbjct: 478 ELGYISITGIWGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFY 537

Query: 610 VGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +G+ L+ RDF      K IDL +HR ++D ELLRQEDEE KE++RNG   +++++FWC
Sbjct: 538 LGYMLYSRDFTFLTDLKKIDLDNHRRLYDPELLRQEDEETKERIRNGGWTQKLLNFWC 595

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  508 bits (1309), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 267/605 (44%), Positives = 351/605 (58%), Gaps = 46/605 (7%)

Query: 71  PQVK--NERFRN-----WLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLH 123
           P+VK  +E  RN     ++DSF+RAE     S   +EN           NDLE+      
Sbjct: 38  PEVKEHSEESRNGLVHRFVDSFRRAE-----SQCLEEN-----------NDLED------ 75

Query: 124 IRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQA 183
                         ++P++    N  LK+++K RHV+MMS                L  A
Sbjct: 76  -------------GTRPMKS---NNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLA 119

Query: 184 GPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQ 243
           GP  LVIGY ++    Y ++QA GE+ VAY+ + G+FN + S  +   F FA  W++CIQ
Sbjct: 120 GPGSLVIGYVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQ 179

Query: 244 WLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVM 303
           WL V PLEL+TSSMTIKYW   ++ D                G K Y E EF FN CK++
Sbjct: 180 WLTVLPLELITSSMTIKYWNDSINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKIL 239

Query: 304 MMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXX 363
           M+ GF I+++ IN G AG DGYIG KYW DPG+F   +   RFKG+              
Sbjct: 240 MVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFADGSNATRFKGICFILVTAYFSFGGI 299

Query: 364 XXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSA 423
               L+  EQSN RK+ P AAK+  YR               VP+N+DQLMGS S    A
Sbjct: 300 ELFVLSINEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHA 359

Query: 424 SPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDR 483
           SPYVLAAS+H V V+ H INAVIL+SV+SVANSA Y++ RL+  LAQ GYAP++ +Y+DR
Sbjct: 360 SPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDR 419

Query: 484 NGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQ 543
            GRPLR++          F A SP+E   FTWL AI+GLS+IFTW  I +SHIRFR+ M+
Sbjct: 420 EGRPLRALAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMK 479

Query: 544 VQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAM 602
           VQGRSLGELG++A TG+ GSYY      L  +AQFWVAL P+ N    D + FF+ YLA 
Sbjct: 480 VQGRSLGELGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCDVQAFFEGYLAA 539

Query: 603 PILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRV 662
           P+ + +Y+G+ L+ +DF L      IDL  HR ++D E++RQEDEE KEKLRN   + R+
Sbjct: 540 PLWIFMYLGYMLYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEENKEKLRNSSIFFRM 599

Query: 663 VDFWC 667
            +FWC
Sbjct: 600 YNFWC 604

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  508 bits (1309), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 268/604 (44%), Positives = 347/604 (57%), Gaps = 47/604 (7%)

Query: 67  SKFLPQVKNERFRNWLDSFKRAE-TPNASSSTADENAVENYSMQEFDNDLENKKSNLHIR 125
           S+F  QVKN   + ++DSFKRA+ +P+                    NDLE K +  H  
Sbjct: 53  SRFDVQVKNRHLQGFIDSFKRADDSPD-------------------HNDLE-KTTTAH-- 90

Query: 126 DDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGP 185
                           ++Q      K+T+K RHVIMMS                L+ AGP
Sbjct: 91  ----------------QEQ------KKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGP 128

Query: 186 APLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWL 245
           A LVI YG++    Y +IQA GE+AV Y  + GSFN + SF +   F FA  W++CIQWL
Sbjct: 129 ASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWL 188

Query: 246 CVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMM 305
            V PLEL+T++MTIKYW T +DPD                G + Y E EF FN CK++M+
Sbjct: 189 TVLPLELITAAMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMI 248

Query: 306 IGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXX 365
            GF I AI +N G AG DGYIG KYW+DPGAF       RFKG+                
Sbjct: 249 GGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAFASSNGASRFKGICYNLVNAYFSYGGNEL 308

Query: 366 XXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSG-GNSAS 424
             L+  +Q NPRK+ P+AAK   YR               VP+NS +L+G+S G G  AS
Sbjct: 309 FVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHAS 368

Query: 425 PYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRN 484
           PYVLAAS+HG+ VV H INAVIL++++SVANS+ Y+  RLL  LAQ GYAP++  YVDR 
Sbjct: 369 PYVLAASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRR 428

Query: 485 GRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQV 544
           GRPL ++L         F ATSP+E +VFTWL AISGLS++FTW +I  SHIRFRR M++
Sbjct: 429 GRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKL 488

Query: 545 QGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNT-HTLDAENFFQNYLAMP 603
           Q +SL  LG++A TG+ GSY+      L   AQFWVAL P N+    DA +FF +YLAMP
Sbjct: 489 QNKSLDTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMP 548

Query: 604 ILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVV 663
           I L  Y G+  W +DF +      +DL +HR ++D E LRQED E KE+LRN     ++ 
Sbjct: 549 IWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYDPEFLRQEDLENKERLRNSSFLVKIY 608

Query: 664 DFWC 667
           +FWC
Sbjct: 609 EFWC 612

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  508 bits (1307), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 258/595 (43%), Positives = 339/595 (56%), Gaps = 33/595 (5%)

Query: 74  KNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYAT 133
           +N     + DSFKRAE         +EN           +DLE+                
Sbjct: 47  RNRLIHRFTDSFKRAEGSTTKIKPINENT----------SDLEDG--------------- 81

Query: 134 VNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYG 193
                  ++    +++LK+++K RHV+MMS                L   GPA LVIGY 
Sbjct: 82  -------IQSFTSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYV 134

Query: 194 IMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELV 253
           ++    Y +IQA GE+AV Y  +  +FN + S  +   F FA  W+YC QW  V PLEL+
Sbjct: 135 LVSFITYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELI 194

Query: 254 TSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAI 313
           T+SMTI++W  K++PD                G K Y E EF FNCCK++M+ GF ++++
Sbjct: 195 TASMTIQFWNDKINPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSV 254

Query: 314 CINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQ 373
            IN G AG DGYIG  YW+ PGAF G T I RFK V                  L+  EQ
Sbjct: 255 VINCGGAGNDGYIGGAYWHKPGAFAGDTSIARFKNVCYILVTAYFSFGGMELFVLSVQEQ 314

Query: 374 SNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLH 433
           +NPRK+ P AAK+  YR               VPYN DQL+G+      ASPYVLAAS+H
Sbjct: 315 TNPRKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHASPYVLAASIH 374

Query: 434 GVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLC 493
           GV +V H INAVIL+SV+SVANS+ Y+  RL+  LAQ GYAPK+ DYVDR GRPLR+++ 
Sbjct: 375 GVRIVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIV 434

Query: 494 XXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELG 553
                   F A S KE  VFTWL AI+GLS++FTW +I +SH+RFR+ M+VQGRSL ELG
Sbjct: 435 CCVIGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELG 494

Query: 554 FRAQTGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYVGF 612
           ++A TG+ GS Y +    L  +AQFWVAL P+ N    +AE FF++YLA PI L  Y+G+
Sbjct: 495 YKATTGIWGSIYGSFFNILVFIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGY 554

Query: 613 KLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            ++ RDF L      IDL  HR ++D EL+RQEDEE KEK++N     +   FWC
Sbjct: 555 MIYNRDFTLLNPLDKIDLDFHRRVYDPELMRQEDEENKEKIKNMSFLSKAHHFWC 609

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  507 bits (1305), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 260/605 (42%), Positives = 347/605 (57%), Gaps = 46/605 (7%)

Query: 71  PQVK--NERFRN-----WLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLH 123
           P++K  +E  RN     ++DSF+RAE+                   E DNDLE+   ++ 
Sbjct: 38  PEIKEHSEESRNGLVHRFVDSFRRAESQRL----------------EEDNDLEDGTKSM- 80

Query: 124 IRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQA 183
                                  N  LK+++K RHV+MMS                L+ A
Sbjct: 81  ---------------------KSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLA 119

Query: 184 GPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQ 243
           GP  LVIGY ++    Y ++QA GE+ V Y  + G+FN + S  +   F FA  W++CIQ
Sbjct: 120 GPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQ 179

Query: 244 WLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVM 303
           WL V PLEL+TSSMT+KYW   ++ D                G K Y E EF FN CK++
Sbjct: 180 WLTVLPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKIL 239

Query: 304 MMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXX 363
           M+ GF I+++ IN G AG DGYIG KYW DPG+F   +   RFKG+              
Sbjct: 240 MVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGI 299

Query: 364 XXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSA 423
               L+  EQSNPRK+ P AAK+  YR               VP+N+DQLMGS      A
Sbjct: 300 ELFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHA 359

Query: 424 SPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDR 483
           SPYVLAAS+H V V+ H INAVIL+SV+SVANSA Y++ RL+  LAQ GYAPK+ +Y+DR
Sbjct: 360 SPYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDR 419

Query: 484 NGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQ 543
            GRPLR+++         F A SP+E   FTWL AI+GLS++FTW  I +SHIRFR+ M+
Sbjct: 420 EGRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMK 479

Query: 544 VQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAM 602
           VQGRSL E+G++A TG+ GSYY      L  +AQFWVAL P+ N    DA+ FF++YLA 
Sbjct: 480 VQGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAA 539

Query: 603 PILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRV 662
           P+ + +YVG+ +++RDF        IDL  HR ++D E++RQEDEE KE+L+N   + RV
Sbjct: 540 PLWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKNSSIFVRV 599

Query: 663 VDFWC 667
             FWC
Sbjct: 600 YKFWC 604

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  507 bits (1305), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 259/597 (43%), Positives = 343/597 (57%), Gaps = 39/597 (6%)

Query: 72  QVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDY 131
           + +N     ++DSFKRAE+ +                 E DNDLE+   ++         
Sbjct: 46  ESRNGLVHRFVDSFKRAESQHL----------------EDDNDLEDGTRSM--------- 80

Query: 132 ATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIG 191
                          N +LK+++K RHV+MMS                L  AGP  LVIG
Sbjct: 81  -------------KSNNRLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIG 127

Query: 192 YGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLE 251
           Y ++    Y ++QA GE+ V Y  + G+FN + S  +   F FA  W++CIQWL V PLE
Sbjct: 128 YVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLE 187

Query: 252 LVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIM 311
           L+TSSMTIKYW  K++ D                G K Y E EF F+ CK++M+ GF I+
Sbjct: 188 LITSSMTIKYWNDKINSDVFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKILMIAGFIIL 247

Query: 312 AICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAA 371
           ++ IN G AG DGYIG KYW DPG+F       RFKG+                  L+  
Sbjct: 248 SVVINCGGAGVDGYIGGKYWRDPGSFAEGNGATRFKGICFILVTAYFSFGGIELFVLSIN 307

Query: 372 EQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAAS 431
           EQSNPRK+ P AAK+  YR               VP+N+DQLMGS S    ASPYVLAAS
Sbjct: 308 EQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAAS 367

Query: 432 LHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
           +H V VV H INAVIL+SV+SVANSA Y++ RL+  LAQ GYAPK+ DY+DR GRPLR++
Sbjct: 368 IHKVRVVPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRAL 427

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
                     F A SP+E   FTWL AI+GLS++FTW  I +SHIRFR+ M+VQGRSL E
Sbjct: 428 FVCCLVGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDE 487

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYV 610
           +G++A TG+ GSYY      L  +AQFWVAL P+ N    +A+ FF++YLA P+ L +Y+
Sbjct: 488 VGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYL 547

Query: 611 GFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           G+ L+ RDF        IDL  HR ++D E++RQE+EE KE+L+N   + R+ +FWC
Sbjct: 548 GYMLYERDFTFLNPLDKIDLDYHRRVYDPEIIRQENEENKERLKNSSFFFRIYNFWC 604

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  507 bits (1305), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 268/597 (44%), Positives = 341/597 (57%), Gaps = 21/597 (3%)

Query: 74  KNERFRNWLDSFKRAE-TPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYA 132
           + +    ++DSFKRA+  P    S            +E  N+    K+     +D LD  
Sbjct: 56  RTKLVHRFVDSFKRAQDVPTGRKS------------KEIGNN-GGSKTKGGFEEDSLDLE 102

Query: 133 TVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGY 192
             + DS        N  LK+ +K RHV+MMS                L   GPA LVIGY
Sbjct: 103 GSDHDSIIT-----NTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALVIGY 157

Query: 193 GIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLEL 252
            ++    Y +IQA GE+AV Y  + G+FN + S  V   F FA  W++CIQWL V PLEL
Sbjct: 158 VLVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLPLEL 217

Query: 253 VTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAK-GYAEAEFFFNCCKVMMMIGFFIM 311
           +T+S+TIKYW  K++ D                G    Y E EF FN CK++M+IGF IM
Sbjct: 218 ITASLTIKYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVIGFIIM 277

Query: 312 AICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAA 371
           +I IN G AG   YIG K+W+DPGAF G+T   RFKG+                  L+  
Sbjct: 278 SIVINAGGAGNREYIGGKFWHDPGAFAGKTAGSRFKGICYVLVSGYFSYGGTELFALSVN 337

Query: 372 EQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAAS 431
           EQSNPR++ P A+K   YR               VPY+SD+LMGS      ASPYVLAAS
Sbjct: 338 EQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSATHASPYVLAAS 397

Query: 432 LHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
           L+GV +  HFINAVIL+SV+SVANS+ Y++ RL+  LAQ GYAPK+ DYVDR GRPL ++
Sbjct: 398 LNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLDYVDRQGRPLLAL 457

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
           +         F A SPKE +VFTWL AI+GLS++FTW +I +SH+RFR  M++Q RSL E
Sbjct: 458 IACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFRMAMKLQNRSLEE 517

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTH-TLDAENFFQNYLAMPILLALYV 610
           LG++A TG+ GS Y      L   AQFW AL P       +A +FF NYLAMPI L  Y 
Sbjct: 518 LGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFANYLAMPIWLVFYF 577

Query: 611 GFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           G+ LW RDF+L      IDL  HR I+D EL+RQEDEE KE+LRNG    R+  FWC
Sbjct: 578 GYMLWTRDFQLLKPLDKIDLDFHRRIYDPELMRQEDEESKERLRNGSFMMRMYHFWC 634

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  504 bits (1297), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 261/596 (43%), Positives = 342/596 (57%), Gaps = 34/596 (5%)

Query: 74  KNERFRNWL-DSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYA 132
           K+E+  + L +SFKRAE     +   +EN           +DLE+               
Sbjct: 46  KSEKLIHRLANSFKRAEGSITKTRQINENT----------SDLEDG-------------- 81

Query: 133 TVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGY 192
                   +E    +++LK+++K RHV+MMS                L   GPA LVIGY
Sbjct: 82  --------IESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGY 133

Query: 193 GIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLEL 252
            ++    Y +IQA GE+AV Y  +  +FN + S  +   F FA  W+YC QWL V PLEL
Sbjct: 134 VLVSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLEL 193

Query: 253 VTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMA 312
           +T+SMTI+YW  K++PD                G K Y E EF FNCCK++M+ GF I++
Sbjct: 194 ITASMTIQYWNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILS 253

Query: 313 ICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAE 372
           + IN G AG DGYIG  YW++PGAF G T I RFK V                  L+  E
Sbjct: 254 VVINCGGAGDDGYIGGAYWHNPGAFAGDTSIARFKNVCYILVTGYFSFGGMELFALSVQE 313

Query: 373 QSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASL 432
           QSNPRK+ P AAK+  YR               VPYN DQLMG+      ASPYVLAAS+
Sbjct: 314 QSNPRKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASI 373

Query: 433 HGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSML 492
           HGV +V H INAVIL+SV+SVANS+ Y+  RL+  L+Q GYAPK+ DYVDR GRPLR+++
Sbjct: 374 HGVKIVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALI 433

Query: 493 CXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGEL 552
                    F A S KE  VFTWL AI+GLS++FTW +I +SH+RFR+ M+VQGRSL EL
Sbjct: 434 VCCIFGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDEL 493

Query: 553 GFRAQTGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYVG 611
           G++A TG+ GS Y      L  +AQFWVAL P+ N      E+FF++YLA PI L  + G
Sbjct: 494 GYKATTGIWGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFG 553

Query: 612 FKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           + ++ RDF L      IDL  HR I+D EL+RQED+E +EK +N    ++   FWC
Sbjct: 554 YMIYNRDFTLLNPLDKIDLDFHRRIYDPELIRQEDQENEEKTKNMSLMRKAYHFWC 609

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  503 bits (1296), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 258/606 (42%), Positives = 343/606 (56%), Gaps = 40/606 (6%)

Query: 64  HGASKFLPQVKNER--FRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSN 121
           H  S + P  + +      +++SFKRAE P                    D+DLE     
Sbjct: 25  HSKSSYEPASRQDSTMIHRFVNSFKRAEQPPLKQ----------------DSDLEE---- 64

Query: 122 LHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLA 181
                   D  T+  D+Q          LK+T+K RHV+MMS                L 
Sbjct: 65  --------DTDTIVTDTQ----------LKKTMKSRHVVMMSLGTGIGTGLLVANAQGLH 106

Query: 182 QAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYC 241
           +AGPAPLVI YG++    Y +IQA GE+AV Y  + G+FN + S  +   F FA  W++ 
Sbjct: 107 KAGPAPLVIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFF 166

Query: 242 IQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCK 301
           IQWL V PLEL+T++MT++YW   ++ D                G K Y E EF FN CK
Sbjct: 167 IQWLTVLPLELITAAMTVQYWNDSINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCK 226

Query: 302 VMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXX 361
           ++ + GF I +I +N G AG  GYIGAKYW+DPGAF   T   RFKGV            
Sbjct: 227 ILFVGGFIIFSIVVNVGGAGNSGYIGAKYWHDPGAFTSDTNAGRFKGVCYVLVTAYFSYG 286

Query: 362 XXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGN 421
                 L+  EQ NPR++ P+AAK+  YR               VP NS++LMGS     
Sbjct: 287 GMELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVT 346

Query: 422 SASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYV 481
            ASPYVLAAS+HGV VV H +NAVIL+S++SV NSA Y++ RL+  LAQ G+APK+ DYV
Sbjct: 347 HASPYVLAASIHGVKVVPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYV 406

Query: 482 DRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRG 541
           DR GRPL +++         F A S KE  VF WL AI+GL+++FTW  I +SHIRFR+ 
Sbjct: 407 DREGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQA 466

Query: 542 MQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLA 601
           M++Q +SL E+G+++  GV GSY+      L  VAQFWVAL P     + A+ FF++YLA
Sbjct: 467 MKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLVFVAQFWVALAPPMYTEMSADTFFESYLA 526

Query: 602 MPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKR 661
            PI  A Y G+ +W+RDF LF   +++DL  HR I+D EL++QEDEE KE L+N P WKR
Sbjct: 527 FPIFFAFYFGYMIWKRDFTLFSDLESVDLDYHRRIYDPELVKQEDEEKKEMLKNSPMWKR 586

Query: 662 VVDFWC 667
           +  FWC
Sbjct: 587 MYYFWC 592

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  503 bits (1296), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 263/590 (44%), Positives = 341/590 (57%), Gaps = 35/590 (5%)

Query: 78  FRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVD 137
           FR ++DSFK AE    S               E D+D+E        R+ +  Y +VN D
Sbjct: 53  FRRFVDSFKPAEDNKHS---------------EVDSDVE--------RNGDAAY-SVNTD 88

Query: 138 SQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGT 197
           +           LK+ +K RHVIMM+                L   GPA LVIGYG++  
Sbjct: 89  TH----------LKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVSM 138

Query: 198 CLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSM 257
             Y +IQA GE+AVAY  + G+FNT+ S  V   F FA  W++CIQWL V PLEL+T+S+
Sbjct: 139 VTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASL 198

Query: 258 TIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINT 317
            IKYWT KV+ D                G K Y E EF FN CK++M+ GF I +I +N 
Sbjct: 199 IIKYWTEKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVNC 258

Query: 318 GAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPR 377
           G AG DGYIG KYW+ PGAF G    ERFKGV                  L+  EQ NPR
Sbjct: 259 GGAGHDGYIGGKYWHSPGAFAGTNAAERFKGVCYVLVSGYFSYGGTELYVLSVNEQENPR 318

Query: 378 KAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHV 437
           K+ P AAK+  YR               VP+N DQLMG+      ASPYVLAAS+HGV V
Sbjct: 319 KSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHASPYVLAASIHGVRV 378

Query: 438 VQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXX 497
           V H INAVIL++V+SVANS+ Y++ RLL  LA+ GYAPK+  YVDR GRPL ++L     
Sbjct: 379 VPHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPLYALLACAVF 438

Query: 498 XXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQ 557
               F A S +E  VFTWL AI+GLS++FTW +I +SH+RFR+ M++QGR L E+G+ A 
Sbjct: 439 GVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYIAN 498

Query: 558 TGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRR 617
           TG  GS Y  +   L  +AQFWVAL P  +  + A++FF++YLA PI +A Y G+ +W +
Sbjct: 499 TGYWGSVYGVVFNILVFIAQFWVALAPPKS-PITAQSFFESYLAFPIWIAFYFGYMIWNK 557

Query: 618 DFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           D+        IDL  HR I+D E+L+QED E KE++RNG  W ++  FWC
Sbjct: 558 DYTFLNPLDKIDLDHHRRIYDPEVLKQEDMENKERVRNGNIWTKLKWFWC 607

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  502 bits (1292), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 260/567 (45%), Positives = 338/567 (59%), Gaps = 15/567 (2%)

Query: 112 DNDLENKKSNL-HIRDDELDYATVNVDSQPVEQQD---------ENAQLKQTIKPRHVIM 161
            +D+E  KSNL H   D    A    +S  +E+ D             LK+ +K RHV+M
Sbjct: 9   SDDVEISKSNLVHRFVDSFRRA----ESPELEENDLEDGTRSIVTKTHLKKAMKSRHVVM 64

Query: 162 MSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFN 221
           MS                L  +GPA L+IGY ++    Y +IQA GE+AVAY  + GSFN
Sbjct: 65  MSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGSFN 124

Query: 222 TFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXX 281
           ++ S  +   F FA  W++ IQWL V PLEL+T+S+T+KYW  K++ D            
Sbjct: 125 SYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWNDKINADVFIIIFYAFLLF 184

Query: 282 XXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQT 341
               G K Y E EF FN CKV+M+ GF I++I IN G AGTDGYIGAKYW+DPG+F    
Sbjct: 185 IHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYIGAKYWHDPGSFADGP 244

Query: 342 KIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXX 401
            I RFKGV                  L+  EQ NPRK+ P+AAK+  YR           
Sbjct: 245 PITRFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTPAAAKQSIYRILIIYLATMIL 304

Query: 402 XXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSS 461
               VP+NSD+LMG+ S    ASPYVLAASLH V VV HFINAVIL+SV+SVANSA Y++
Sbjct: 305 IGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKVVPHFINAVILISVISVANSALYAA 364

Query: 462 SRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISG 521
            RL+  LA+ GYAPK+ +YVDR GRPLR ++         F + S KE +VFTWL AI+G
Sbjct: 365 PRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSASSKEEEVFTWLAAIAG 424

Query: 522 LSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVA 581
           LS++FTW  I +SHIRFR+ M+  G+S  E+GF+A TG+ GSYY      L  +AQFWVA
Sbjct: 425 LSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTGIWGSYYGCAFNILVFIAQFWVA 484

Query: 582 LVPMNT-HTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEE 640
           L P  +    DAE FFQ+YLA PI L  Y G+ +++RDF +    + IDL  HR I+D +
Sbjct: 485 LSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIYKRDFTILNPLEKIDLDFHRRIYDPD 544

Query: 641 LLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            ++QEDEE KE+L+N   W R+  +WC
Sbjct: 545 FIKQEDEENKERLKNSSIWARIYHWWC 571

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  502 bits (1293), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 258/594 (43%), Positives = 334/594 (56%), Gaps = 33/594 (5%)

Query: 75  NERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATV 134
           N+    ++DSFKRAE     +   +EN           +DLE                  
Sbjct: 48  NKLIHRFVDSFKRAEGSTTHTKQINENT----------SDLEGD---------------- 81

Query: 135 NVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGI 194
                 V     +++LK+++K RHV+MM+                L   GPA LVIGY +
Sbjct: 82  ------VNSFTSDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFL 135

Query: 195 MGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 254
           +    Y +IQA GE+AV Y  +  +FN + S  +   F FA  WVYC QWL V PLEL+T
Sbjct: 136 VSFVTYFMIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELIT 195

Query: 255 SSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAIC 314
           ++MTIK+W   ++PD                G KGY E EF FNCCK++M+ GF I+++ 
Sbjct: 196 AAMTIKFWNDTINPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVV 255

Query: 315 INTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQS 374
           IN G AG DGYIG KYW +PGAF G T   RFK V                  L+  EQ+
Sbjct: 256 INCGGAGNDGYIGGKYWRNPGAFAGDTSAGRFKNVCYILVTAYFSFGGMELFALSVQEQA 315

Query: 375 NPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHG 434
           NPRK  P AAK+  YR               VPYN DQLMG+      ASPYVLAAS+HG
Sbjct: 316 NPRKTTPVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHG 375

Query: 435 VHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCX 494
           V VV H INAVIL+SV+SVANS+ Y+  RL+  LAQ GY PK+ DYVDR GRPL +++  
Sbjct: 376 VKVVPHIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVC 435

Query: 495 XXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGF 554
                  F A S KE  VF WL AI+GLS++FTW +I +SH+RFR+ M+VQGRSL ELG+
Sbjct: 436 SVFGVIGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGY 495

Query: 555 RAQTGVLGSYYAAIMLFLALVAQFWVALVPMNT-HTLDAENFFQNYLAMPILLALYVGFK 613
           +A TG+ GS Y      L  +AQFWVAL P+N      AE+FFQ+YLA PI +A Y+G+ 
Sbjct: 496 KATTGIWGSAYGVFFNILVFIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGYM 555

Query: 614 LWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           ++ RDF        IDL  HR I+D EL+RQED E +E+ R+    ++   FWC
Sbjct: 556 IYNRDFTFLNPLDKIDLDFHRHIYDPELMRQEDLENEERKRDMSLMRKTYHFWC 609

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  500 bits (1288), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 260/610 (42%), Positives = 350/610 (57%), Gaps = 46/610 (7%)

Query: 66  ASKFLPQVK--NERFRN-----WLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENK 118
           A+ F P+VK  +E  R+     ++DSF+RAE+                   E DNDLE+ 
Sbjct: 33  AASFSPEVKEHSEESRSGLVHRFVDSFRRAESQRL----------------EDDNDLEDG 76

Query: 119 KSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXX 178
             ++                        N  LK+++K RHV+MMS               
Sbjct: 77  TRSMR----------------------SNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAK 114

Query: 179 PLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAW 238
            L  AGP  LVIGY ++    Y ++QA GE+ V Y  + G+FN + S  V   F FA  W
Sbjct: 115 GLKLAGPGSLVIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTW 174

Query: 239 VYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFN 298
           ++CIQWL V PLEL+TSSMTIKYW   ++ D                G K Y E EF FN
Sbjct: 175 LFCIQWLTVLPLELITSSMTIKYWNDTINADVFIAIFYVFLLFIHFFGVKAYGETEFIFN 234

Query: 299 CCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXX 358
            CK++M+ GF I+++ IN G AG DGYIG +YW +PG+F   +   RFKG+         
Sbjct: 235 SCKILMIAGFIILSVIINCGGAGVDGYIGGEYWRNPGSFADGSSATRFKGICFILVTAYF 294

Query: 359 XXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSS 418
                    L+  EQ+NPRK+ P AAK+  YR               VP+++DQLMGS S
Sbjct: 295 SFGGIELFVLSINEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSGS 354

Query: 419 GGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWF 478
               ASPYVLAAS+HGV V+ H INAVIL+SV+SVANSA Y++ RL+  LAQ GYAPK+ 
Sbjct: 355 SATHASPYVLAASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFL 414

Query: 479 DYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRF 538
           +Y+DR GRPLR+++         F A S +E   FTWL AI+GLS+IFTW  I +SHIRF
Sbjct: 415 NYIDREGRPLRALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRF 474

Query: 539 RRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTH-TLDAENFFQ 597
           R+ M+VQGRSL E+G+++ TG+ GSYY  I   L  +AQFWVAL P  +    D E+FFQ
Sbjct: 475 RKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALSPPGSDGKCDVESFFQ 534

Query: 598 NYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGP 657
           +YLA P+ + +Y+G+ ++ +DF L      IDL  HR ++D E++RQEDEE KE+LRN  
Sbjct: 535 SYLAAPLWIFMYLGYMIYNKDFTLLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLRNSS 594

Query: 658 KWKRVVDFWC 667
            + R+ + WC
Sbjct: 595 VFFRMYNMWC 604

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  498 bits (1283), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 255/592 (43%), Positives = 342/592 (57%), Gaps = 12/592 (2%)

Query: 77  RFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSN-LHIRDDELDYATVN 135
           + +N ++  ++ E  N +SSTA + A     +  F +  +          D++L+  T +
Sbjct: 37  KLQNGMEHSEKLE--NLASSTALDEAPRTGLVHRFMDSFKRADGQRAGFDDNDLESGTRS 94

Query: 136 VDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIM 195
             S+        + LK+++K RHV+MM+                L  +GPAPLV+ YG++
Sbjct: 95  FISE--------SHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLV 146

Query: 196 GTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTS 255
               Y +IQA GE+AV Y  + G+FN++ S  V   F FA  W++ +QWL V PLEL+TS
Sbjct: 147 SFVTYFMIQAAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITS 206

Query: 256 SMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICI 315
           S+TIKYW  K++ D                G + Y E EF FN CK++M+ GF I +I +
Sbjct: 207 SLTIKYWNDKINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVV 266

Query: 316 NTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSN 375
           N G AG DGYIG KYW+DPGAF   T I RFKG+                  L+  EQ N
Sbjct: 267 NCGGAGHDGYIGGKYWHDPGAFTSHTNIGRFKGICFILVTAYFSYGGTELYVLSVNEQEN 326

Query: 376 PRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGV 435
           PRK+ P AAK+  YR               VP+++DQLMGS      ASPYVLAAS+HGV
Sbjct: 327 PRKSTPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHASPYVLAASIHGV 386

Query: 436 HVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXX 495
            +V HFINAVIL+SV+SVANS+ Y+S RLL  LAQ GYAPK+  Y+DR GRPL ++    
Sbjct: 387 RIVPHFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCS 446

Query: 496 XXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFR 555
                 F A S +E  VFTWL AI+GLS++FTW  I +SH+RFR+ M+VQGR L ELG++
Sbjct: 447 LFGVIGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYK 506

Query: 556 AQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLW 615
           A +GV GS Y      L   AQFWVAL P  +    A +FF++YLA PI    Y G+ LW
Sbjct: 507 AVSGVWGSVYGVFFNILVFFAQFWVALAPPGSKP-TALSFFESYLAFPIFFTFYFGYMLW 565

Query: 616 RRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            +DF   I  ++IDL  HR ++D E +RQE EE K KL+N   W R+  FWC
Sbjct: 566 NKDFTFLIPLESIDLDFHRRVYDPEFIRQEREEKKIKLKNSSIWTRMYYFWC 617

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  497 bits (1280), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 266/597 (44%), Positives = 356/597 (59%), Gaps = 12/597 (2%)

Query: 82  LDSFKRAETPNASSSTADENAVENYS---MQEFDNDLENKK------SNLHIRDDELDYA 132
           L++    + P     +++ N  E+ S   + + D    N+K      S      D  D A
Sbjct: 6   LENLSNEKLPATECGSSNSNLRESISSNDLSDGDRGFVNRKLHNFCNSFKRANSDTFD-A 64

Query: 133 TVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGY 192
           + +++   +     N++ KQ++K RHV+MMS                L   GPA L+IGY
Sbjct: 65  SQDLEGASINSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGY 124

Query: 193 GIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLEL 252
            ++    Y ++QA GE+AVAY  + G+FN + S  +   F FA  W+YC+QWL V PLEL
Sbjct: 125 SLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLEL 184

Query: 253 VTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMA 312
           +T+S+TIKYW + ++PD                GA GY EAEF F+ CKV M+ GF I++
Sbjct: 185 ITASLTIKYWNSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILS 244

Query: 313 ICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAE 372
           I IN G AGT GYIG +YW +PGAF G + I  FKG+                  LT  E
Sbjct: 245 IVINCGGAGTGGYIGGEYWRNPGAFAGGSPIGHFKGIAYVLVTAYFSYGGMELFALTVNE 304

Query: 373 QSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSS-GGNSASPYVLAAS 431
           Q+NPRKA+PSA KK  YR               VPYNSD+LMGSS      ASPYV+A +
Sbjct: 305 QANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHASPYVIAVA 364

Query: 432 LHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
            HGV VV H INAVIL+SV+SV NSA YS+ RLL  LA+ GYAPK F YVDR GRPL ++
Sbjct: 365 SHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVAL 424

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
           +         F A S KE  VFTWL AI+GLS++FTW AIC+SH+RFR  M+ QG SL E
Sbjct: 425 VGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSE 484

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYV 610
           LG++++TG  GS YA     +  VAQFWVAL P+ N    DAE FFQ+YLA PI ++ YV
Sbjct: 485 LGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAPIGNGGKADAEAFFQSYLAFPIWISCYV 544

Query: 611 GFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           G+K++ ++++L +    IDL SHR IFD+ +L+QED+E+KEKL+N   W ++ +FWC
Sbjct: 545 GYKIYSKEWKLLVPLDEIDLNSHRHIFDKHILQQEDDEHKEKLKNSGWWVKMANFWC 601

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  495 bits (1275), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 255/591 (43%), Positives = 344/591 (58%), Gaps = 39/591 (6%)

Query: 78  FRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVD 137
           +RN++DSFKRAE  N +  +AD                             L+  T ++ 
Sbjct: 55  YRNFIDSFKRAEHGNLNEKSAD-----------------------------LEDGTASIQ 85

Query: 138 SQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGT 197
           S+        + +K+++K RHVIMMS                LA  GPA L+IGY I+  
Sbjct: 86  SK--------SYMKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSF 137

Query: 198 CLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSM 257
            +Y +IQA GE+AV Y  + G+FNT+ S  +   + FA  W++CIQW+ V PLEL+TSS+
Sbjct: 138 IVYFMIQAAGEMAVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSL 197

Query: 258 TIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINT 317
           TI+YWT  ++ D                G K Y E EF FN CK++M+ GF I +I +N 
Sbjct: 198 TIQYWT-DLNGDIFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNC 256

Query: 318 GAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPR 377
           G AG DGYIG KYW+ PG+F       RFKG+                  L+  EQ+ PR
Sbjct: 257 GGAGNDGYIGGKYWHTPGSFAEGGPTSRFKGICYVLVAGYFSYGGTELYVLSVNEQAEPR 316

Query: 378 KAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHV 437
           KA P+AAKK  YR               VP+NSDQLMG+      ASPYVLAAS+HGV V
Sbjct: 317 KATPAAAKKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHASPYVLAASIHGVKV 376

Query: 438 VQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXX 497
           V H INAVIL+SV+SVANS+ Y+S RLL  LA+ GYAPK   Y+DR GRPL ++L     
Sbjct: 377 VPHIINAVILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLCAVF 436

Query: 498 XXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQ 557
               F A+S KE  VFTWL AI+GLS++FTW  I  SH+RFR  M+VQ + + E+G++A 
Sbjct: 437 GCIAFVASSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYKAT 496

Query: 558 TGVLGSYYAAIMLFLALVAQFWVALVPMNT-HTLDAENFFQNYLAMPILLALYVGFKLWR 616
            G+ GS++ +I   L L+AQFWVAL P  +   + AE+FF+NYLAMPI +  Y+ + ++ 
Sbjct: 497 AGIYGSWFGSIFGVLVLIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVYSVYN 556

Query: 617 RDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +++ +      IDL +HR I+D +L+RQED E KEKL+N P W RV +FWC
Sbjct: 557 KEWTILTDLSKIDLDAHRRIYDPDLIRQEDAENKEKLKNSPFWVRVYNFWC 607

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  488 bits (1255), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 255/597 (42%), Positives = 346/597 (57%), Gaps = 15/597 (2%)

Query: 83  DSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATV------NV 136
           DSF + ET + S ++++ +++   S   +++   N K+  + R+    Y         N 
Sbjct: 3   DSFPK-ETKSPSYASSEHSSI--VSANSYNSSAGNSKTRGYFRNFIDSYKRADPSQLHNA 59

Query: 137 DSQPVEQQ----DENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGY 192
            S+ VE        + Q K+++  RHVIMMS                L   GP  L+IGY
Sbjct: 60  RSEDVEDGIASIRSDTQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLIIGY 119

Query: 193 GIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLEL 252
            ++    Y +IQA GE+AVAY  + G+FN + S  +   + FA  W++CIQWL V PLEL
Sbjct: 120 VLVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLPLEL 179

Query: 253 VTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGA-KGYAEAEFFFNCCKVMMMIGFFIM 311
           +TSS+TIKYW  K++ D                G  + Y E EF FN CK++M+IGF I+
Sbjct: 180 ITSSLTIKYWNDKINADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGFIIL 239

Query: 312 AICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAA 371
           +I IN G AG DGYIG KYW++PG+F       RFKG+                  L+  
Sbjct: 240 SIVINAGGAGNDGYIGGKYWHEPGSFAEGDATSRFKGICLVLVSGYFSYGGTELYVLSVN 299

Query: 372 EQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAAS 431
           EQ+ PRKA P+AAKK  YR               VP+N+DQLMG+      ASPYVLAA+
Sbjct: 300 EQAEPRKATPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHASPYVLAAT 359

Query: 432 LHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
           +HGV +V HFINAVIL+SV+SVANS+ ++  RLL  LA  GYAPK   YVDR GRPL ++
Sbjct: 360 IHGVKIVPHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDREGRPLVAL 419

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
                     F + +  E +VFTWL AI+GLS+IFTW  I  SH+RFR  M+VQG+ + E
Sbjct: 420 GISFLIGLIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQGKDINE 479

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYV 610
           LG++A TGV GS Y A    L L+AQFWVAL P+ N    DAE FF++YLA PI +A Y 
Sbjct: 480 LGYKANTGVWGSAYGAFFGVLVLIAQFWVALAPIGNGGKCDAEAFFESYLAFPIWVACYF 539

Query: 611 GFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           G+ ++ +DF L      IDL S+R I+D EL++QEDEE KE L++ P + ++  FWC
Sbjct: 540 GYMIYNKDFTLLSPLDKIDLDSYRRIYDPELIKQEDEENKENLKSRPLYYKIYRFWC 596

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  481 bits (1238), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 260/552 (47%), Positives = 336/552 (60%), Gaps = 11/552 (1%)

Query: 126 DDELDYATVNVDSQPVEQQDENA--------QLKQTIKPRHVIMMSXXXXXXXXXXXXXX 177
            D    A V  D    E Q+E A        +LK  IK RH+ M+S              
Sbjct: 39  KDSFKRADVVEDVHEKEGQEEYATGLNKTQQKLKHNIKTRHLTMISLGTGIGTGLLVASG 98

Query: 178 XPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVA 237
             L   GP  L+IGY    T LYC++QAC EL VAY+ + G++N +P+FLVD GF FAVA
Sbjct: 99  KALHYGGPGGLLIGYLTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDRGFGFAVA 158

Query: 238 WVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFF 297
            VY +QW  V PLELVT+SMTIKYWT  V+PD                G++GYAE+EF F
Sbjct: 159 LVYGLQWAIVLPLELVTASMTIKYWTESVNPDVFVAIFYLFIVFIHFFGSRGYAESEFIF 218

Query: 298 NCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXX 357
           N  KV++M GF IM I +N GA+   GYIGAKYW++PG F G+  I   KG+        
Sbjct: 219 NTLKVLLMAGFIIMGISLNCGASKL-GYIGAKYWSNPGTFAGERSINHLKGICSVWVQSA 277

Query: 358 XXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSS 417
                     LTAAEQ+NPR+++PSA K+  YR               VPY SDQL+ SS
Sbjct: 278 FAYGGSEFIALTAAEQANPRESVPSATKRWLYRVVVVFLIPIALICFLVPYTSDQLLSSS 337

Query: 418 SGGNSAS-PYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPK 476
               S + P+V+AA+ HGV +V H INA+IL SV+SV NS  YS+ R+LL LA+ G  PK
Sbjct: 338 GASASHASPFVIAAAYHGVKIVPHIINAIILTSVISVGNSGMYSAPRILLSLAENGLCPK 397

Query: 477 WFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHI 536
            F YVDR GRPL ++L         F A S  +  VFTWL AI+GLSQ+FTW +I +SHI
Sbjct: 398 IFTYVDRAGRPLATLLFVCVFGLLSFVAASKNQESVFTWLTAIAGLSQLFTWTSIALSHI 457

Query: 537 RFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTH-TLDAENF 595
           RFR  M+VQGRSLGELG+ + TG +GSYYA     + LVAQFW+A+ P++ H  LDAE+F
Sbjct: 458 RFRAAMKVQGRSLGELGYTSTTGAIGSYYAVFFNIVVLVAQFWIAIAPIDKHGELDAESF 517

Query: 596 FQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRN 655
           F+NYLA  +L+  YVG+K+W R+ +L I    IDL +HR IFDEE+L+QE+ E KE+++ 
Sbjct: 518 FKNYLAFAVLVLFYVGYKIWYREVQLLIPVDKIDLETHRQIFDEEVLQQEELERKERMKT 577

Query: 656 GPKWKRVVDFWC 667
               +R + FWC
Sbjct: 578 ASFKQRFIAFWC 589

>TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  476 bits (1226), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 255/595 (42%), Positives = 333/595 (55%), Gaps = 40/595 (6%)

Query: 74  KNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYAT 133
           K  RFR W DSFKRAE      ST  E+                                
Sbjct: 60  KTGRFRRWADSFKRAE-----KSTEAEDG------------------------------- 83

Query: 134 VNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYG 193
              +S  +   +E+ +LK+ +K RHV+MMS                LA +GPAPLVIGYG
Sbjct: 84  ---ESGSIYNGNESTELKKAMKSRHVVMMSLGTGIGTGLLVANAKGLAISGPAPLVIGYG 140

Query: 194 IMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELV 253
           ++    Y +IQA GEL V Y+ + G+FN +   LV   F FA  W+  +QWL V PLEL+
Sbjct: 141 LVSFITYFMIQAAGELGVTYASLPGNFNVYFGTLVSRPFGFATVWLASVQWLTVIPLELI 200

Query: 254 TSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAI 313
           T ++TIKYWT KV+ D                G K Y EAEF FN CK++M+ GF I++I
Sbjct: 201 TCAITIKYWTEKVNGDIFVLIIYVFLLFIHIFGVKAYGEAEFLFNTCKILMIAGFIILSI 260

Query: 314 CINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQ 373
            IN G AG DGYIG  YWN+PGAF       RFK +                  L+  EQ
Sbjct: 261 VINVGGAGNDGYIGGSYWNNPGAFASDNAASRFKSICYILVTGYFSYGGTELFVLSVNEQ 320

Query: 374 SNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLH 433
            NPRK+ P AAK   YR               VP++SDQLMGS+     ASPYVLAASLH
Sbjct: 321 ENPRKSTPQAAKHSIYRILVIYLLTMILIGFNVPHDSDQLMGSAGSSAHASPYVLAASLH 380

Query: 434 GVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLC 493
           GV VV HFINAVIL++++SVANS+ Y++ R+++ LAQ G+APK+  YVDR GRPL  +  
Sbjct: 381 GVKVVPHFINAVILIALISVANSSLYAAPRMMVSLAQQGFAPKFLTYVDREGRPLLGIAV 440

Query: 494 XXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELG 553
                   F A+S KE DVFTWL AI+GLS++FTW A  +SHIRFR+ M+VQG+++ E G
Sbjct: 441 CAVFGVIGFAASSDKEEDVFTWLAAIAGLSELFTWSAFFLSHIRFRQAMKVQGKNIKECG 500

Query: 554 FRAQTGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYVGF 612
           + + TG+ GS        L  +AQFWVAL P+ N    DA+ FFQ+YLA PI LA Y G 
Sbjct: 501 YLSVTGIWGSIIGLCFNILVFIAQFWVALSPIGNDGKCDAQAFFQSYLAFPIWLAFYFGC 560

Query: 613 KLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
             + +D+ L    ++IDL  HR I+D E L++ED   K +L+      ++V F+C
Sbjct: 561 MFYYKDYTLLNPLESIDLDDHRRIYDPEELKKEDLATKAELKRRGFHAQLVAFFC 615

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  473 bits (1218), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 239/545 (43%), Positives = 317/545 (58%), Gaps = 4/545 (0%)

Query: 127 DELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPA 186
           D    A +     P      NA LKQ +K RHV MMS                L+ AGPA
Sbjct: 76  DSYRRADIPGQDDPEGDMVSNAGLKQALKTRHVAMMSLGTGIGTGLLIANGKGLSNAGPA 135

Query: 187 PLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLC 246
           PL+IGYG++    Y ++QA GELAVA+  + GSFN + S LV   F FA  W++ +QWL 
Sbjct: 136 PLLIGYGLVSVNTYFMVQAAGELAVAFPTIPGSFNAYTSQLVSRPFGFATTWLFFVQWLT 195

Query: 247 VCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMI 306
           + P+EL+  +  +++WTT+VD D                G + Y E EFF N  KV+M+I
Sbjct: 196 MFPMELIAMTFAVRFWTTRVDADVFVLIFFVFLFIVHFIGVEAYGETEFFLNLFKVLMVI 255

Query: 307 GFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXX 366
           GF I AIC+  G AG  GYIGAKYW+DPGAF   T   RFKGV                 
Sbjct: 256 GFVIFAICVAAGGAGDSGYIGAKYWHDPGAFVSHTAEGRFKGVCYVLVSAYFSYGGTELF 315

Query: 367 XLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGS---SSGGNSA 423
            L+  EQ NPRK IP+A K   YR               VP N  +LMGS     G  S 
Sbjct: 316 VLSVNEQENPRKTIPTATKTTIYRIIFIYLLTMVLVGFTVPNNHPRLMGSPYAKEGVQSV 375

Query: 424 SPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDR 483
           SPYVLAAS H V V+ HFINAV++L+++S++NSA Y++ RL+  LAQ GY PK+FDY+DR
Sbjct: 376 SPYVLAASYHHVRVLPHFINAVVMLALVSMSNSAMYAAPRLICSLAQQGYCPKYFDYIDR 435

Query: 484 NGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQ 543
            GRP R+++         F ++S K   +F+WL AI+GLS++FTW +I +SH+RFR  ++
Sbjct: 436 RGRPTRALVLCFIIGVIAFASSSEKRETIFSWLSAIAGLSELFTWSSIMLSHVRFRAAIK 495

Query: 544 VQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVAL-VPMNTHTLDAENFFQNYLAM 602
           VQG+ + ELG+++ TGV GS Y      L   AQFWVAL  P +     A +FFQ+YLA+
Sbjct: 496 VQGKDINELGYKSNTGVWGSAYGVFFSLLVFAAQFWVALSAPNSGGKCSASDFFQSYLAL 555

Query: 603 PILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRV 662
           PI L  YVGF LW RDF   I    +DL S+R  +D ELLRQEDEE+K+ +++   W ++
Sbjct: 556 PIWLTFYVGFMLWTRDFTFLIPLNKVDLDSYRRYYDPELLRQEDEEHKQAMKSASIWIKL 615

Query: 663 VDFWC 667
             F+C
Sbjct: 616 HSFFC 620

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  472 bits (1214), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 248/582 (42%), Positives = 327/582 (56%), Gaps = 46/582 (7%)

Query: 74  KNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYAT 133
           ++ R R W+DS+KRAE P                 +E  +  E+ +S             
Sbjct: 60  RSGRIRRWIDSYKRAEHP-----------------REHIDGFEDGESK------------ 90

Query: 134 VNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYG 193
                       +   LK+ +K RHV+MMS                L  AGPAPLVIGYG
Sbjct: 91  ------------DGIHLKKQMKTRHVVMMSLGTGIGTGLLIANAKGLHFAGPAPLVIGYG 138

Query: 194 IMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELV 253
           ++    Y +IQA GELAVAY  + G+FN++   L+   F FA  W+  +QWL V PLE +
Sbjct: 139 MVSFVTYFMIQAAGELAVAYPTLPGNFNSYFGILISKPFGFATVWLAAVQWLTVLPLEFI 198

Query: 254 TSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAI 313
            +S+TIKYW  ++  D                G + Y E EF FN CKV+M+IGF I++I
Sbjct: 199 AASLTIKYWNDRISGDVFVVIFYVFLLFIHFVGVRAYGETEFIFNLCKVLMIIGFIILSI 258

Query: 314 CINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQ 373
            IN G AG DGYIG KYWNDPGAF G+T   RFKGV                  L+  EQ
Sbjct: 259 VINAGGAGNDGYIGGKYWNDPGAFAGETAGSRFKGVCYILVTGYFSYGGTELFVLSVNEQ 318

Query: 374 SNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSS-SGGNSASPYVLAASL 432
            NPRK+ P AAK   YR               VPYN  +LMG+  + G+ ASPYVLAAS+
Sbjct: 319 ENPRKSTPQAAKHSIYRIVIIYLLTMILIGFNVPYNDPRLMGADDASGSHASPYVLAASI 378

Query: 433 HGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSML 492
           HGV +V HFINAV+L++++SV NSA Y++ R+++ LA+ G+APK   YVDR GRPL S+ 
Sbjct: 379 HGVKIVPHFINAVVLIALISVGNSALYAAPRMMVSLAEQGFAPKIMAYVDREGRPLVSLG 438

Query: 493 CXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGEL 552
                    F A+S KE  VFTWL AI+GLS++FTW A  +SHIRFR  M++QG+ + E+
Sbjct: 439 ICALFGLIGFAASSSKEEQVFTWLAAIAGLSELFTWSAFFISHIRFRWAMKLQGKDIKEV 498

Query: 553 GFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGF 612
           GF A TG+ GS+Y      L   AQFWVAL P+ +  + AE+FF++YLA PI L  Y G+
Sbjct: 499 GFLASTGLYGSFYGLFFNILVFAAQFWVALSPIGSKKVGAESFFESYLAFPIWLFFYFGY 558

Query: 613 KLWRRDFRLFIRAKNIDLISHRIIFDEELL----RQEDEEYK 650
            +W +DF      ++IDL  HR I+D E +    RQE EEYK
Sbjct: 559 MVWAKDFTFLNPLESIDLDFHRRIYDPEEMAEINRQEKEEYK 600

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  470 bits (1210), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 237/590 (40%), Positives = 333/590 (56%), Gaps = 41/590 (6%)

Query: 78  FRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVD 137
           FR ++DSF+R +T  +                    DLE+ + N                
Sbjct: 32  FRRFVDSFRREDTSRS-------------------GDLEDGEIN---------------- 56

Query: 138 SQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGT 197
                   +  +L+Q ++ RHV+MMS                L   GPA L+IGY ++  
Sbjct: 57  ------STDTTKLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSI 110

Query: 198 CLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSM 257
             Y ++ A GE+AVAY  + G+FN + S  +   F FA  W++C+QWL V PLEL+T+++
Sbjct: 111 VSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATI 170

Query: 258 TIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINT 317
            IKYW   V+ +                GA+GY E EF FN CKV+M++GF I+ I IN 
Sbjct: 171 VIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINV 230

Query: 318 GAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPR 377
           GA G  GYIG +YW +PG+F   T +++ KG                   L+  E  NP+
Sbjct: 231 GAIGDTGYIGDRYWRNPGSFVSGTPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPK 290

Query: 378 KAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHV 437
            AIPSA KK  YR               VP++SD+LMGS S     SPYVLA  +HGV V
Sbjct: 291 TAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKV 350

Query: 438 VQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXX 497
           + H +NAVIL+SV+SV NSA YS+ RLL  LAQ GYAPK  DY+DR GRPL S++     
Sbjct: 351 LPHIVNAVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIF 410

Query: 498 XXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQ 557
               F A S  +  +F WL AI+GLS++FTW +IC+SH RFR+ M++QGRSL  LG+RA 
Sbjct: 411 GLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAI 470

Query: 558 TGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRR 617
           TG  GS YA     L  +AQFWVALVP+    +D  +FFQNY+A P+ L +++G+ ++ R
Sbjct: 471 TGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVDVLSFFQNYMAFPLWLIMFLGYMVYSR 530

Query: 618 DFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           ++ L      +DL +HR ++D E+L+QE+ E+KE++RN P + +V++FWC
Sbjct: 531 NWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFKERMRNSPWYVKVLNFWC 580

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  470 bits (1209), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 234/531 (44%), Positives = 308/531 (58%), Gaps = 1/531 (0%)

Query: 137 DSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMG 196
           D + +  +  +  LK+ +K RHVIMM+                L+  GP  LVIGY ++ 
Sbjct: 53  DLEEMSMESTDRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVS 112

Query: 197 TCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSS 256
              Y +IQA GE+AV Y  + GSFNT+ S  +     FA  W++ IQWL V PLEL+T +
Sbjct: 113 FVTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGT 172

Query: 257 MTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICIN 316
           MTI+YW   ++ D                G K Y E EF FN CK++ + GF I +I +N
Sbjct: 173 MTIQYWNDSINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVN 232

Query: 317 TGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNP 376
            G AGTDGYIGAKYW +PG+F   T   RFK V                  L+  EQ+NP
Sbjct: 233 AGGAGTDGYIGAKYWKNPGSFASSTSAGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANP 292

Query: 377 RKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVH 436
           R++ P AAK+  YR               VP+++DQLMG+      ASPYVLAAS+HGV 
Sbjct: 293 RRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHASPYVLAASIHGVK 352

Query: 437 VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXX 496
           VV H INAVIL+ V S+ NS+ Y++ RL   LA+ GYAPK   Y+DR GRP+ ++     
Sbjct: 353 VVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACAV 412

Query: 497 XXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRA 556
                F A S +E  VFTWL AI+ LS++FTW  I +SHIRFR  M+VQG+ L ELG++A
Sbjct: 413 VGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYKA 472

Query: 557 QTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWR 616
            TGV GS +      L  +AQFWVAL P    T+ AE FF++YLA P+ L  Y  + LW+
Sbjct: 473 LTGVWGSMWGFGFCVLVFIAQFWVALSPPG-GTISAEGFFESYLAFPLWLFFYFAYMLWK 531

Query: 617 RDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           RDF    + ++IDL +HR I+D E LRQEDEE KEK+RN   W ++  FWC
Sbjct: 532 RDFTFLTKLEDIDLDAHRRIYDPEFLRQEDEERKEKIRNSSFWIKMKYFWC 582

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  467 bits (1202), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 242/583 (41%), Positives = 332/583 (56%), Gaps = 16/583 (2%)

Query: 88  AETPNASSSTAD--ENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQD 145
           AE+PN   S  D   + +    +  F       +++  + D E+  A             
Sbjct: 20  AESPNIPISGGDGHRDGLFQRIVDSFKRVEGEVRNSSDLEDGEVTSA------------- 66

Query: 146 ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQA 205
            + +LKQ +K RHV++MS                L   GP  L+IGY  +    Y ++QA
Sbjct: 67  HSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVSIISYIMMQA 126

Query: 206 CGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK 265
            GE+AVAY  + G+FN + S  +   F FA  W++CIQW  + PLEL+TSS+ +KYWTTK
Sbjct: 127 AGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWTTILPLELITSSIVVKYWTTK 186

Query: 266 VDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGY 325
           ++ D                GA+GY E EF FN CKV+M+ GF I+ I IN GA G DGY
Sbjct: 187 INADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGILINCGAVGDDGY 246

Query: 326 IGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAK 385
           IG KYW++PGAF   + I+RFKG+                  L+  E  NPRKAIPSA  
Sbjct: 247 IGGKYWHEPGAFAAGSGIDRFKGIAYVLVTAYFSYGGMELYALSVNELPNPRKAIPSACA 306

Query: 386 KVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAV 445
           K  YR               VP++S++L+GS S G   SPYVLA SLHG+ +V H INAV
Sbjct: 307 KGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSSGVHPSPYVLALSLHGIKIVPHIINAV 366

Query: 446 ILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCAT 505
           IL+SV+SV NSA YS  RLL  LAQ GYAPK  DYVDR GRPL +++         F A 
Sbjct: 367 ILISVISVGNSAMYSGPRLLCSLAQQGYAPKILDYVDRQGRPLMALIICSVFGLIAFVAA 426

Query: 506 SPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYY 565
           S  E D+F WL AISGLS++FTW AIC+SH RFRR M++QGRSL  LG+R+ TG  GS Y
Sbjct: 427 SKYEEDIFGWLAAISGLSELFTWTAICLSHFRFRRAMKLQGRSLETLGYRSTTGEWGSLY 486

Query: 566 AAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIR 624
           A +     L+AQ WVA++PM N      ++ F++ LA+P+ L++ VG+ +  +++ +   
Sbjct: 487 AVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFKSCLALPLWLSMAVGYMIVTKNWTILNP 546

Query: 625 AKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
             +I + SHR  +D E+++QED EYK+K++    + R+   WC
Sbjct: 547 LSSISVDSHRRSYDVEVMKQEDLEYKQKMKRSKWYVRMSYTWC 589

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  467 bits (1202), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 252/542 (46%), Positives = 329/542 (60%), Gaps = 23/542 (4%)

Query: 141 VEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLY 200
           +E Q++N  L ++IK RH++M+S                L  AGPA LV+GYG+    LY
Sbjct: 82  LESQEKN-NLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIMLY 140

Query: 201 CIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIK 260
           CIIQA GEL + Y+ + G++  +PS LVDP   FAV+ VY IQWL V PL+LVT++MT+K
Sbjct: 141 CIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVK 200

Query: 261 YWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAA 320
           YWT+ V+ D                G++GYAEAEF FN CK++M+IGF I+AI IN G A
Sbjct: 201 YWTS-VNSDIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAIIINCGGA 259

Query: 321 GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAI 380
           G   YIG +YW++PG F        FKGV                  L+AAEQ NP K+I
Sbjct: 260 GDRKYIGTEYWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSI 314

Query: 381 PSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSS-SGGNSASPYVLAASLHGVHVVQ 439
           P+A KKV YR               VPYNSD+L+GS  S G+ ASP+V+A + HGV VV 
Sbjct: 315 PNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSDDSSGSHASPFVIAVASHGVKVVP 374

Query: 440 HFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXX 499
           HFINAVIL+SV+SVANS+ YS  RLLL LA+ G  PK   YVDR GRPL   L       
Sbjct: 375 HFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSLAFGC 434

Query: 500 XXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTG 559
             F ATS  E +VFTWLLAIS LSQ+F W ++ +SHIRFR  M  QGRS+ E+G++AQTG
Sbjct: 435 IGFVATSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTG 494

Query: 560 VLGSYYAAIMLFLALVAQFWVALVPMNTH-TLDAENFFQNYLAMPILLALYVGFKLWRRD 618
             GS+ A ++    LV QFWVA+ P+N H  L+ + FFQNYLAMPI+L  Y G K++ + 
Sbjct: 495 YWGSWLAVLIAVFFLVCQFWVAIAPVNDHGKLNVKVFFQNYLAMPIVLVAYFGHKIYFKS 554

Query: 619 FRLFIRAKNIDLISHRIIF-----------DEELLRQEDEEYKE---KLRNGPKWKRVVD 664
           +  +I A  IDL SHR IF           D+++   E++E  E    LR+   +K++V+
Sbjct: 555 WSFWIPADKIDLNSHRNIFVHSTLTEFDKADDDVKEYENQESLENLNNLRSRNLFKKMVN 614

Query: 665 FW 666
            W
Sbjct: 615 LW 616

>TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {ON}
           Anc_3.284 YDR046C
          Length = 664

 Score =  463 bits (1191), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 248/609 (40%), Positives = 340/609 (55%), Gaps = 41/609 (6%)

Query: 63  PHGASKFLPQVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNL 122
           PH   KF  ++KN+R +NW+DSFK  E                                 
Sbjct: 93  PH-KRKFNIEIKNKRIKNWIDSFKPPE--------------------------------- 118

Query: 123 HIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQ 182
              + EL+  +++ +     ++   AQLK+T+K RHV+MMS                L+ 
Sbjct: 119 ECMESELELNSIDENGH---REKPRAQLKKTMKSRHVVMMSLGTGIGTGLLVSNASCLSL 175

Query: 183 AGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCI 242
           +GPAPLVIGYG++    Y +IQA GE+ VAY  + G+FNT+ S  +     FA  W+  I
Sbjct: 176 SGPAPLVIGYGLVSIITYLLIQAAGEMGVAYPTLPGNFNTYISTFLSRPIGFATIWLSSI 235

Query: 243 QWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKV 302
           QWL V PLEL+ +SMTIKYWTT + PD                G   Y E EF FN CK+
Sbjct: 236 QWLTVVPLELIAASMTIKYWTTSISPDVFVVIFYVFLNFIHFFGTAAYGETEFIFNLCKI 295

Query: 303 MMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXX 362
           +M+IGF I++I IN G AG DGYIG KYW+ PGAF G+    RFK V             
Sbjct: 296 LMIIGFIILSIVINCGGAGHDGYIGGKYWHTPGAFVGKNSASRFKDVCYILVTAFFSYGG 355

Query: 363 XXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGN 421
                LT  EQ NPRK+ P+AAK   YR               VPY++  L   +SS G+
Sbjct: 356 TELFVLTINEQPNPRKSTPTAAKTTIYRILIVYLLTMILLGFNVPYDNKNLFSATSSNGD 415

Query: 422 SAS--PYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFD 479
           S S  PYVLAAS+HGV VV HFINAV+L++++SVANSA Y++ R++  LAQ G APK+  
Sbjct: 416 SISISPYVLAASIHGVKVVPHFINAVVLIALISVANSATYAAPRMMASLAQQGMAPKFLA 475

Query: 480 YVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFR 539
           Y+DR GRP+  +L         F A S KE +VF WL AI+GL+ +F W    +SHIRFR
Sbjct: 476 YIDREGRPIYGLLICSLLGVIGFAAASDKEQEVFVWLAAIAGLATLFLWECFFLSHIRFR 535

Query: 540 RGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHT-LDAENFFQN 598
             M+VQG+ + E+G++A  G+ GS   A    L L+A FWV+L P    + + A+NFF+ 
Sbjct: 536 WAMKVQGKDINEVGYKAACGIWGSIIGACFNVLVLIANFWVSLTPPGQGSNVSAKNFFEQ 595

Query: 599 YLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPK 658
            LA+PI +   VG+ + ++D+ ++   ++IDL   R I+D E L++EDEE +E++RN   
Sbjct: 596 MLALPIWIFFAVGYMVIKKDWVIWNPIESIDLDYCRKIYDPEQLKREDEENRERIRNAGF 655

Query: 659 WKRVVDFWC 667
           W R   FWC
Sbjct: 656 WARCRAFWC 664

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  461 bits (1186), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 259/545 (47%), Positives = 327/545 (60%), Gaps = 26/545 (4%)

Query: 141 VEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLY 200
           +E Q+ N  L ++IK RH+IM+S                L  AGPA LV+GYGI    LY
Sbjct: 82  LESQERN-NLTRSIKSRHLIMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLY 140

Query: 201 CIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIK 260
           CIIQA GEL + Y+ + G++  + S LVDP   FAV+ VY IQWL V PL+LVT++MTIK
Sbjct: 141 CIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTIK 200

Query: 261 YWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAA 320
           YWT  V+ D                G+KGYAEAEF FN CK++M+IGF I+AI IN G A
Sbjct: 201 YWT-NVNADIFVAAVFIFVIIINLFGSKGYAEAEFMFNICKILMVIGFVILAIVINCGGA 259

Query: 321 GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAI 380
           G   +IG KYW++PG F        FKGV                  L+AAEQ NP K+I
Sbjct: 260 GDRKFIGTKYWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSI 314

Query: 381 PSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNS-ASPYVLAASLHGVHVVQ 439
           P+A KKV YR               VPYNSD+L+GS S   S ASP+V+A + HGV VV 
Sbjct: 315 PNACKKVVYRILFIYMLTTILICFLVPYNSDELLGSGSSSGSHASPFVIAVASHGVKVVP 374

Query: 440 HFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXX 499
           HFINAVIL+SV+SVANS+ YS+ RLLL LA+ G+ PK   YVDRNGRPL   L       
Sbjct: 375 HFINAVILISVISVANSSLYSAPRLLLSLAEQGFLPKCLAYVDRNGRPLLCFLVSIIFGC 434

Query: 500 XXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTG 559
             F ATS  E  VFTWLLAIS LSQ+F W ++ +SHIRFR  M  QGRS+ E+G++AQTG
Sbjct: 435 IGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMDEVGYKAQTG 494

Query: 560 VLGSYYAAIMLFLALVAQFWVALVPMNTH-TLDAENFFQNYLAMPILLALYVGFKLWRRD 618
             GS+ A ++    LV QFWVA+ P++ H  LDA  FFQNYLAMPI+L  Y G K++ + 
Sbjct: 495 YWGSWLAVLIALFFLVCQFWVAIAPVSKHGKLDANVFFQNYLAMPIVLFAYFGHKIYTKS 554

Query: 619 FRLFIRAKNIDLISHRIIF------------DEELLRQEDEEYKEKLRNGPK----WKRV 662
           ++ +I A+ IDL SHR I+            D++L   E  E  E   NG      +KR+
Sbjct: 555 WKFWIPAEKIDLDSHRTIYVPPILMGTNKIDDDDLKEYETSESSEN-PNGSGSRKFFKRM 613

Query: 663 VDFWC 667
            +FWC
Sbjct: 614 ANFWC 618

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  461 bits (1187), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 252/616 (40%), Positives = 347/616 (56%), Gaps = 38/616 (6%)

Query: 78  FRNWLDSFKRAE---------------TPNASS-STADE-------------NAVENYSM 108
           ++NW+DSFKRAE               T N ++ +  DE             N    Y M
Sbjct: 58  YQNWIDSFKRAEPVGERRRRRAQQDISTTNINNMNKGDESDFYMGNGGEPSTNIDTAYDM 117

Query: 109 QEFDNDLENKKS-NLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXX 167
              + D  NKK+ N++  +D+L+  T ++ +       E+   K  +K RHVIMM+    
Sbjct: 118 NSNEVDPNNKKNENIYALNDDLEDGTTSIAAS------EDMPKKGGMKARHVIMMTLATG 171

Query: 168 XXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFL 227
                       L  +GPA LV+GY ++    Y ++QA GE+A+AY  + G FNT+ S  
Sbjct: 172 IGTGLLVANAKSLHFSGPAGLVVGYFMVSFVTYFVVQAAGEMAIAYPTLPGGFNTYQSLF 231

Query: 228 VDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGA 287
           +   F FA  W++ + WL + PLEL+TSS+T+KYWTT ++PD                G 
Sbjct: 232 ISKPFGFATVWIFALNWLTILPLELITSSITVKYWTTSINPDIFVLIFYLFLLFVHFIGL 291

Query: 288 KGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFK 347
           + YAEAEFFFN CK++M+ GF I +I +N G AG DGYIG KYW+DPG F       RFK
Sbjct: 292 RLYAEAEFFFNSCKILMITGFIIFSIVVNCGGAGHDGYIGGKYWHDPGPFASDNGAARFK 351

Query: 348 GVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVP 407
            V                  L+  EQ NPRKA+P AAK   YR               VP
Sbjct: 352 EVCYVLINAYFSYGGTELYVLSVNEQENPRKAVPVAAKTSVYRVAIIYLLTMILIGFNVP 411

Query: 408 YNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLG 467
           YNS  LMG+++  + ASPYVLAA +HGV +V HFINAVILLSV+SVANSA ++  RLL  
Sbjct: 412 YNSPDLMGNANSKD-ASPYVLAAQIHGVKIVPHFINAVILLSVISVANSALFAGPRLLAT 470

Query: 468 LAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFT 527
           LA+ G+APK+  YVDR GRPL ++          F ATS KE +VFTWL AI+GLS++F 
Sbjct: 471 LAEQGFAPKFLTYVDRAGRPLLALCVCSLFGVIAFAATSKKEDEVFTWLAAIAGLSELFA 530

Query: 528 WFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVAL-VPMN 586
           W  I +SHIRFR  M+  G+S+ E+G++A TG+ GSYY      L L+AQFWVAL  P +
Sbjct: 531 WSGILLSHIRFRWAMKYHGKSMDEVGYKAITGIWGSYYGLFFNLLVLIAQFWVALSAPGS 590

Query: 587 THTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQED 646
              + A +FF++YLA  I +  Y+ + ++ +D+ + I  K+ID+   R I+D + LRQE 
Sbjct: 591 GGQVTAISFFESYLAFVIWVFFYLCYMIYNKDWTILIPLKDIDVDYQRRIYDADFLRQEK 650

Query: 647 EEYKEKLRNGPKWKRV 662
           EE  EK +     K++
Sbjct: 651 EESYEKYKQSNIGKKI 666

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  459 bits (1180), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 238/520 (45%), Positives = 314/520 (60%), Gaps = 15/520 (2%)

Query: 118 KKSNLHIRD-DELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXX 176
           K+ N+ +R  D      V  D +  E +    QL +T+KPRH++M+S             
Sbjct: 76  KRRNVFVRIVDSFKRQKVRNDGEFAETE---TQLNKTMKPRHIVMISLGTGIGTGLLVGN 132

Query: 177 XXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAV 236
              L+++GPA LVIGYG+    +YC++QA GEL + YS++ G++ T+P++L+DP   FAV
Sbjct: 133 GQVLSKSGPAGLVIGYGVASIMIYCVVQAAGELGLVYSRLTGNYTTYPTYLIDPAVGFAV 192

Query: 237 AWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFF 296
           + +Y +QWL V PL+LVT++MTI+YWTT V+PD                GAKGYAEAEFF
Sbjct: 193 SMLYTLQWLTVLPLQLVTAAMTIRYWTTNVNPDIFVAAILVLVIAINMFGAKGYAEAEFF 252

Query: 297 FNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXX 356
            NCCK++MM GF I+ I IN G AG   YIG KYW  PGAF        FKGV       
Sbjct: 253 CNCCKLLMMAGFVILGIVINCGGAGDKEYIGVKYWQTPGAFA-----NGFKGVAAVFCYA 307

Query: 357 XXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGS 416
                      LTA EQ+NPRKAIP A +KV YR               VPYNS  L+GS
Sbjct: 308 AFSYGGIEVLVLTANEQANPRKAIPDACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGS 367

Query: 417 SS--GGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYA 474
           ++   G+ ASP+V+A + HGV VV H INA IL+SV+SVANS+ YS  RLLL L+Q GYA
Sbjct: 368 NNDGSGSDASPFVIAVASHGVQVVPHIINAAILISVISVANSSLYSGPRLLLSLSQQGYA 427

Query: 475 PKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVS 534
           PK F+Y+DR GRP+  +L         F A  P   +VFTWLLA+SGLSQIF W +I +S
Sbjct: 428 PKCFNYIDRRGRPIICVLVSVAMGLIAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITIS 487

Query: 535 HIRFRRGMQVQ---GRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTL 590
           H+RFR  ++ Q    R+   + + AQTG +GS  A  +    LV QFWVA+ P+ +   L
Sbjct: 488 HLRFRDAIRSQLGGLRARDVVEYTAQTGYVGSLVALAISIFILVCQFWVAIAPLGHNGQL 547

Query: 591 DAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDL 630
           D + FF+NYLA P+LL  Y+ +K+W RD+RL I A  IDL
Sbjct: 548 DVQIFFENYLAAPVLLGGYLAYKIWHRDWRLCIPANEIDL 587

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  456 bits (1173), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 255/545 (46%), Positives = 327/545 (60%), Gaps = 25/545 (4%)

Query: 141 VEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLY 200
           +E Q++N  L+++IK RH++M+S                L  AGPA LV+GYGI    LY
Sbjct: 82  LESQEKN-NLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLY 140

Query: 201 CIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIK 260
           CIIQA GEL + Y+ + G++  + S LVDP   FAV+ VY IQWL V PL+LVT++MT+K
Sbjct: 141 CIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVK 200

Query: 261 YWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAA 320
           YWT  V+ D                G++GYAEAEF FN CK++M+ GF I+AI IN G A
Sbjct: 201 YWT-NVNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGA 259

Query: 321 GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAI 380
           G   YIG +YW++PG F        FKGV                  L+AAEQ NP ++I
Sbjct: 260 GDRRYIGTEYWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTESI 314

Query: 381 PSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNS-ASPYVLAASLHGVHVVQ 439
           P+A KKV YR               VPYNSD+L+GS S   S ASP+V+A S HGV VV 
Sbjct: 315 PNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFVIAVSSHGVKVVP 374

Query: 440 HFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXX 499
           HFINAVIL+SV+SVANS+ YS  RLLL LA+ G  PK   YVDRNGRPL   L       
Sbjct: 375 HFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSLAFGC 434

Query: 500 XXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTG 559
             F ATS  E  VFTWLLAIS LSQ+F W ++C+SHIRFR  M  QGRS+ E+G++AQTG
Sbjct: 435 IGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYKAQTG 494

Query: 560 VLGSYYAAIMLFLALVAQFWVALVPMNTH-TLDAENFFQNYLAMPILLALYVGFKLWRRD 618
             GS+ A ++    LV QFWVA+ P++ H  LD + FFQNYLAMPI+L  Y G K++ + 
Sbjct: 495 YWGSWIAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHKMYFKS 554

Query: 619 FRLFIRAKNIDLISHR-------------IIFDEELLRQEDEEYKEKL---RNGPKWKRV 662
           +R +I A+ IDL SHR             I  D+++   E  E  E L   R    +K++
Sbjct: 555 WRFWIPAEKIDLDSHRNVYLPPTSTGADKIDDDDDVTEYETSESSENLHSSRLNKSFKKM 614

Query: 663 VDFWC 667
           V+FWC
Sbjct: 615 VNFWC 619

>YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}
           TAT1Amino acid transport protein for valine, leucine,
           isoleucine, and tyrosine, low-affinity tryptophan and
           histidine transporter; overexpression confers FK506 and
           FTY720 resistance
          Length = 619

 Score =  455 bits (1170), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 253/545 (46%), Positives = 326/545 (59%), Gaps = 25/545 (4%)

Query: 141 VEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLY 200
           +E Q++N  L ++IK RH++M+S                L  AGPA LV+GYGI    LY
Sbjct: 82  LESQEKN-NLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLY 140

Query: 201 CIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIK 260
           CIIQA GEL + Y+ + G++  +PS LVDP   FAV+ VY IQWL V PL+LVT++MT+K
Sbjct: 141 CIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVK 200

Query: 261 YWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAA 320
           YWT+ V+ D                G++GYAEAEF FN CK++M+IGF I+AI IN G A
Sbjct: 201 YWTS-VNADIFVAVVFVFVIIINLFGSRGYAEAEFIFNSCKILMVIGFVILAIIINCGGA 259

Query: 321 GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAI 380
           G   YIGA+YW++PG F        FKGV                  L+AAEQ NP K+I
Sbjct: 260 GDRRYIGAEYWHNPGPFA-----HGFKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSI 314

Query: 381 PSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSAS-PYVLAASLHGVHVVQ 439
           P+A KKV YR               VPYNSD+L+GSS    S + P+V+A + HGV VV 
Sbjct: 315 PNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSSDSSGSHASPFVIAVASHGVKVVP 374

Query: 440 HFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXX 499
           HFINAVIL+SV+SVANS+ YS  RLLL LA+ G  PK   YVDRNGRPL           
Sbjct: 375 HFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFFVSLVFGC 434

Query: 500 XXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTG 559
             F ATS  E  VFTWLLAIS LSQ+F W ++ +SHIRFR  M  QGRS+ E+G++AQTG
Sbjct: 435 IGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTG 494

Query: 560 VLGSYYAAIMLFLALVAQFWVALVPMNTH-TLDAENFFQNYLAMPILLALYVGFKLWRRD 618
             GS+ A ++    LV QFWVA+ P+N H  L+ + FFQNYLAMPI+L  Y G K++ + 
Sbjct: 495 YWGSWLAVLIAIFFLVCQFWVAIAPVNEHGKLNVKVFFQNYLAMPIVLFAYFGHKIYFKS 554

Query: 619 FRLFIRAKNIDLISHRIIFDEELLRQED-----EEYKE-----------KLRNGPKWKRV 662
           +  +I A+ IDL SHR IF    L + D     ++ KE             R+   +KR+
Sbjct: 555 WSFWIPAEKIDLDSHRNIFVSPSLTEIDKVDDNDDLKEYENSESSENPNSSRSRKFFKRM 614

Query: 663 VDFWC 667
            +FWC
Sbjct: 615 TNFWC 619

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  452 bits (1162), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 232/537 (43%), Positives = 315/537 (58%), Gaps = 6/537 (1%)

Query: 135 NVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGI 194
           ++++  V+    + +L+++I+PRHV MMS                L   GP  L+IGY  
Sbjct: 64  DLETASVQTDLTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAA 123

Query: 195 MGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 254
           +    Y ++QA GE+AVAY  + G+FN + S  +   F FA  W+YC+QWL V PLEL+T
Sbjct: 124 VSVVAYIMMQAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELIT 183

Query: 255 SSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAIC 314
           +S+TIKYWT  V+ D                G++GY E+EF F  CKV+M+ GF I+AI 
Sbjct: 184 ASLTIKYWTDSVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIV 243

Query: 315 INTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQS 374
           IN G AG  GYIGA+YW+DPGAF       +FKG                   +T  EQS
Sbjct: 244 INCGGAGNSGYIGARYWHDPGAFAVGDPASKFKGFCYVLVTGYFSYGGTELYAMTVNEQS 303

Query: 375 NPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSA---SPYVLAAS 431
           +PR+AI SA K+  YR               VP+ SD+LMGS  GG SA   SPYVLA S
Sbjct: 304 SPRRAIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGS--GGKSATHASPYVLAVS 361

Query: 432 LHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
           LHGV VV H +NAVIL++V+SV NSA YS  R+L  LA+ GYAPK+  Y+DR GRPL ++
Sbjct: 362 LHGVKVVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMAL 421

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
           +         F A S  E DVFTWL AI+GLS++FTW AI +SHIRFR+ M+  G SL +
Sbjct: 422 IACSVIGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQ 481

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYV 610
           LG+++ TG+ GS Y      L  VAQFWVAL P+ N    D  +FFQ+YLA P+    ++
Sbjct: 482 LGYKSITGLWGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFL 541

Query: 611 GFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           G+ ++  ++ +    K+ID+   R ++DEE + QE  E+K  L+N     R+  FWC
Sbjct: 542 GYMVYSGEWMILRPLKDIDINHFRCVYDEERIEQEKLEHKTMLQNSNWLGRLKHFWC 598

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  449 bits (1155), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 237/560 (42%), Positives = 323/560 (57%), Gaps = 9/560 (1%)

Query: 110 EFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXX 169
            F N  +  + +    + +L++AT +           ++ LK++IKPRHV MMS      
Sbjct: 50  RFVNSFKRAEKHSTPSNGDLEHATTH-------SVASSSPLKRSIKPRHVAMMSICTGIG 102

Query: 170 XXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVD 229
                     L   GPA L+IGY  +    Y ++QA GE+AVAY  + G+FN + S L+ 
Sbjct: 103 TGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLIS 162

Query: 230 PGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKG 289
             F FA  W+YCIQWL V PLEL+T+S+TIKYW   ++ D                G++G
Sbjct: 163 RPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRG 222

Query: 290 YAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGV 349
           Y E+EF F  CKV+M+IGF I++I IN G AG   YIGAKYW DPGAF   +   +FKGV
Sbjct: 223 YGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAFAVGSGATKFKGV 282

Query: 350 MDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYN 409
                             +T  EQSNPR+AI S  K+  YR               VP+ 
Sbjct: 283 AYVLVTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHT 342

Query: 410 SDQLMGSSS-GGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGL 468
           S +LMGSS      ASPYVLA SLHGV +V H INAVIL++V+SV NSA YS  R+L  L
Sbjct: 343 SSELMGSSGKSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTL 402

Query: 469 AQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTW 528
           A+ GYAP++  YVDR GRPL +++         F A S  E DVFTWL AI+GLS++FTW
Sbjct: 403 AEQGYAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTW 462

Query: 529 FAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTH 588
            AI +SH+RFR+ M+   R L ELG++A TGVLGS        L  +AQFWV++ P    
Sbjct: 463 SAIMLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILVFIAQFWVSIAPFGKD 522

Query: 589 -TLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDE 647
             LD  +FFQ+YLA P+ + L+ G+ +  R++ +    K+IDL  +R I+D++ L QED 
Sbjct: 523 GKLDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQDRLYQEDL 582

Query: 648 EYKEKLRNGPKWKRVVDFWC 667
           E+K  ++N    +++ +FWC
Sbjct: 583 EHKILIQNSSWARKLHNFWC 602

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  437 bits (1123), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 255/567 (44%), Positives = 340/567 (59%), Gaps = 17/567 (2%)

Query: 85  FKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNV-------- 136
           F+     N+S  T+    ++  S+ E +   + K   +   D ++     N         
Sbjct: 18  FEHLNETNSSLHTSRNLDIDFKSVNELNEGDKVKYEGIKNGDTQVTSGITNSFESESLRD 77

Query: 137 DSQPVEQQDENA-QLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIM 195
           DS+P+E +++   QL ++IK RH++M+S                LA++GPA LVIGYG+ 
Sbjct: 78  DSKPLENEEKTENQLNRSIKSRHLLMISLGTGIGTGLLVGNGQVLAKSGPAGLVIGYGVA 137

Query: 196 GTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTS 255
              +Y I+QA GEL + YS + G++  +PS LVDP   FA++ +Y +QWL V PL+LVT+
Sbjct: 138 SIMVYFIVQAAGELGICYSGLTGNYIRYPSILVDPALGFAISIIYTLQWLTVMPLQLVTA 197

Query: 256 SMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICI 315
           +MTI YWT  ++P+                GAKGY EAEF  N  KV+MM+GF ++AI I
Sbjct: 198 AMTIGYWT-NINPNIFVAIVLVIVVLTNCFGAKGYVEAEFLCNIFKVLMMVGFVLLAILI 256

Query: 316 NTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSN 375
           NTGA GTDGYIG  YW +PGAF        FKGV                  LTAAEQ N
Sbjct: 257 NTGAIGTDGYIGTIYWKNPGAFA-----NGFKGVCSVFCYAAFSYGGIEVLALTAAEQEN 311

Query: 376 PRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSAS-PYVLAASLHG 434
           P KAIPSA KK  YR               VPY+S QLMGS+SGG S S P+V+A + HG
Sbjct: 312 PIKAIPSACKKTVYRILFLYMLTTILIGFLVPYDSPQLMGSTSGGGSHSSPFVIAIASHG 371

Query: 435 VHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCX 494
           V VV H INAVIL+S++SVANSAFYSS+RLLL L++ G  PK F+YVD+ GRP   +L  
Sbjct: 372 VKVVPHLINAVILISIVSVANSAFYSSTRLLLSLSEQGKIPKIFNYVDKEGRPWYCILFA 431

Query: 495 XXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGF 554
                  F A+SP + +VFTWLLAISGLSQIF W +IC+SHIRFRR M  QG+SL E+G+
Sbjct: 432 SLFGSIGFVASSPYKEEVFTWLLAISGLSQIFLWMSICLSHIRFRRAMIKQGKSLDEIGY 491

Query: 555 RAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTH-TLDAENFFQNYLAMPILLALYVGFK 613
           +A TG  GS+ A  +   +L++QFWVA+ P+     LD   FFQNYLA PI+L  Y+G+K
Sbjct: 492 KAPTGCWGSWIALSIALFSLISQFWVAIAPIGKDGKLDVLVFFQNYLAAPIVLIAYLGYK 551

Query: 614 LWRRDFRLFIRAKNIDLISHRIIFDEE 640
            + +D+RL+I +  IDL   R I+  E
Sbjct: 552 TYYKDWRLYIPSDKIDLSYGREIYVPE 578

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  435 bits (1118), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 236/508 (46%), Positives = 303/508 (59%), Gaps = 10/508 (1%)

Query: 145 DENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQ 204
           DEN  L + I+ RH+IM+S                L+Q+GP  L+IGY +    ++ IIQ
Sbjct: 80  DEN-DLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVSSLMVFLIIQ 138

Query: 205 ACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTT 264
           A GEL + YS V G+F  +P+ LVDP F FA++++Y IQW+ V PL+LVT++MTI++W  
Sbjct: 139 AAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTAAMTIQFWNV 198

Query: 265 KVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAA--GT 322
            V+ D                GA+GY EAEFF N CK++M+ GF I+ I I  G    G 
Sbjct: 199 GVNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGIIITAGGIPNGP 258

Query: 323 DGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPS 382
           DGYIG KYW +PG F        FKGV                  L+AAEQ NP K+IPS
Sbjct: 259 DGYIGGKYWRNPGLFA-----NGFKGVCSVFCYAAFSYGGVETLVLSAAEQKNPLKSIPS 313

Query: 383 AAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFI 442
           A KKV YR               VPY S  LMGSS  G+ +SP+V+A + HGV VV H I
Sbjct: 314 ATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHSSPFVIAIASHGVSVVPHLI 373

Query: 443 NAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXF 502
           NAVIL+SVLSVANSA Y + RLLL LAQ G APK+ +Y+D+ GRP    L         F
Sbjct: 374 NAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPTTCTLVVVLFGMIGF 433

Query: 503 CATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLG 562
            A S K   VFTWLL+ISGL QIF W +ICVSHIRFR  M+VQG  L E+ ++AQTG  G
Sbjct: 434 VAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGHPLTEIAYKAQTGYWG 493

Query: 563 SYYAAIMLFLALVAQFWVALVPMNTH-TLDAENFFQNYLAMPILLALYVGFKLWRRDFRL 621
           SY A  +    LV QFWVA+ P+  H  LDA NFFQNYLA P++L  Y+GFK++ + ++L
Sbjct: 494 SYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVLCAYLGFKVYYKQWQL 553

Query: 622 FIRAKNIDLISHRIIF-DEELLRQEDEE 648
            I A  I+L ++R ++  EE L  +  E
Sbjct: 554 LIPADKIELDNNRNVYVPEEALEDKPLE 581

>NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  429 bits (1103), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 251/567 (44%), Positives = 337/567 (59%), Gaps = 26/567 (4%)

Query: 72  QVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDY 131
           ++++ + R    S K   + + + ST+  NA   +  Q+F +  + K S+L         
Sbjct: 42  EIESTKKREIEVSEKPIASADTTVSTSKCNAKTYF--QDFCHSFKRKDSDL--------- 90

Query: 132 ATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIG 191
                DS  VE QD   QL +TIK RH++M+S                LA+AGPA L+IG
Sbjct: 91  -----DSD-VEAQD--TQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIG 142

Query: 192 YGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLE 251
           Y +    +YCII A GEL + Y  + G+F  +PS L+DP   FA++ +Y +QWL V PL+
Sbjct: 143 YTVSSIMIYCIIHAAGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQ 202

Query: 252 LVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIM 311
           LVT+++TI +WT  V+PD                GA+GYAE EFF NCCK++M+ GF I+
Sbjct: 203 LVTAAITISFWT-DVNPDIFVLCVFIVVIIVNLFGARGYAETEFFCNCCKILMITGFIIL 261

Query: 312 AICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAA 371
           +I I TG AG DGYIGAKYW  PG F        FKGV                  L+  
Sbjct: 262 SIVIITGGAGKDGYIGAKYWIHPGPFA-----HGFKGVCTVFTYAAFSYGGIEVVVLSID 316

Query: 372 EQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAAS 431
           EQ +P  A+P+A KKV YR               VPY+S  L+GSS  G+ ASP+V+A  
Sbjct: 317 EQEDPVSAVPNACKKVVYRILLIYLLTTILVCFLVPYDSPNLLGSSHSGSHASPFVIAIE 376

Query: 432 LHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
            HGV VV HFINAVIL+SV+SVANS+ YSSSRLLL L++ G  P+W +++D NGRP+R  
Sbjct: 377 SHGVKVVPHFINAVILISVISVANSSLYSSSRLLLSLSEQGSLPQWLNFIDMNGRPIRCF 436

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
           +         F A S K  DVFTWLLAISGLSQ+F W ++ +SHIR R  M+ QG+SL E
Sbjct: 437 IISILFGMIGFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDE 496

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTH-TLDAENFFQNYLAMPILLALYV 610
           +G++AQTG  GS+ A  + F +LV QFWVA+ P+  H  LD  NFFQNYLA PI+L  Y+
Sbjct: 497 IGYKAQTGYWGSWLAVFIGFFSLVTQFWVAIAPVEKHGELDVVNFFQNYLAFPIVLVAYL 556

Query: 611 GFKLWRRDFRLFIRAKNIDLISHRIIF 637
           G K++ +++RL+I A  IDL SHR I+
Sbjct: 557 GHKIYYKNWRLWIPADKIDLDSHRRIY 583

>NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa]
           {ON} 
          Length = 619

 Score =  413 bits (1061), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 242/563 (42%), Positives = 330/563 (58%), Gaps = 26/563 (4%)

Query: 100 ENAVENYSMQEFDNDLENKKSNLHIRDDELDYAT-------------VNVDSQPVEQQDE 146
           E  V++ S++E  N+  N+K   H +  E +  T              N +   +E QD 
Sbjct: 29  EETVKHISIEEASNETLNEKPEAHTQKCEYNPITHFKNFLNGFKRQKQNEEGADLEMQD- 87

Query: 147 NAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQAC 206
             QL +TIK RH++M+S                L++AGP  LVIGY I    +YC+IQ+ 
Sbjct: 88  -TQLSKTIKARHLLMISLGTGIATGLLVGNGQVLSKAGPGGLVIGYFISSVMIYCMIQSA 146

Query: 207 GELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKV 266
           GEL + Y  + G+F  + S L+DP   FA++ +Y  QWL V PL+LVT+++TI++WT  +
Sbjct: 147 GELGICYRGLVGNFTRYSSLLIDPSLGFALSILYTFQWLTVLPLQLVTAAITIEFWT-DL 205

Query: 267 DPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYI 326
           +PD                GA+GYAEAEFF N CK++M+IGF I++I I +G AG DGYI
Sbjct: 206 NPDIFVAIIFIVVIVVNLFGARGYAEAEFFCNLCKILMIIGFIILSIIIISGGAGNDGYI 265

Query: 327 GAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKK 386
           GAKYW +PGAF        FKGV                  L+  EQ NP K +P+  KK
Sbjct: 266 GAKYWKNPGAFA-----NGFKGVCTVFTYAAFSYGGIEVLVLSIDEQENPIKVVPNCCKK 320

Query: 387 VAYRXXXXXXXXXXXXXXXVPYNSDQLMGS----SSGGNSASPYVLAASLHGVHVVQHFI 442
           VAYR               VPY S QL+GS     + G+ ASP+V+A   HGV VV HFI
Sbjct: 321 VAYRILFIYLLTTILVCFLVPYTSPQLLGSLNKGENSGSHASPFVIAVESHGVKVVPHFI 380

Query: 443 NAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXF 502
           NAVIL+SV+SVANS+ YSS RLLL L++ G  P++ +Y+D+ GRP+R  +         F
Sbjct: 381 NAVILISVISVANSSVYSSGRLLLSLSEQGTFPQFLNYIDQRGRPIRCFVISLTFGLIGF 440

Query: 503 CATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLG 562
            A+S K  DVFTWLLAISGLSQ+F W AIC+SHIRFR  M+ Q +S+ E+G++AQTG  G
Sbjct: 441 VASSEKRQDVFTWLLAISGLSQLFIWLAICLSHIRFRDAMKTQKKSMDEVGYKAQTGYWG 500

Query: 563 SYYAAIMLFLALVAQFWVALVPMNTH-TLDAENFFQNYLAMPILLALYVGFKLWRRDFRL 621
           S+ A ++   +LV QFWVA+ P++ +  LD  +FFQNYLA PI+L  Y G KL+  ++  
Sbjct: 501 SWVAVLIGLFSLVTQFWVAIAPVDKNGKLDVMSFFQNYLAFPIVLVAYFGHKLYYGNWCP 560

Query: 622 FIRAKNIDLISHRIIFDEELLRQ 644
            I    IDL SHR I+  E + +
Sbjct: 561 LIPLSKIDLDSHRKIYSPEEITE 583

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  410 bits (1054), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 229/560 (40%), Positives = 312/560 (55%), Gaps = 8/560 (1%)

Query: 86  KRAETPNASSSTADENAVENYSMQEFDN--DLENKKSNLHIRDDELDYATVNVDSQPVEQ 143
           ++ + P + S   D+N  +  +M    N   L +K + +    +++   +    ++    
Sbjct: 4   QQEQYPESISMGNDKNMYKPETMFGTMNWPKLMSKDTLISDSSEDITNDSTTGKTEKGHT 63

Query: 144 QDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCII 203
             EN +LKQ+IKP HV M++                ++ AG    ++GY I+G+ L C +
Sbjct: 64  GSENEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVGYFIIGSMLVCCM 123

Query: 204 QACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWT 263
           Q+ GEL VA+  + G FN++    VDP F F VAW++C+QW  V PLELVT+SMTIKYW 
Sbjct: 124 QSVGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLELVTASMTIKYWN 183

Query: 264 TKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTD 323
             ++P                 GA+GYA+AEF FN  KV+M+ GF I+ I I+ GAAGT 
Sbjct: 184 NSLNPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIILGIIISFGAAGTS 243

Query: 324 GYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQS--NPRKAIP 381
           GYIG KY   PGAF  +     FK +                  L+AAEQ+  N  K+I 
Sbjct: 244 GYIGIKYLKTPGAFNTR---NTFKSICSTLVNACFSCGGVEFLALSAAEQARGNISKSIK 300

Query: 382 SAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHF 441
            A  +V  R               VPYNS +LMGSSS    +SPYV+A + HGV VV H 
Sbjct: 301 RACGQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYVIAVASHGVKVVPHL 360

Query: 442 INAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXX 501
           INAVIL++V+SVANSA YSSSR L  LA+ G+AP +F  +D  GRP R ++         
Sbjct: 361 INAVILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPFRCLVVSGVFGLLS 420

Query: 502 FCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVL 561
           F A    +  VF WLL+ISGLS IFTW  ICV+H+RFR  M+ Q  SL ELG RA +G+ 
Sbjct: 421 FIAEYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHSLEELGHRAWSGIY 480

Query: 562 GSYYAAIMLFLALVAQFWVALVPMNTHTL-DAENFFQNYLAMPILLALYVGFKLWRRDFR 620
           GSYY   +  L LV QFWV+L P++     D  NFFQNY+A+P  L LYVG K++ R ++
Sbjct: 481 GSYYVIAINSLTLVVQFWVSLFPLDGDGRPDFVNFFQNYMAVPFALCLYVGHKIYTRSWQ 540

Query: 621 LFIRAKNIDLISHRIIFDEE 640
             I A  ID+ + R I+  E
Sbjct: 541 FIIPADKIDVDTSRDIYGVE 560

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  407 bits (1047), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 230/604 (38%), Positives = 328/604 (54%), Gaps = 41/604 (6%)

Query: 65  GASKFLPQVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHI 124
           G+S    Q    R++++ D FKR E                  ++E D +L         
Sbjct: 30  GSSPGQTQASKSRWQDFKDGFKRVE------------------LEELDPNL--------- 62

Query: 125 RDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAG 184
                       +++ +      + L++ +K RH+ M++                L   G
Sbjct: 63  -----------TEAEKIAIITAQSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGG 111

Query: 185 PAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQW 244
           PA ++IG+G++G  +YC++ + GELAV +  V+G F T+ +  VD  F FA+ + Y +QW
Sbjct: 112 PAGVLIGWGLIGLMIYCVVMSMGELAVTF-PVSGGFTTYATRFVDESFGFAINYNYMLQW 170

Query: 245 LCVCPLELVTSSMTIKYWTTKVD-PDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVM 303
           L V PLE+V +S+T+ +W T     D                G +GY EAEF F+  KV+
Sbjct: 171 LVVLPLEIVAASITVNFWGTPPKYRDGFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVI 230

Query: 304 MMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXX 363
            +IGF I+ I +  G     GYIG KYW++PGAF G     RFKGV              
Sbjct: 231 TVIGFIILGIVLVCGGGPVGGYIGGKYWHNPGAFSGDDAGSRFKGVCSVFVTAAFSFAGT 290

Query: 364 XXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSA 423
               L +AE +NPRKA+P AAK+V +R               VP+ S++L+G+SS   +A
Sbjct: 291 ELVGLASAETANPRKALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAA 350

Query: 424 SPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDR 483
           SP+VLA   HG+  +   IN VIL+SVLSV NSA Y+ SR ++ LA+ G  P  F Y+DR
Sbjct: 351 SPFVLAIQTHGIKGLPSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDR 410

Query: 484 NGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQ 543
            GRPL +++         F A S KE DVF WLLA+SGLS +F+W AIC+ HIRFRR + 
Sbjct: 411 KGRPLVAIITTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALS 470

Query: 544 VQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMP 603
            QGRS  EL F +  G+ GSY+  I++ L L+AQFWVA+ P+     +AE+FF  YL+ P
Sbjct: 471 AQGRSTDELAFVSYAGIAGSYFGVILVLLVLIAQFWVAVWPIGGSP-NAEDFFSAYLSFP 529

Query: 604 ILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVV 663
           +LLA Y+  K+W+R+++LF RAK+ID+ + R   D E LRQE  E K  L   P W R+ 
Sbjct: 530 VLLAFYIFHKIWKRNWKLFTRAKDIDIDTGRREMDTEALRQEIAEEKMLLSTRPWWYRLY 589

Query: 664 DFWC 667
            FWC
Sbjct: 590 FFWC 593

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  396 bits (1017), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 207/518 (39%), Positives = 299/518 (57%), Gaps = 8/518 (1%)

Query: 144 QDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCII 203
           Q +   L+Q+I+PRHV M+S                +A AG    +IGYGI+G  L C +
Sbjct: 35  QGKKEVLRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGIGGTLIGYGIIGVMLVCCM 94

Query: 204 QACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWT 263
           Q+ GEL VA+  ++G FN++    +DP   F+V+W++C+QW+ V PLELVT SMTIKYW 
Sbjct: 95  QSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWMIVLPLELVTGSMTIKYWN 154

Query: 264 TKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTD 323
             + P                 G+ GYAEAEF FN  KV+++IGF I+ + I+TG  GT 
Sbjct: 155 ASLSPSLFVSVFYALICVVNSFGSGGYAEAEFIFNSLKVVVIIGFIILGVLIDTGCVGTS 214

Query: 324 GYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQS--NPRKAIP 381
           G IG +Y  DPG F     I   K                    L+AAEQ+  N  K+I 
Sbjct: 215 GTIGFRYLIDPGMFNKNYNI--IKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPKSIG 272

Query: 382 SAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHF 441
            A  +V+ R               VP+NS  LMGS S    +SPYV A +++G+ VV H 
Sbjct: 273 RACNQVSIRIFVFYLLSISVVGLLVPHNSPILMGSGSNMIHSSPYVAAVAMNGITVVPHI 332

Query: 442 INAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXX 501
           INAVIL++V+SVANSA YSSSR L  LA+  +APK+F  ++++G+P+R +          
Sbjct: 333 INAVILIAVISVANSAMYSSSRTLHSLAEQNFAPKYFTKLNKHGQPMRCLFISALFGLIS 392

Query: 502 FCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVL 561
           F A    +  +F WLL+ISGLS IFTW  IC++HIRFR  ++ +G+SL  LG+++ TGV 
Sbjct: 393 FVAEYRDQEAIFIWLLSISGLSTIFTWTTICIAHIRFRDAIKSRGQSLETLGYKSITGVA 452

Query: 562 GSYYAAIMLFLALVAQFWVALVPMNTHTL-DAENFFQNYLAMPILLALYVGFKLWRRDFR 620
           GSY A ++  + LV QFWV+L P+ ++   +   FFQNY+A+P+ L  Y+G K++ +++ 
Sbjct: 453 GSYIATVINLVILVVQFWVSLFPLESNGKPNIVQFFQNYMAVPVALLFYIGHKVYTKNWS 512

Query: 621 LFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPK 658
           L IRA N+D+ + R I+   +   ED + K  ++N P 
Sbjct: 513 LLIRASNVDITTDRDIYCPTI---EDPKIKVLMQNSPS 547

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  395 bits (1015), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 205/499 (41%), Positives = 288/499 (57%), Gaps = 5/499 (1%)

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
            +  E A L+Q+IKPRHV M+S                +A AG    +IGY I+G  + C
Sbjct: 17  SEGSEPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLIIGVMVVC 76

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
            +Q+ GEL VA+  + G FN++    +DP   F V+W++C+QW+ V PLELVT+SMTIKY
Sbjct: 77  CMQSVGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVTASMTIKY 136

Query: 262 WTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAG 321
           W + + P                 G+ GYAEAEF FNC KVM++  F ++ I I TG  G
Sbjct: 137 WNSNLSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLGIVIITGGLG 196

Query: 322 TDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQS--NPRKA 379
             G IG +Y   PGAF   T    FK                    L+AAEQ+  N  K+
Sbjct: 197 NSGPIGFQYLKTPGAF--NTNYNVFKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPKS 254

Query: 380 IPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQ 439
           I  A ++V+ R               VPY+S  LMGS S     SPYV A +LHGV +V 
Sbjct: 255 IRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAAIALHGVRIVP 314

Query: 440 HFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXX 499
           H INAVIL++V+SVANSA YSSSR L  LA+  +AP++F  ++++G+P+R ++       
Sbjct: 315 HIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRCLVVSAIVGL 374

Query: 500 XXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTG 559
             F A    +  VF WLL+ISGLS IFTW  IC++HIRFR  +++QG+SL  LG+R+ TG
Sbjct: 375 ISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLGYRSNTG 434

Query: 560 VLGSYYAAIMLFLALVAQFWVALVPM-NTHTLDAENFFQNYLAMPILLALYVGFKLWRRD 618
           V+GSY A  +  + ++ QFWV+L P+ N    DA  FFQNY+A+P+ + LY+G KL+  D
Sbjct: 435 VIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLYLGHKLYTND 494

Query: 619 FRLFIRAKNIDLISHRIIF 637
           +  +IR   +D+ + R ++
Sbjct: 495 WTPWIRTHCVDINTDRDVY 513

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  392 bits (1008), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 216/579 (37%), Positives = 322/579 (55%), Gaps = 6/579 (1%)

Query: 90  TPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQ 149
           TP  ++S    +A  ++S +        K S      +E+D      +++ +      A 
Sbjct: 38  TPTTTASIDSNDATIDHS-KSVSRWTRIKDSFKRAEKEEVDPNLT--EAERIAINTAKAP 94

Query: 150 LKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGEL 209
           LK T+K RH+ M++                L  AGPA +VIG+G+  T +YC++ A GEL
Sbjct: 95  LKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGEL 154

Query: 210 AVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTT-KVDP 268
           AV +  V+G F T+ +  +D  F FA  + Y +QWL   PLE+V++S+T+ YW T +   
Sbjct: 155 AVVF-PVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYR 213

Query: 269 DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGA 328
           D                G +G+ EAEF F+  KV+ +IGF I+ I +  G     G++G 
Sbjct: 214 DGFVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGG 273

Query: 329 KYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVA 388
           +YW++PGAF G     +FKGV                  +TAAE +NPRK++P AAK+V 
Sbjct: 274 RYWHNPGAFVGDNAGTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPRAAKQVV 333

Query: 389 YRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILL 448
           +R               VPY   +L+G+SS   SASP+V+A   HG+  +   IN VIL+
Sbjct: 334 WRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASASPFVIAIVTHGIRGLPSVINVVILI 393

Query: 449 SVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPK 508
           +VLSV NSA ++ SR +  L++ G+ P+ F Y+DR GRPL  ++         F A S K
Sbjct: 394 AVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIAFIAASKK 453

Query: 509 ETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAI 568
           + +VF WL+A+SGLS +FTW  IC+ HIRFR  ++ QGRS  EL F +  G++GS +   
Sbjct: 454 QGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGIIGSSWGLF 513

Query: 569 MLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNI 628
           ML L  +AQF+VAL P  +    AE FF++YL+ PI+LA Y G K+++++++LFI+A+++
Sbjct: 514 MLLLMFIAQFYVALFPPGSKP-SAEVFFESYLSFPIVLAFYFGHKIYKKNWKLFIKAEDM 572

Query: 629 DLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           D+ + R   D ELL+QE EE K  L     W R   FWC
Sbjct: 573 DIDTGRRETDLELLKQEIEEEKAILATKGWWYRQYQFWC 611

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  391 bits (1004), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 209/575 (36%), Positives = 321/575 (55%), Gaps = 21/575 (3%)

Query: 101 NAVE-----NYSMQEFDNDLENKKSNL-HIRDDELD-YATVNVDSQPVEQQDENAQLKQT 153
           NAVE     +     FD+  EN KS++ H+ D E + Y T N           +++L + 
Sbjct: 44  NAVEYGEHTSLKSSSFDSK-ENIKSDVPHVSDFENNVYDTAN-----------DSKLNKD 91

Query: 154 IKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAY 213
           +  RH++ ++                L   GPA L++ + I+ TCL+ I+ A GELA  +
Sbjct: 92  LSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNALGELAAVF 151

Query: 214 SKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXX 273
             V G FN + +  V+P F FAV   Y  QW  + PLELV +S+TI+YW   ++ D    
Sbjct: 152 PVVGG-FNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYWNNTINSDAWVA 210

Query: 274 XXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWND 333
                         K + E EF  +  K++ +IGF I+ I +  G   +  YIG +YWND
Sbjct: 211 IFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGEYIGGRYWND 270

Query: 334 PGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXX 393
           PGAF G T   RFKGV                  ++AAE  NPR  +P A+K+  +    
Sbjct: 271 PGAFVGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLPKASKRTFWLITL 330

Query: 394 XXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLS 452
                       VPYN ++L+ G+SS   +ASP V+A    G+  +   +NA+IL+++LS
Sbjct: 331 CYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAILS 390

Query: 453 VANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDV 512
           VANSA Y+ SR ++ +A++G  PK  +Y+D+ GRPL ++          F A S K+ +V
Sbjct: 391 VANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEV 450

Query: 513 FTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFL 572
           FTWL A+SGLS +F WF+I +SHIRFR+ M+ Q RSL EL F + TGV GS+Y  I++FL
Sbjct: 451 FTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSITGVYGSWYGCIVIFL 510

Query: 573 ALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLIS 632
            L+A FW +L P+ +   DAE+FF+ YL++PI +  Y+G K++++D+RL+++ K++DL +
Sbjct: 511 VLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKKDWRLYVKTKDMDLDT 570

Query: 633 HRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            R   D ++L+QE    +E++   P + R ++ WC
Sbjct: 571 GRREIDLDILKQEIRLEREQMAQKPFYIRFLNVWC 605

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  391 bits (1004), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 221/595 (37%), Positives = 315/595 (52%), Gaps = 41/595 (6%)

Query: 74  KNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYAT 133
           K  ++R ++DSFKR E P                  E D +L  ++              
Sbjct: 51  KGSKWRQFIDSFKRVEVP------------------ELDPNLTEQER------------- 79

Query: 134 VNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYG 193
                  +     +  LK  +K RH+ M++                L  AGPA L+IG+ 
Sbjct: 80  -------IAIITAHTPLKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWS 132

Query: 194 IMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELV 253
           I G+ +Y ++ A  E+AV Y  ++G F T+ +  +D  F FA  + Y +QWL V PLE+V
Sbjct: 133 ITGSMIYSMVMAVAEMAVLY-PISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIV 191

Query: 254 TSSMTIKYWTTKVD-PDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMA 312
           ++S+T+ YW T     D                G KGY EAEF F+  KV+ ++GF I+ 
Sbjct: 192 SASITVNYWGTPTKYRDGFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILG 251

Query: 313 ICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAE 372
           + +  G   T GY+GAKYW+DPGAF G T   +F+G                   +  +E
Sbjct: 252 LVLVCGGGPTGGYVGAKYWHDPGAFVGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSE 311

Query: 373 QSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASL 432
             NPRKA+P AAK+V +R               VP N  +L+GSS+   +ASP+V+A ++
Sbjct: 312 AENPRKAVPPAAKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITV 371

Query: 433 HGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSML 492
           HG+  +   IN VIL++VLSV NSA Y+ SR L+ LA+ G+ PK   Y+DR+GRPL  + 
Sbjct: 372 HGIRGLPSVINVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIA 431

Query: 493 CXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGEL 552
                    F A S KE DVF WLLAISGLS  FTW AIC+ HIRFR  ++ Q RS  EL
Sbjct: 432 ISSFFGLVAFVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDEL 491

Query: 553 GFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGF 612
            F +  GV GSY+   ++ L L AQF+VA+ P+   T  A NFF  YL++P++L +Y+  
Sbjct: 492 PFVSPLGVFGSYWGLFLIVLMLAAQFYVAIFPVG-DTPSATNFFSAYLSLPVVLVMYIAH 550

Query: 613 KLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           KLW +++++FI    +DL + R   D +LLRQE  E +  L   P+W R+  FWC
Sbjct: 551 KLWTKNWKIFIPLGQLDLDTGRKQLDLDLLRQEVAEERATLAARPRWFRIYTFWC 605

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  389 bits (999), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 214/531 (40%), Positives = 295/531 (55%), Gaps = 3/531 (0%)

Query: 138 SQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGT 197
           ++ V      + L++ +K RH+ M++                L   GPA ++IG+G++G 
Sbjct: 68  AEKVAIATARSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGL 127

Query: 198 CLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSM 257
            +Y ++ A GELAV +  V G F T+    VD  F FA+ ++Y +QWL V PLE+V +S+
Sbjct: 128 MIYSVVMAMGELAVTF-PVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASI 186

Query: 258 TIKYWTTKVD-PDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICIN 316
           T+ YW T     D                G KGY EAEF F+  KV  ++GF I+ I + 
Sbjct: 187 TVNYWGTPAKYRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLI 246

Query: 317 TGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNP 376
            G     GY+G KYW++PGAF G    +RFK V                  L AAE  NP
Sbjct: 247 CGGGPVGGYVGGKYWHNPGAFNGDNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENP 306

Query: 377 RKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVH 436
           RKA+P AAK+V +R               VPY S+ L+GSSS   +ASP+VLA   HG+ 
Sbjct: 307 RKALPRAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVLAIKTHGIS 366

Query: 437 VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXX 496
            +   IN VIL+SVLSV NS+ Y+ SR L  LA  G+ P+ F Y+DR GRPL  +L    
Sbjct: 367 GLPSVINVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCT 426

Query: 497 XXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRA 556
                F A S KE DVF WL+A+SGLS +FTW  IC+ H+RFRR +  QGRS  EL F +
Sbjct: 427 FGLLCFIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTS 486

Query: 557 QTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWR 616
             GV GSY+  I++ L  +AQFW+A+ PM   T +A +FFQ YL++ ++L  Y+  KL+ 
Sbjct: 487 YVGVWGSYFGVILICLVFIAQFWIAVWPMG-GTPNASDFFQAYLSVVVVLFFYLAHKLYT 545

Query: 617 RDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           R++    RAK+ID+ + R   D + L+QE  E K +L   P W RV   WC
Sbjct: 546 RNWTFAKRAKDIDIDTGRRELDLDALKQEIAEEKLRLSTKPWWYRVYHLWC 596

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  387 bits (993), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 224/551 (40%), Positives = 309/551 (56%), Gaps = 12/551 (2%)

Query: 125 RDDELDYATVNVDSQPVEQQD-----ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXP 179
           RD       V VD    E +          LK  +K RH+ M++                
Sbjct: 55  RDSFKRVEPVEVDPNLTEAEKVAFITAQTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKA 114

Query: 180 LAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWV 239
           L   GPA L+IG+G MGT +Y ++ A GELAV +  ++G F T+ +  +D  F FA  + 
Sbjct: 115 LRTGGPASLLIGWGSMGTMIYAMVMALGELAVVF-PISGGFTTYATRFIDESFGFAANFN 173

Query: 240 YCIQWLCVCPLELVTSSMTIKYWTTKVDP---DXXXXXXXXXXXXXXXXGAKGYAEAEFF 296
           Y +QWL   PLE+V++S+T+ YW T  DP   D                G KGY EAEF 
Sbjct: 174 YMLQWLVTLPLEIVSASITVNYWGT--DPKYRDGFVALFWLVIVCINMFGVKGYGEAEFV 231

Query: 297 FNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXX 356
           F+  KV+ +IGF I+ I +N G     GYIG KY++DPGAF G T   +FKGV       
Sbjct: 232 FSIIKVITIIGFIILGIILNCGGGPEKGYIGGKYFHDPGAFAGDTPGAKFKGVCSVFVTA 291

Query: 357 XXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGS 416
                      L A+E  +PRK++P AAK+V +R               VPYN  +L+G+
Sbjct: 292 AFSFAGSELVGLAASESVDPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGA 351

Query: 417 SSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPK 476
           SS   +ASP+V+A   HG+  +   +N VIL++VLSV NSA ++ SR  + LA+ G+ P+
Sbjct: 352 SSVDAAASPFVIAIVTHGIKGLPSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQ 411

Query: 477 WFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHI 536
            F YVDR GRPL  ++         F A S KE DVF WLLA+SGLS +FTW  IC+ HI
Sbjct: 412 IFAYVDRKGRPLVGIIITSAVGLIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHI 471

Query: 537 RFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFF 596
           RFR+ +  QGRS+ EL F++ TGV GSY+   M+ +  +AQF+VAL P+N     AE FF
Sbjct: 472 RFRKALTSQGRSVDELSFKSPTGVWGSYWGLFMIVIMFIAQFYVALFPVNGSP-SAEGFF 530

Query: 597 QNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNG 656
           + YL+ P++LA+Y+G K+++R+++L I A  +D+ S R   D ELL+QE  E K  L   
Sbjct: 531 EAYLSFPLVLAMYIGHKIYKRNWKLLIPAGEMDIDSGRREVDLELLKQEIAEEKAILATK 590

Query: 657 PKWKRVVDFWC 667
           P W RV  FWC
Sbjct: 591 PAWFRVYSFWC 601

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  385 bits (989), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 220/580 (37%), Positives = 323/580 (55%), Gaps = 15/580 (2%)

Query: 91  PNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQL 150
           P+  S+T ++ A      Q+F +           R + ++      +++ V        L
Sbjct: 35  PSNGSATTNDEAGSGSKWQDFKDSFR--------RVEPVEVDPNLTEAEKVAFVTAQTPL 86

Query: 151 KQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELA 210
           K  +K RH+ M++                L   GPA L+IG+G  GT +Y ++ A GELA
Sbjct: 87  KHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMALGELA 146

Query: 211 VAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDP-- 268
           V +  ++G F T+ +  +D  F +A  + Y +QWL V PLE+V++S+T+ +W T  DP  
Sbjct: 147 VIF-PISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGT--DPKY 203

Query: 269 -DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIG 327
            D                G KGY EAEF F+  KV+ ++GF I+ I +N G     GYIG
Sbjct: 204 RDGFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIG 263

Query: 328 AKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKV 387
            KYW+DPGAF G T   +FKG+                  L A+E  +PRK++P AAK+V
Sbjct: 264 GKYWHDPGAFAGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVPKAAKQV 323

Query: 388 AYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVIL 447
            +R               VPYN   L+G+SS   +ASP+V+A   HG+  +   +N VIL
Sbjct: 324 FWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAASPFVIAIKTHGIKGLPTVVNVVIL 383

Query: 448 LSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSP 507
           ++VLSV NSA Y+ SR ++ LA+  + P+ F YVDR GRPL  +          F A S 
Sbjct: 384 IAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIAFVAASK 443

Query: 508 KETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAA 567
           KE DVF WLLA+SGLS +FTW  IC+ HIRFR+ +  QGR L EL F++ TGV GSY+  
Sbjct: 444 KEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGL 503

Query: 568 IMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKN 627
            M+ +  +AQF+VAL P+      AE FF+ YL+ P+++A+Y+G K+++R+++LFI A++
Sbjct: 504 FMVVIMFIAQFYVALFPVGASP-SAEGFFEAYLSFPLVVAMYLGHKIYKRNWKLFIPAED 562

Query: 628 IDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +D+ + R   D ELL+QE  E K  +   PKW R+ +FWC
Sbjct: 563 MDIDTGRREVDLELLKQEIAEEKAIMATKPKWYRIWNFWC 602

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  385 bits (988), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 217/594 (36%), Positives = 316/594 (53%), Gaps = 41/594 (6%)

Query: 75  NERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATV 134
           + R++   DSFKRAE P                  E D +L                   
Sbjct: 47  DSRWKKIKDSFKRAEVP------------------ELDPNL------------------- 69

Query: 135 NVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGI 194
             +++ +      + L+  +K RH+ M+S                L  AGPA ++IG+ I
Sbjct: 70  -TEAEKIAIATARSPLQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWII 128

Query: 195 MGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 254
            G+ +YC++ +  ELA+A+  V G F T+ +  +D  + FA  + Y +QW+   PLE+V 
Sbjct: 129 AGSMIYCMVMSVAELAIAF-PVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVA 187

Query: 255 SSMTIKYW-TTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAI 313
           +S+T+ YW T K   D                G +GY EAEF F+ CK++M++GF I+AI
Sbjct: 188 ASITVNYWHTDKKYRDGFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAI 247

Query: 314 CINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQ 373
            +  G     GYIGA+YW  PGAF G T   +FKG                   L AAE 
Sbjct: 248 ILICGGGPGTGYIGARYWYHPGAFAGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEA 307

Query: 374 SNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLH 433
           SNPRK +P AAK+V +R               VPY   +L+G SS   +ASP+V+A    
Sbjct: 308 SNPRKDVPGAAKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAIKNQ 367

Query: 434 GVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLC 493
           G+  +   +N VIL++VLSV NSA Y+ SR L  LA  G+ PK F Y+DR GRP+  +  
Sbjct: 368 GISGLPTLVNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAV 427

Query: 494 XXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELG 553
                   F A S KE +VF WL+A+SGLS +FTW  IC+ HIRFRR +  QGRS  EL 
Sbjct: 428 TSAFGLIAFVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELA 487

Query: 554 FRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFK 613
           F +  GV G+ +   +  + L AQF+VAL P+      A +FFQ YL++PI+LA+++G K
Sbjct: 488 FASPAGVWGAAWGLFLCIIMLAAQFYVALFPLGAPP-SANDFFQGYLSLPIVLAMWLGHK 546

Query: 614 LWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +W+++++LFI+A+++D+ + R   D +LLRQ+ EE +  L   P W R+  F+C
Sbjct: 547 IWKKNWKLFIKAEDMDIDTGRRELDLDLLRQQVEEERAALAAKPMWYRIYKFFC 600

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  384 bits (987), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 217/600 (36%), Positives = 317/600 (52%), Gaps = 6/600 (1%)

Query: 73  VKNERFRNWLDSFKRAETPNASSSTADENAVEN--YSMQEFDNDLENKKSNLHIRDDELD 130
           +K E +    D FK A++ N  + T       N   S     N  + K+      DD  +
Sbjct: 5   LKREYWSEVADGFKLADSGNRMTETPVGGTTSNPESSFLSEKNRYDFKEETTSFSDDRFN 64

Query: 131 YATVNVDSQP--VEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPL 188
                    P  +++    + + Q +  RH+I ++                L   GPA L
Sbjct: 65  SQHSYNPGSPDDIKEDIHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASL 124

Query: 189 VIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVC 248
           VIG+ I+ T L+ +I + GELA AY  V G FN + +  VDP F F+V   Y +QWL + 
Sbjct: 125 VIGWTIVSTALFTVINSLGELAAAYPVVGG-FNVYMTRFVDPSFAFSVNLNYLVQWLVLL 183

Query: 249 PLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGF 308
           PLELV +S+TI+YW   ++ D                  K + E EF  +  K++ +IGF
Sbjct: 184 PLELVAASLTIRYWDDTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGF 243

Query: 309 FIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXL 368
           FI+ I +  G     GYIG KYW+DPGAF G +   +FKG+                  +
Sbjct: 244 FILGIVLTCGGGPKGGYIGGKYWHDPGAFVGDSAGTQFKGLCSVFVTAAFSYAGIEMIAV 303

Query: 369 TAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYV 427
           +AAE  NPRK IP+AAK+  +                V YN  +L+ GSSS   +ASP V
Sbjct: 304 SAAESQNPRKTIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLV 363

Query: 428 LAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRP 487
           +A    G+  +   +NA+IL+++LSVANSA Y+ SR ++ +A +G  PK    VD+ GRP
Sbjct: 364 IAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRP 423

Query: 488 LRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGR 547
           LR++          F A S K+ +VFTWL A+SGLS IF W  I ++HIRFR+ M VQ R
Sbjct: 424 LRAIFTTLFFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNR 483

Query: 548 SLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLA 607
           SL E+ + +QTG+ GSYY   +LFL L+A FW +L P+     DAE FF+ YL+ PIL+A
Sbjct: 484 SLDEMPYLSQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIA 543

Query: 608 LYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            Y+G KL+ +++R+    + IDL++ R   D ++L++E +  +E LR     KR +  WC
Sbjct: 544 CYIGHKLYFKNWRIMTPLEEIDLLTGRKEVDIDILKEELKIEREALRQSSFMKRFLLIWC 603

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  381 bits (978), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 218/580 (37%), Positives = 323/580 (55%), Gaps = 17/580 (2%)

Query: 92  NASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLK 151
           + SS+ ++E+       +  D+  E ++  +     ELD          +  +  N+ L+
Sbjct: 32  DLSSTGSEEHKKGKVWTRFVDSFRERERLEVDPNMSELD---------QIAFRTANSPLQ 82

Query: 152 QTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAV 211
             +K RH+ M++                L  AGPA ++IG+G+ GT +Y ++ A GELAV
Sbjct: 83  HHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMALGELAV 142

Query: 212 AYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDP--- 268
            +  V+G F T+ +  +D  + FA    Y +QWL V PLE+V +S+T+ YW T  +P   
Sbjct: 143 LF-PVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGT--NPRYR 199

Query: 269 DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGA 328
           D                G KGY EAEF F+  KV+ ++GF I+ I +N G     GYIG 
Sbjct: 200 DGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPVKGYIGG 259

Query: 329 KYWNDP-GAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKV 387
           +YW+ P GAF G +   RFKGV                  L +AE +NPRK++P AAK+V
Sbjct: 260 RYWHHPYGAFVGDSAGARFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSVPKAAKQV 319

Query: 388 AYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVIL 447
            +R               VPY   +L+G+SS   +ASP+V+A + HG+  +   +N VIL
Sbjct: 320 FWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAASPFVIAITTHGIRGLPSVVNVVIL 379

Query: 448 LSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSP 507
           ++VLSV NSA Y+ SR L  LA+  + PK+F Y+DR+GRPL S+L         F A S 
Sbjct: 380 IAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVTSGFGLVAFVAQSK 439

Query: 508 KETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAA 567
           KE +VF WLLA+SGLS +FTW  IC+ HIRFR+ +  QGR   EL F +  GV GSY+  
Sbjct: 440 KEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSFVSPAGVYGSYWGL 499

Query: 568 IMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKN 627
            M+ L  +AQF+VAL P      +A+ FF+ YL+ PI++A Y+G K++++++++FI+A++
Sbjct: 500 FMIILMFIAQFYVALFPPGAKP-NAKAFFEAYLSFPIVIACYLGHKIYKKNWKIFIKAED 558

Query: 628 IDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +D+ + R   D +LLRQE  E +  L   P W R   FWC
Sbjct: 559 MDIDTGRKDDDLDLLRQEVAEERAVLATKPWWYRWWVFWC 598

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  379 bits (974), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 226/577 (39%), Positives = 316/577 (54%), Gaps = 16/577 (2%)

Query: 92  NASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLK 151
           N+  S +D + VE    + F +  +        R D  D      D++ +     NA LK
Sbjct: 26  NSYVSQSDASPVEGTRWERFRDSFK--------RADTQDLDPNLTDAEKMAILTANAPLK 77

Query: 152 QTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAV 211
           +T+K RH+ M++                LA AGPA ++IG+ + GT +YC++ A GELAV
Sbjct: 78  RTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGELAV 137

Query: 212 AYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVD-PDX 270
            +  + G F T+ S  VD  F FA   +Y +QWL V PLE+V +S+T+ YW T     D 
Sbjct: 138 TF-PIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRDG 196

Query: 271 XXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKY 330
                          G KGY EAEF F+  KV+ +IG+ I+ + +  G     GYIG + 
Sbjct: 197 FVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGRL 256

Query: 331 WNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYR 390
           W++PGAF        FKGV                  L AAE +NPRK++PSAAK+V +R
Sbjct: 257 WHNPGAFA-----NGFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWR 311

Query: 391 XXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSV 450
                          VPY SD+L+G SS   +ASP+V++    G+  +   IN VIL++V
Sbjct: 312 ITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINVVILIAV 371

Query: 451 LSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKET 510
           LSV NSA ++ SR +  LA  G  PK F Y+DR GRPL  ++         F A SPKE 
Sbjct: 372 LSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEG 431

Query: 511 DVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIML 570
           +VF WLLA+SGLS +FTW  I + HIR RR +  Q R+  EL F A TGV GS Y  +++
Sbjct: 432 EVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLI 491

Query: 571 FLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDL 630
            L L+AQFW+AL P+      A  FF+ YL+ PIL+A Y+G K+W+++++LFIRAKNID+
Sbjct: 492 ILILMAQFWIALFPIGDKP-SASAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDI 550

Query: 631 ISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            + R   D E L+QE  E K  + + P + R+  FWC
Sbjct: 551 DTGRRETDIEALKQEIAEEKAFIASKPFYYRMYKFWC 587

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  379 bits (973), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 217/599 (36%), Positives = 324/599 (54%), Gaps = 5/599 (0%)

Query: 73  VKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYA 132
           +K E + + +D FK A +P + +       V     +     L + K +  I     D  
Sbjct: 6   LKKEYWADMVDGFKPATSPVSENEKDSTIFVTEQKSKTDSTFLLSSKGSPGINQTTNDVT 65

Query: 133 TVN--VDSQPVEQQD-ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLV 189
           + +    S+ +EQ+D  N  L + +  RH++ ++                L+  GPA LV
Sbjct: 66  SSDHFRGSEGIEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLV 125

Query: 190 IGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCP 249
           I + I+ TCL+ +I + GEL+ A+  V G FN +    V+P F FAV   Y  QWL + P
Sbjct: 126 IDWVIISTCLFTVINSLGELSAAFPVVGG-FNVYSMRFVEPSFAFAVNLNYLAQWLVLLP 184

Query: 250 LELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFF 309
           LELV +S+TIKYW  K++ D                  K + E EF  +  K++ +IGF 
Sbjct: 185 LELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFT 244

Query: 310 IMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLT 369
           I+ I ++ G     GYIG KYW+DPGAF G +   +FKG+                  ++
Sbjct: 245 ILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVS 304

Query: 370 AAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVL 428
           AAE  NPR+ IP AAK+  +                VP N  +L+ GSSS   ++SP V+
Sbjct: 305 AAESKNPRETIPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVI 364

Query: 429 AASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPL 488
           A    G+  +   +NA+IL++V+SVANSA Y+ SR ++ +A +G  PK+ + VD+ GRP+
Sbjct: 365 AIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPM 424

Query: 489 RSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRS 548
            ++L         F A S K+ +VFTWL A+SGLS IF W AI +SHIRFR+ M+VQ RS
Sbjct: 425 NAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERS 484

Query: 549 LGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLAL 608
           L EL F +QTGV GS+Y  I+LFL L+A FW +L P+ +   +AE+FF+ YL+ PIL+  
Sbjct: 485 LDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVC 544

Query: 609 YVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           Y G K++ R++ L ++ ++IDL + R   D  L R+E +  +E L       R + FWC
Sbjct: 545 YFGHKIYTRNWTLMVKLEDIDLDTGRKQVDLALRREEMKVERETLAKRSFMTRFLHFWC 603

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  379 bits (972), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 222/545 (40%), Positives = 305/545 (55%), Gaps = 10/545 (1%)

Query: 129 LDYATVNVDSQPVEQ---QDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGP 185
           LD A V  D   +E+   +  +A LK  +K RH+ M++                L  AGP
Sbjct: 57  LDEAVVTDDMSDIEKIAHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGP 116

Query: 186 APLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWL 245
           A ++IG+G+ GT +YC++ A GEL+V +  ++G F T+ +  +D  F FA  + Y +QWL
Sbjct: 117 AGILIGWGLTGTMIYCMVMAMGELSVVF-PISGGFTTYATRFIDESFGFANNFNYMLQWL 175

Query: 246 CVCPLELVTSSMTIKYWTTKVDP---DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKV 302
           CV PLE+V +S+T+ YW T  DP   D                G KGY EAEF F+  KV
Sbjct: 176 CVLPLEIVAASITVNYWGT--DPKYRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKV 233

Query: 303 MMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXX 362
           + +IGF IM I +N G     GYIG KY++DPGAF G T   RF+GV             
Sbjct: 234 LTVIGFIIMGIVLNCGGGPEGGYIGGKYFHDPGAFVGDTAGARFQGVCSVFVTAAFSFAG 293

Query: 363 XXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNS 422
                + AAE + PRK++P AAK+V +R               VPY  ++L+G+SS   +
Sbjct: 294 SELIGIAAAESAEPRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAA 353

Query: 423 ASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVD 482
           ASP+V+A + HG+  +   +N VIL++VLSV NSA Y  SR L  LAQ  + PK F Y+D
Sbjct: 354 ASPFVIAITSHGIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYID 413

Query: 483 RNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGM 542
           R+GRPL  +          F A S KE +VF WLLA+SGLS +FTW  IC  HIRFR  +
Sbjct: 414 RSGRPLFGIAFTSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAAL 473

Query: 543 QVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAM 602
             QGRS  EL F+A  G+ GS +   M+ L  +AQF+VAL P       AE FFQ+YL+ 
Sbjct: 474 TAQGRSTDELPFKAPAGIYGSMWGLFMIVLMFMAQFYVALFPPGGKP-SAEVFFQSYLSF 532

Query: 603 PILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRV 662
           P++LA Y G KL+ R+++L I    +D+ + R   D ++LRQE  E K+ +   P W R 
Sbjct: 533 PVVLAFYFGHKLYARNWKLLIPLSKLDIDTGRREMDLDVLRQEIAEEKQMMSTRPWWYRW 592

Query: 663 VDFWC 667
             FWC
Sbjct: 593 YSFWC 597

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  377 bits (969), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 210/558 (37%), Positives = 313/558 (56%), Gaps = 6/558 (1%)

Query: 112 DNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXX 171
            +D +N+K  L  +++  D  ++    Q  E+   N  L + +  RH++ ++        
Sbjct: 7   SSDFKNEKWTL--KEESQDIPSITETRQEEEETLNNTNLSKNLSVRHLVTLAVGGSIGTG 64

Query: 172 XXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPG 231
                   L+  GPA LV+G+ I+ TCL+ +I + GELA A+  V G FN + +  VDP 
Sbjct: 65  LFVNSGTALSDGGPASLVVGWVIISTCLFTVINSLGELAAAFPIVGG-FNVYITRFVDPS 123

Query: 232 FNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYA 291
             FAV   Y  QWL + PLELV +S+TIKYW  K++ D                  K + 
Sbjct: 124 VGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDKINSDAWVAIFYVTIVLANMLEVKSFG 183

Query: 292 EAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMD 351
           E EF  +  K++ +IGF I+ I + +G   + GY+G KYWN+PGAF G T   +FKG+  
Sbjct: 184 ETEFVLSMVKILAIIGFTILGIVLASGGGPSGGYLGFKYWNNPGAFVGGTNASKFKGLCS 243

Query: 352 XXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSD 411
                           ++AAE  NPRK IP AAK+  +                VPYN  
Sbjct: 244 VFVTAAFSFSGIEMIAVSAAESKNPRKVIPKAAKRTFWLVTSSYVVILTLVGCLVPYNDS 303

Query: 412 QLMGSSSGGNSA-SPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQ 470
           +L+ +++  ++A SP V+A    G+  +   +NA+IL++++SVANSA Y+ SR ++ +A 
Sbjct: 304 RLLNAATSVDAAASPLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAH 363

Query: 471 VGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFA 530
           +G  PK    VD+ GRP+ +++         F A S K+ +VFTWL A+SGLS IF W A
Sbjct: 364 IGNLPKVLSKVDKKGRPMNALIVTLIFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMA 423

Query: 531 ICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTL 590
           I  S IRFRR MQVQ RSL EL + +QTG+ G++Y  ++LFL +VA FW ++ P+ +   
Sbjct: 424 INYSLIRFRRAMQVQNRSLDELPYLSQTGIWGAWYGVLVLFLVIVASFWTSMFPLGSAHA 483

Query: 591 DAENFFQNYLAMPILLALYVGFKLW-RRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEY 649
           DAE+FF+++L++PILL  Y G KL+  R++RL I A+ +D+ S R I DEE L+QE EE 
Sbjct: 484 DAESFFESFLSLPILLVCYFGHKLYFARNWRLQIGAEEMDIDSGRKIIDEEGLKQEREE- 542

Query: 650 KEKLRNGPKWKRVVDFWC 667
           +EK  N     +    WC
Sbjct: 543 EEKAMNSSFLIKFWHVWC 560

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  377 bits (968), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 218/579 (37%), Positives = 322/579 (55%), Gaps = 16/579 (2%)

Query: 92  NASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLK 151
           N S+ + DE        Q+F +  +       ++  E+D      +++ V        LK
Sbjct: 37  NGSAVSIDETG-SGSKWQDFKDSFK------RVKPIEVDPNLS--EAEKVAIITAQTPLK 87

Query: 152 QTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAV 211
             +K RH+ M++                L   GPA L+IG+G  GT +Y ++ A GELAV
Sbjct: 88  HHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELAV 147

Query: 212 AYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDP--- 268
            +  ++G F T+ +  +D  F +A  + Y +QWL V PLE+V++S+T+ +W T  DP   
Sbjct: 148 IF-PISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGT--DPKYR 204

Query: 269 DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGA 328
           D                G KGY EAEF F+  KV+ ++GF I+ I +N G   T GYIG 
Sbjct: 205 DGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGG 264

Query: 329 KYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVA 388
           KYW+DPGAF G T   +FKGV                  L A+E   PRK++P AAK+V 
Sbjct: 265 KYWHDPGAFAGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKAAKQVF 324

Query: 389 YRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILL 448
           +R               VPYN   L+G+SS   +ASP+V+A   HG+  +   +N VIL+
Sbjct: 325 WRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVILI 384

Query: 449 SVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPK 508
           +VLSV NSA Y+ SR ++ LA+  + P+ F YVDR GRPL  +          F A S K
Sbjct: 385 AVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASKK 444

Query: 509 ETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAI 568
           E +VF WLLA+SGLS +FTW  IC+ HIRFR+ +  QGR L EL F++ TGV GSY+   
Sbjct: 445 EGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVWGSYWGLF 504

Query: 569 MLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNI 628
           M+ +  +AQF+VA+ P+   +  AE FF+ YL+ P+++ +Y+G K+++R+++LFI A+ +
Sbjct: 505 MVIIMFIAQFYVAVFPVG-DSPSAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLFIPAEKM 563

Query: 629 DLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           D+ + R   D +LL+QE  E K  +   P+W R+ +FWC
Sbjct: 564 DIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRIWNFWC 602

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  377 bits (968), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 218/599 (36%), Positives = 322/599 (53%), Gaps = 5/599 (0%)

Query: 73  VKNERFRNWLDSFKRAETPN-ASSSTADENAVENYSMQEFDNDLENKKS-NLHIRDDELD 130
           +K E + + +D FK A +P   +         E  S  +    L  K S  +    +++ 
Sbjct: 6   LKKEYWADVVDGFKPAPSPGFENEKDCSAFGTEQKSQTDSTFPLSTKGSPGMKQTTNDIT 65

Query: 131 YATVNVDSQPVEQQD-ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLV 189
            +  + D+  VEQ D  N  L + +  RH++ ++                L+  GPA LV
Sbjct: 66  SSERSRDNDDVEQVDINNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASLV 125

Query: 190 IGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCP 249
           I + I+GTCL+ +I + GEL+ A+  V G FN +    V+P F FAV   Y  QWL + P
Sbjct: 126 IDWVIIGTCLFTVINSLGELSAAFPVVGG-FNVYGMRFVEPSFAFAVNLNYLAQWLVLLP 184

Query: 250 LELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFF 309
           LELV +S+TIKYW  K++ D                  K + E EF  +  K++ +IGF 
Sbjct: 185 LELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFS 244

Query: 310 IMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLT 369
           I+ I ++ G     GYIG KYW +PGAF G     +FKG+                  ++
Sbjct: 245 ILGIVLSCGGGPHGGYIGGKYWRNPGAFVGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVS 304

Query: 370 AAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVL 428
           AAE  NPR+ IP AAK+  +                VP N  +L+ GSSS   ++SP V+
Sbjct: 305 AAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVI 364

Query: 429 AASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPL 488
           A     +  +   +NA+IL++V+SVANSA Y+ SR ++ +A +G  PK+ + VD+ GRP+
Sbjct: 365 AIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPM 424

Query: 489 RSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRS 548
            ++L         F A S KE +VFTWL A+SGLS IF W AI +SHIRFR+ M+VQ RS
Sbjct: 425 NAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQERS 484

Query: 549 LGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLAL 608
           L EL F +QTGVLGS+Y  ++LFL L+A FW +L P+ +    AE+FF+ YL+ PIL+  
Sbjct: 485 LDELPFISQTGVLGSWYGFVVLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFPILIVC 544

Query: 609 YVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           Y G K++ R++ L ++ ++IDL + R   D  L R+E +  +E L       R + FWC
Sbjct: 545 YFGHKIYTRNWTLMVKIEDIDLDTGRKQVDLTLRREEMKIERENLAKKSFITRFLHFWC 603

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  374 bits (961), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 218/587 (37%), Positives = 311/587 (52%), Gaps = 10/587 (1%)

Query: 82  LDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPV 141
           +DSFK AET  +   +A             D+  ++K+ +L    +    A  N+DS   
Sbjct: 12  IDSFKPAETQPSRLRSARSR------YDSADDRADSKQKDLMSGSET--KALENLDSTSQ 63

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
           E +D++A+  + +  RH++ ++                L   GP  LVI + I+ TCL+ 
Sbjct: 64  EVEDQDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFT 123

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
           I+ A GEL+  +  V G FN + S  V+P F FAV   Y  QW  + PLELV +S+TI+Y
Sbjct: 124 IVNALGELSSTFPVVGG-FNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRY 182

Query: 262 WTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAG 321
           W   ++ D                  K + E EF  +  K++ +IGF I+ I +  G   
Sbjct: 183 WNHTINSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGP 242

Query: 322 TDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIP 381
             GYIG KYW++PGAF G T  +RF G+                  ++AAE  NPR  +P
Sbjct: 243 KGGYIGGKYWSNPGAFVGHTAGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLP 302

Query: 382 SAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVLAASLHGVHVVQH 440
            A K+  +                V  +  +L+ GSSS   +ASP V+A    G+  +  
Sbjct: 303 KACKRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPS 362

Query: 441 FINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXX 500
            +NA+IL++VLSVANSA Y+ SR +  +AQ+G  PK F YVDR GRPL +++        
Sbjct: 363 LMNAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLL 422

Query: 501 XFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGV 560
            F A S K+ +VFTWL A+SGLS +F WFAI VSHIRFRR M+ +GR+L EL F + TGV
Sbjct: 423 SFIAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMTGV 482

Query: 561 LGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFR 620
            GSYY  I++F+ LV  FW +L P      +AE+FF+ YL+ PILLA Y G KL+ R +R
Sbjct: 483 WGSYYGCIVIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWR 542

Query: 621 LFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           L    K IDL S R   D EL++ E    ++ +R    + R +  WC
Sbjct: 543 LLTPTKEIDLDSGRRAVDLELMKDEKRIEEQAMRQKSLFARFIHLWC 589

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  374 bits (961), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 218/615 (35%), Positives = 322/615 (52%), Gaps = 27/615 (4%)

Query: 73  VKNERFRNWLDSFK-----RAETPNASSSTADEN-----------AVENYSMQEFDND-- 114
           ++ E +   +D F+     RAE P  + ST  ++              +Y M  + N   
Sbjct: 6   LRREYWHEVVDGFRPAASARAEAPVTTGSTGGDSLGDEKNGFMGAGTTSYEMYNYSNSST 65

Query: 115 -LENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXX 173
               K  +  +  DE     +       E  D + Q+ + +  RH++ ++          
Sbjct: 66  GAGGKGDSHSLTRDEAGSGVMK------EDVDGHPQMNKDLDVRHLLTLAVGGAIGTGLF 119

Query: 174 XXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFN 233
                 L+  GPA LVI + I+ TCL+ ++ + GELA A+  V G FN + +  +DP F 
Sbjct: 120 VNSGAALSSGGPASLVIDWVIISTCLFTVVNSLGELAAAFPVVGG-FNVYITRFIDPSFG 178

Query: 234 FAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEA 293
           FAV   Y  QWL + PLELV +S+TI+YW  K++ D                  K + E 
Sbjct: 179 FAVNINYLAQWLVLLPLELVAASITIRYWNDKINSDAWVAIFYAAIAFANMLDVKSFGET 238

Query: 294 EFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXX 353
           EF  +  K++ ++GF I+ I ++ G     GYIG KYW+DPGAF G+T   +FKG+    
Sbjct: 239 EFILSMIKILAIVGFTILGIVLSCGGGPKGGYIGGKYWHDPGAFVGETSGTKFKGLCSVF 298

Query: 354 XXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQL 413
                         ++AAE  NPR+ IP AAK+  +                VPYN+ +L
Sbjct: 299 VTAAFSYSGMELTAVSAAESLNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKL 358

Query: 414 M-GSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVG 472
           + GSSS   ++SP V+A    G+  +   +NA+IL++++SVANSA Y+ SR ++ +A++ 
Sbjct: 359 LNGSSSVDAASSPLVIAIENGGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIR 418

Query: 473 YAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAIC 532
             P++   VDR GRPL + L         F A S K+ +VFTWL A+SGLS IF W AI 
Sbjct: 419 NLPRFLGRVDRKGRPLNATLLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAIN 478

Query: 533 VSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDA 592
           +SHIRFR+ M  QG SL EL + + TGV GS+Y  I+LFL LVA FW +L P+     DA
Sbjct: 479 LSHIRFRQAMAHQGISLDELPYISMTGVSGSWYGVIVLFLVLVASFWTSLFPLGGKGADA 538

Query: 593 ENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEK 652
            +FF+ YL+ PIL+  YVG KL+ R  RL I   ++DL+S R + D E+ R+E    KE+
Sbjct: 539 TSFFEGYLSFPILIVCYVGHKLYIRKKRLLIDVADMDLVSDRKVVDVEVCREEMRIEKEQ 598

Query: 653 LRNGPKWKRVVDFWC 667
           L     + R +  WC
Sbjct: 599 LAKRSFFARFLHLWC 613

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  373 bits (958), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 222/598 (37%), Positives = 311/598 (52%), Gaps = 18/598 (3%)

Query: 84  SFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSN-----------LHIRDDELDYA 132
           S    +T   +S   D   VEN S +    D     S               R +E++  
Sbjct: 2   SIIEEKTRLPASKGGDNVVVENISQEPVSYDQSQGSSTEAHSRWGRFKESFKRAEEMELD 61

Query: 133 TVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGY 192
               +++ +  +   + LK  +K RH+ M++                L  AGPA ++IG+
Sbjct: 62  PNLTEAERIAIKTAQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGW 121

Query: 193 GIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLEL 252
           G+ GT +Y ++ A GELAV +  V G F T+ +  VD  F FA  ++Y +QWL V PLE+
Sbjct: 122 GLTGTMIYSMVMAVGELAVVF-PVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEI 180

Query: 253 VTSSMTIKYWTTKVDP---DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFF 309
           V +S+T+ YW T  DP   D                G KGY EAEF F+  KV+ +IGF 
Sbjct: 181 VAASITVNYWGT--DPKYRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFI 238

Query: 310 IMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLT 369
           IMAI +  G      YIGA+YW +PGAF G T  ++F+G                   L 
Sbjct: 239 IMAIVLICGGGKDHKYIGAQYWYNPGAFVGDTAGQQFQGFCTVFVTAAFSFAGSELVGLA 298

Query: 370 AAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLA 429
            +E   PRK++P AAK+V +R               VP +S +L+G+SS   +ASP+V+A
Sbjct: 299 GSEAEEPRKSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAASPFVIA 358

Query: 430 ASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLR 489
              HG+  +   +N VIL++VLSV NSA YS SR L  LA  G+ P    Y+DR GRPL 
Sbjct: 359 IVNHGIKGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLV 418

Query: 490 SMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSL 549
            +          F A S KE DVF WL+A+SGLS +FTW  IC+ HIR+R  +  QGRS 
Sbjct: 419 GIAISAFFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRST 478

Query: 550 GELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALY 609
            EL F+A  GV GSY+   M  L  +AQF+V L P  T   +A +FF  YL+  I +ALY
Sbjct: 479 DELPFQAPAGVWGSYWGFFMCILMFIAQFYVGLFPPGTKP-NAYDFFLAYLSFCIFIALY 537

Query: 610 VGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
              K+W+R+++LFI  K++D+ + R   D ++LR+E  E +  L   P W R   FWC
Sbjct: 538 AFHKIWKRNWKLFIPLKDLDIDTGRREVDLDVLREELAEERAALAARPFWYRSWKFWC 595

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  372 bits (956), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 217/573 (37%), Positives = 309/573 (53%), Gaps = 14/573 (2%)

Query: 107 SMQEFDNDLENKKSNLH----------IRDDELDYATVNV-DSQPVEQQDENAQLKQTIK 155
           S++ FDN +++     H           +  E++    N+ D + +  +   + L+  +K
Sbjct: 34  SLESFDNQIDSSNYASHRSAWGNFLDSFKRVEVEEVDPNLTDLEKIAIKTARSPLQHKLK 93

Query: 156 PRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSK 215
            RH+ M++                L  AGPA ++IG+ I GT ++ ++ A GELAV +  
Sbjct: 94  SRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMALGELAVMF-P 152

Query: 216 VNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVD-PDXXXXX 274
           V+G F T+ +  +D  F FA  + Y +QWL V PLE+V +S+T+ YW T V   D     
Sbjct: 153 VSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVRYTDGFVAL 212

Query: 275 XXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDP 334
                      G +GY EAEF F+  KV  +IGF I+ I +  G     GY+GA+YW++P
Sbjct: 213 FWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYVGARYWHNP 272

Query: 335 GAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXX 394
           GAF G T  ++F G                   L  +E  NPRKA+PSAAK+V +R    
Sbjct: 273 GAFVGSTSGQKFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVPSAAKQVFWRILLF 332

Query: 395 XXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVA 454
                      VPYN  +L+ SSS   SASP+V+A   HG+  +   IN VIL+SVLSV 
Sbjct: 333 YIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVTHGISGLPSVINVVILISVLSVG 392

Query: 455 NSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFT 514
           NSA YS SR L+ L++ G+ PK   Y+DR GRPL  +          F A S K+ ++F 
Sbjct: 393 NSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIAFVAASNKQNEMFN 452

Query: 515 WLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLAL 574
           WLLAISGLS  FTW AIC+ HIRFR  ++ QGR   EL F +  GV+GSY+   +  L L
Sbjct: 453 WLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPAGVIGSYWGLFLNILML 512

Query: 575 VAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHR 634
           +AQF++AL P+      A  FF  YLA P++LA Y+  KLW+++++  I  +++D+ + R
Sbjct: 513 IAQFYIALFPIGGSP-SAYEFFSAYLAAPVILAFYIAHKLWKKNWKFLIPLEDVDIDTGR 571

Query: 635 IIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
              D  LL+QE  E K  L   P W RV  FWC
Sbjct: 572 RDTDVNLLKQEIAEEKAALAMRPWWYRVYVFWC 604

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  372 bits (956), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 219/551 (39%), Positives = 305/551 (55%), Gaps = 5/551 (0%)

Query: 118 KKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXX 177
           K S     D ELD      +++ + Q    A L+ T+K R   M++              
Sbjct: 73  KDSFKKAEDVELDPNLT--EAERIAQATAKAPLQHTLKGRQQTMIAIGGAIGSGLFVGSS 130

Query: 178 XPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVA 237
             L   GPA L+IG+G+  T +Y ++ A GELAV +  V G F T+ +  VD  F +A  
Sbjct: 131 TALRTGGPAGLIIGWGLTSTMIYSMVMALGELAVVF-PVAGGFTTYATRFVDESFGYANN 189

Query: 238 WVYCIQWLCVCPLELVTSSMTIKYWTTKVD-PDXXXXXXXXXXXXXXXXGAKGYAEAEFF 296
           + Y +QWL V PLE+V++S+T+ YW T     D                G KG+ EAEF 
Sbjct: 190 FNYALQWLVVLPLEIVSASITVNYWGTPTRYRDGFVALFWLVIVIINMFGVKGFGEAEFV 249

Query: 297 FNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXX 356
           F+  KV  +IGF I+ I +  G     G++GAKYW+DPGAF G     +FKGV       
Sbjct: 250 FSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAFVGHGSGAQFKGVCSVFVTA 309

Query: 357 XXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGS 416
                      +TAAE +NPRK+IP AAK+V +R               VPYN  +L+G+
Sbjct: 310 AFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGA 369

Query: 417 SSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPK 476
           SS   +ASP+V+A   HG+  +   IN VIL++VLSV NSA ++ SR +  L+  G+ PK
Sbjct: 370 SSVDAAASPFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPK 429

Query: 477 WFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHI 536
            F Y+DR+GRPL  +          F A S KE +VF WLLA+SGLS +FTW  IC+ HI
Sbjct: 430 VFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHI 489

Query: 537 RFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFF 596
           RFR  ++ QGR   EL F +  GV GSY+   M+ L  +AQF+VAL P      DAE FF
Sbjct: 490 RFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLMFIAQFYVALFPPGGKP-DAEVFF 548

Query: 597 QNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNG 656
           Q+YL+ PI++A Y G K+++R+++LFI  +++D+ + R   D ELL+QE  E K  L + 
Sbjct: 549 QSYLSFPIVVATYFGHKIYKRNWKLFIPLEDMDIDTGRRETDMELLKQEIMEEKAILASK 608

Query: 657 PKWKRVVDFWC 667
           P + R   FWC
Sbjct: 609 PWYIRAYAFWC 619

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  370 bits (951), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 215/597 (36%), Positives = 324/597 (54%), Gaps = 16/597 (2%)

Query: 70  LPQVKNERFRNWLDSFKRAETPNASSSTADENAVE---NYSMQEFDNDLENKKSNLHIRD 126
           +P + N+ +   +    R  TP  SS +   N++E   ++  ++  N L  K+ N+ I+ 
Sbjct: 1   MPSIFNKEYWAEVRDGFRTATPQGSSLSGGNNSIEMNSSFITEKRSNSL--KEDNVMIQT 58

Query: 127 DELDYATVNV-------DSQPVEQQD-ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXX 178
                AT N+       DS  + ++D + + L + +  RH++ ++               
Sbjct: 59  TS-SGATKNINGTSNPNDSNMLSKEDIDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGA 117

Query: 179 PLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAW 238
            L   GPA LVIG+ I+ T L+ +I + GELA AY  V G F+ + +  +DP   F++  
Sbjct: 118 SLNTGGPASLVIGWVIVSTALFTVINSLGELAAAYPVVGG-FSVYMTRFIDPSIAFSINL 176

Query: 239 VYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFN 298
            Y +QWL + PLELV +S+TI+YW  K++ D                  K + E EF  +
Sbjct: 177 NYLVQWLVLLPLELVAASITIRYWNDKINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLS 236

Query: 299 CCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXX 358
             K++ +IGF I+ I ++ G     GYIG KYW+DPGAF G T   +FKG+         
Sbjct: 237 FIKILAIIGFTILGIVLSCGGGPVGGYIGGKYWHDPGAFVGHTAGSQFKGLCSVFVTAAF 296

Query: 359 XXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSS 417
                    ++AAE  +PRK IP AAK+  +                VPY+  +L+ GSS
Sbjct: 297 SYSGIEMIAVSAAESIDPRKTIPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSS 356

Query: 418 SGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKW 477
           S   ++SP V+A    G+  +   +NA+IL++VLSVANSA Y+ SR ++ +A +G  PK 
Sbjct: 357 SVDVASSPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQ 416

Query: 478 FDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIR 537
              +D+ GRP+ + L         F A S K+ +VFTWL A+SGLS IF W  I +SHIR
Sbjct: 417 LGRIDKKGRPINATLVTLFFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIR 476

Query: 538 FRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQ 597
           FRR M +QGRSL E+ + +Q GV GS+Y  I+LFL L+A FW +L P+ +   +A  FF+
Sbjct: 477 FRRAMDIQGRSLEEMPYLSQVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFE 536

Query: 598 NYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLR 654
            YL++PILLA YVG K + +++RLF     IDL S +   D ELLR+E +  +  L+
Sbjct: 537 GYLSLPILLACYVGHKFYFKNWRLFTPYNEIDLDSGKRDIDLELLREEKKMEELALK 593

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  370 bits (950), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 218/534 (40%), Positives = 309/534 (57%), Gaps = 7/534 (1%)

Query: 137 DSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMG 196
           +++ +     N+ LK+ +K RH+ M++                L  AGPA ++IG+ + G
Sbjct: 64  EAEKIAIATANSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTG 123

Query: 197 TCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSS 256
           T +YC++ A GELAV +  V+G F T+ +  +D  F +A  + Y +QWL V PLE+V +S
Sbjct: 124 TMIYCMVMAMGELAVTF-PVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAAS 182

Query: 257 MTIKYWTTKVDP---DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAI 313
           +T+ YW T  DP   D                G KGY EAEF F+  KV+ +IGF I+ I
Sbjct: 183 ITVNYWGT--DPKYRDGFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGI 240

Query: 314 CINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQ 373
            +  G     GYIG   W++PGAF G T  +RFKGV                  L +AE 
Sbjct: 241 ILVCGGGPVGGYIGGANWHNPGAFVGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAET 300

Query: 374 SNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLH 433
           +NPRK++P AAK+V +R               VPYN  +L+G+SS   +ASP+VLA   H
Sbjct: 301 ANPRKSLPRAAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVLAIKNH 360

Query: 434 GVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLC 493
           G+  +   +N VIL++VLSV NSA +  SR L  LA+ G+ PK F Y+DR GRPL  +  
Sbjct: 361 GIKGLPSVVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGF 420

Query: 494 XXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELG 553
                   F A SPKE +VF WLLA+SGLS +FTW AIC+ H+RFRR +  QGRS  EL 
Sbjct: 421 TSFFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELS 480

Query: 554 FRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFK 613
           F +  GV GS Y  +++ L L AQFW+AL P+ +   DA++FF++YL++P++L +Y+G K
Sbjct: 481 FVSPAGVWGSIYGTVLIMLILAAQFWIALFPIGSPP-DAKDFFESYLSLPVVLVMYIGHK 539

Query: 614 LWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            ++R+++LFIRA+NID+ + R   D E L+ E  E K  L +   W R   FWC
Sbjct: 540 CYKRNWKLFIRAENIDIDTGRREVDIEALKVELAEEKAVLASKSLWIRSYYFWC 593

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  369 bits (946), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 197/542 (36%), Positives = 301/542 (55%), Gaps = 3/542 (0%)

Query: 127 DELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPA 186
           +E DYA +N D +      ++++L + +  RH++ ++                L+  GPA
Sbjct: 42  EEKDYADMN-DVEKAIYNTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPA 100

Query: 187 PLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLC 246
            LVI + I+ TCL+ I+ + GEL+  +  V G FN + +  V+P F FAV + Y  QW  
Sbjct: 101 SLVIAWTIISTCLFTIVNSLGELSATFPVVGG-FNVYVTRFVEPSFGFAVNFNYLAQWAI 159

Query: 247 VCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMI 306
           + PLEL  +S+TI+YW   ++PD                  K + E EF  +  K++ +I
Sbjct: 160 LLPLELCAASITIRYWNKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAII 219

Query: 307 GFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXX 366
           GF I+ I +  G   + G+IG KYWNDPGAF G T  +RFKG+                 
Sbjct: 220 GFTILGIVLICGGGPSGGFIGGKYWNDPGAFVGDTPAQRFKGLSAVFITAAFSYSGLELV 279

Query: 367 XLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASP 425
            ++AAE  NPR  +P AAK+  +                VP N   L+ G+SS   +ASP
Sbjct: 280 GVSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASP 339

Query: 426 YVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNG 485
            V+A    G+  +   +NA+IL+++LSVANSA Y+ SR ++ +A++G  P+   +VD+ G
Sbjct: 340 LVIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKG 399

Query: 486 RPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQ 545
           RPL ++          F A S K  +VFTWL A+SGLS +F WFAI ++H+RFR  M+ Q
Sbjct: 400 RPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQ 459

Query: 546 GRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPIL 605
            RSL EL + + TG  GS+Y  I++ L L+A FW +L P   +  DA +FF++YL++PI 
Sbjct: 460 NRSLEELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIF 519

Query: 606 LALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDF 665
           +A Y+G K+W+R+ RL+I+   +D+ S R   D   L+QE E   E ++  P + R+ +F
Sbjct: 520 IACYLGHKIWKRNLRLYIKLSEVDVDSGRTDTDAATLKQEKEAEAELMKTKPFYIRLWNF 579

Query: 666 WC 667
           WC
Sbjct: 580 WC 581

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  369 bits (948), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 214/607 (35%), Positives = 327/607 (53%), Gaps = 19/607 (3%)

Query: 73  VKNERFRNWLDSF---KRAETPNASSSTADENAVENYSMQEFDN----DLENKKSNLHIR 125
           +K + +   +D F    R ++ N  SS+ D     N+ +   ++    ++ +  ++  ++
Sbjct: 6   LKKQYWTEVIDGFHSPDRTDSANDRSSSPD-----NFELSSVNSPVRVNVSSSGNDDILK 60

Query: 126 DDELDYATVNVDSQPVE----QQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLA 181
            D  +Y   +V + P      +   N  L + +  RH++ ++                L 
Sbjct: 61  GDTKEYPR-DVKATPEAASYVEDINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLT 119

Query: 182 QAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYC 241
             GPA LVIG+ I+ TCL+ +I + GELA A+  V G FN + +  ++P F FA+   Y 
Sbjct: 120 TGGPASLVIGWVIVSTCLFTVINSLGELAAAFPVVGG-FNVYITRFIEPSFAFAINLNYL 178

Query: 242 IQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCK 301
            QWL + PLELV +S+TI+YW  K++ D                  K + E EF  +  K
Sbjct: 179 AQWLVLLPLELVAASITIRYWNDKINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVK 238

Query: 302 VMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXX 361
           ++ +IGF I+ I +  G     GYIG KYW++PGAF G +   +FKG+            
Sbjct: 239 ILAIIGFGILGIVLTCGGGPHGGYIGGKYWHNPGAFVGHSAGSQFKGLCSVFVTAAFSYS 298

Query: 362 XXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGG 420
                 ++AAE  NP++ IP AAK+  +                VPYN  +L+ GSSS  
Sbjct: 299 GIEMTAVSAAESRNPKETIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVD 358

Query: 421 NSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDY 480
            +ASP V+A    G+  +   +NA+IL++++SVANSA Y+ SR ++ +A +G  PK+   
Sbjct: 359 AAASPLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSK 418

Query: 481 VDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRR 540
           VD+ GRPL ++L         F A S K+ +VFTWL A+SGLS IF W AI +S IRFR 
Sbjct: 419 VDKRGRPLNAILLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRD 478

Query: 541 GMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYL 600
            M+ QGRSL E+ F +Q+G  G++Y  I+LFL LVA FW +L P+ + T  A++FF+ YL
Sbjct: 479 AMKAQGRSLDEMPFLSQSGTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYL 538

Query: 601 AMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWK 660
           ++PIL+A YVG KLW+RD+RL +    +DL S R + D E   +E    +E L N   + 
Sbjct: 539 SLPILIACYVGHKLWKRDWRLLVPLMEMDLDSGRRVLDAETREEELRVEREYLANASFFT 598

Query: 661 RVVDFWC 667
           R +  WC
Sbjct: 599 RFLHIWC 605

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  368 bits (944), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 209/598 (34%), Positives = 322/598 (53%), Gaps = 19/598 (3%)

Query: 73  VKNERFRNWLDSFKRAETPNA--SSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELD 130
           ++N      ++ FK AE   +     ++ ++++ + ++++ DN +E       + +D   
Sbjct: 6   LRNGPLNKIVNGFKSAEDEKSILEGKSSTQSSLLDLTLKKCDNGIE-------VVND--- 55

Query: 131 YATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVI 190
            AT  V +  V     N  L + +  RH++ ++                LA  GPA LVI
Sbjct: 56  -ATSTVSNASVT----NVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVI 110

Query: 191 GYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPL 250
            + I+ TCL+ +I A GE+A A+  V G FN + +  VDP   FAV   Y  QWL + PL
Sbjct: 111 DWVIISTCLFTVINALGEMAAAFPVVGG-FNVYITRFVDPSVGFAVNINYLAQWLVLLPL 169

Query: 251 ELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFI 310
           ELV +SMTIKYW   ++ D                  K + E EF  +  K++ +IGF I
Sbjct: 170 ELVAASMTIKYWNDTINSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTI 229

Query: 311 MAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTA 370
           + I ++ G     GY+G KYW++PG+F G T   +FKG+                  ++A
Sbjct: 230 LGIVLSCGGGPQGGYLGGKYWHNPGSFVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSA 289

Query: 371 AEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVLA 429
           AE  +PR+ IP AAK+  +                VPY+  +L+ GSSS   ++SP V+A
Sbjct: 290 AESKDPRRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVIA 349

Query: 430 ASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLR 489
               G+  +   +NA+IL+S++SVANSA Y+ SR ++ +A +G  P+   ++D+ GRP+ 
Sbjct: 350 IENGGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVN 409

Query: 490 SMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSL 549
           ++L         F A S K+ +VFTWL A+SGLS IF W AI +SHIRFR+ M+ Q +SL
Sbjct: 410 AILFTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSL 469

Query: 550 GELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALY 609
            EL + +QTGV GS+Y  I+LFL L+  FW +L P+     DAE+FFQ YL+ PIL+A Y
Sbjct: 470 DELPYLSQTGVWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACY 529

Query: 610 VGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           VG KL  R  ++ +  +++D+ + R   D  + RQE +E +E L     + R +  WC
Sbjct: 530 VGHKLVYRKKQIVVALEDMDIDTGRRQVDLTIRRQEMKEEQEHLAKSSFFARFLHVWC 587

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  367 bits (941), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 222/608 (36%), Positives = 329/608 (54%), Gaps = 23/608 (3%)

Query: 73  VKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSN---LHIRDDE- 128
           +K E + + +D FK A +P      A EN  E+ +   F  +L +K  +   L  +D   
Sbjct: 6   LKKEYWADVVDGFKPATSP------AFENEKESTT---FVTELTSKTDSAFPLSSKDSPG 56

Query: 129 LDYATVNVDS-------QPVEQQD-ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPL 180
           ++  T ++ S       +  EQ+D  N  L + +  RH++ ++                L
Sbjct: 57  INQTTNDITSSDRFRRNEDTEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAAL 116

Query: 181 AQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVY 240
           +  GPA LVI + I+ TCL+ +I + GEL+ A+  V G FN +    ++P F FAV   Y
Sbjct: 117 STGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGG-FNVYSMRFIEPSFAFAVNLNY 175

Query: 241 CIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCC 300
             QWL + PLELV +S+TIKYW  K++ D                  K + E EF  +  
Sbjct: 176 LAQWLVLLPLELVAASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMI 235

Query: 301 KVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXX 360
           K++ +IGF I+ I ++ G     GYIG KYW+DPGAF G +   +FKG+           
Sbjct: 236 KILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHSSGTQFKGLCSVFVTAAFSY 295

Query: 361 XXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSG 419
                  ++AAE  NPR+ IP AAK+  +                VP N  +L+ GSSS 
Sbjct: 296 SGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSV 355

Query: 420 GNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFD 479
             ++SP V+A    G+  +   +NA+IL++V+SVANSA Y+ SR ++ +A +G  PK+ +
Sbjct: 356 DAASSPLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLN 415

Query: 480 YVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFR 539
            VD+ GRP+ ++L         F A S K+ +VFTWL A+SGLS IF W AI +SHIRFR
Sbjct: 416 RVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFR 475

Query: 540 RGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNY 599
           + M+VQ RSL EL F +QTGV GS+Y  I+LFL L+A FW +L P+      AE+FF+ Y
Sbjct: 476 QAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGGSGASAESFFEGY 535

Query: 600 LAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKW 659
           L+ PIL+  YVG KL+ R++ L ++ +++DL + R   D  L R+E    +E L      
Sbjct: 536 LSFPILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVDLTLRREEMRIERETLAKRSFV 595

Query: 660 KRVVDFWC 667
            R + FWC
Sbjct: 596 TRFLHFWC 603

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  366 bits (939), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 215/587 (36%), Positives = 303/587 (51%), Gaps = 12/587 (2%)

Query: 82  LDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPV 141
           LDSFK AET   SS            M    ++  + K       +E  +A  NV+S   
Sbjct: 12  LDSFKPAETYKQSSRN---------DMSPLTSEAPDFKKADAASGNE-SWALENVESTSG 61

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
               E+++  + +  RH++ ++                L   GP  LVI + I+ TCL+ 
Sbjct: 62  TSDAEDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFT 121

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
           I+ A GEL+  +  V G FN + S  V+P F FAV   Y  QW  + PLELV +S+TI+Y
Sbjct: 122 IVNALGELSSTFPVVGG-FNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRY 180

Query: 262 WTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAG 321
           W + ++ D                  K + E EF  +  K++ +IGF I+ I +  G   
Sbjct: 181 WNSTINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGP 240

Query: 322 TDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIP 381
             GYIG KYW++PGAF G T  +RF G+                  ++AAE  NPR  +P
Sbjct: 241 EGGYIGGKYWSNPGAFVGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLP 300

Query: 382 SAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVLAASLHGVHVVQH 440
            A K+  +                VP +  +L+ GSSS   +ASP V+A    G+  +  
Sbjct: 301 KACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPS 360

Query: 441 FINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXX 500
            +NA+IL++VLSVANSA Y+ SR +  +A++G  PK F YVDR GRPL ++L        
Sbjct: 361 LMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLL 420

Query: 501 XFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGV 560
            F A S K+  VFTWL A+SGLS +F WFAI VSHIRFR  M+ +GRSL EL F + TGV
Sbjct: 421 SFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSMTGV 480

Query: 561 LGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFR 620
            GSYY  +++F+ LV  FW AL P       AE+FF+ YL+ PILL  Y+G KL+ + +R
Sbjct: 481 WGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTKSWR 540

Query: 621 LFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           L      ID+ S R   D E+L+ E    ++ +R      R +  WC
Sbjct: 541 LLTPTTEIDIDSGRRAVDIEVLKDEKRMEEQAMREKSYLTRFLHLWC 587

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  365 bits (938), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 201/529 (37%), Positives = 293/529 (55%), Gaps = 3/529 (0%)

Query: 141 VEQQD-ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCL 199
           V+Q+D  N  L + +  RH++ ++                L+  GPA LVI + I+ TCL
Sbjct: 76  VQQEDINNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTCL 135

Query: 200 YCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTI 259
           + +I + GEL+ A+  V G FN +    V+P F FAV   Y  QWL + PLELV +S+TI
Sbjct: 136 FTVINSLGELSAAFPVVGG-FNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITI 194

Query: 260 KYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGA 319
           KYW  K++ D                  K + E EF  +  K++ +IGF I+ I ++ G 
Sbjct: 195 KYWNDKINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLSCGG 254

Query: 320 AGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKA 379
               GYIG KYWNDPGAF G     +FKG+                  ++AAE  NPR+ 
Sbjct: 255 GPHGGYIGGKYWNDPGAFVGHDSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 380 IPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVLAASLHGVHVV 438
           IP AAK+  +                VP N  +L+ GSSS   ++SP V+A     +  +
Sbjct: 315 IPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGL 374

Query: 439 QHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXX 498
              +NA+IL++V+SVANSA Y+ SR ++ +A +G  PK+   VD+ GRP+ +++      
Sbjct: 375 PSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFFG 434

Query: 499 XXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQT 558
              F A S K+ +VFTWL A+SGLS IF W AI +SHIRFR+ M+ Q RSL EL F +QT
Sbjct: 435 LLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDELPFISQT 494

Query: 559 GVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRD 618
           GV GS Y  ++LFL L+A FW ++ P+ +   +AE+FF+ YL+ PIL+  Y G K++ RD
Sbjct: 495 GVWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILIVCYFGHKIYTRD 554

Query: 619 FRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +RL ++ +++DL + R   D  L RQE +  +E L       R +  WC
Sbjct: 555 WRLLVKLEDMDLDTGRKQVDLNLRRQEMKIEQETLAKRSFLTRFLRVWC 603

>KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn
          Length = 556

 Score =  363 bits (931), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 193/520 (37%), Positives = 290/520 (55%), Gaps = 7/520 (1%)

Query: 149 QLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGE 208
           +LKQ+IKP HV MMS                +A AG    ++GY I+G  L C +Q  GE
Sbjct: 36  ELKQSIKPFHVFMMSTATGIGTGLLVGNGRSIAIAGVGGTLVGYLIIGIMLTCCMQTVGE 95

Query: 209 LAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDP 268
           L VA+  + G F ++    +DP   F ++W++ + W  V PLE+  +SMTI +W   ++P
Sbjct: 96  LVVAFPSMPGGFTSYGKRFIDPSVGFTISWLFFLNWTVVLPLEICVASMTINFWNENINP 155

Query: 269 DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGA 328
                            GA+ YA+A+  FNC KV+M++GF I+ I +NTG  GT GY+G 
Sbjct: 156 SIVVALCYSLVCGVNFFGARCYADADCIFNCLKVLMILGFIILGIFVNTGVVGTSGYLGF 215

Query: 329 KYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSN---PRKAIPSAAK 385
           KY++ PG FR    +  FK +                  L+ AEQ+    PR +I  A+ 
Sbjct: 216 KYFHSPGFFRNDEGL--FKSIAATLITACFSTGGTEFVALSCAEQNTEDMPR-SIKRASI 272

Query: 386 KVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAV 445
           +V  R               VP+NS  LMGS S    ASPYV+A + +GV ++ H +NA+
Sbjct: 273 QVVVRIAIIFCVSLMIIGLLVPFNSPYLMGSGSELTHASPYVVALTTNGVRIIPHIVNAI 332

Query: 446 ILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCAT 505
           ILLS++SVAN+A YSSSR L  LA+ G+A K+F  +D +G+P R +          F A 
Sbjct: 333 ILLSIISVANNAMYSSSRTLHSLAEQGFAMKYFCKLDESGKPFRCLCVSAFTGLFSFIAE 392

Query: 506 SPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYY 565
              +  VF WLL+ISGLS IFTW   CVSH+RFR+ M+ Q ++L +LG+++  GV GSY 
Sbjct: 393 YKDQETVFVWLLSISGLSTIFTWSMTCVSHLRFRKAMKDQDQALDQLGYQSPCGVYGSYI 452

Query: 566 AAIMLFLALVAQFWVALVPMNTH-TLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIR 624
           +  +  + L+ QFWV+L P+ ++  L+  +F QNY+A+PI + LY+G K +  +++ FIR
Sbjct: 453 SLFICAIILIVQFWVSLFPLESNGRLNVVSFLQNYMAVPITIVLYLGHKAYTGNWKPFIR 512

Query: 625 AKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVD 664
           A  ID+ + R I+  + +  +   + E L +G    ++ D
Sbjct: 513 APEIDIQTDRDIYCVDEVTGKKSVFVELLDSGDMCSKLSD 552

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  364 bits (934), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 200/539 (37%), Positives = 291/539 (53%), Gaps = 7/539 (1%)

Query: 135 NVDSQPVEQ-----QDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLV 189
           N+++ P EQ     +D N  L + +  RH+I ++                LA  GPA LV
Sbjct: 72  NIETTPSEQFSIAKEDINENLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLV 131

Query: 190 IGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCP 249
           I + I+ TCL+ +I A GELA AY  V G FN + +  VDP   FA+   Y  QWL + P
Sbjct: 132 IDWVIISTCLFTVINALGELAAAYPVVGG-FNVYITRFVDPSVAFAINLNYLAQWLVLLP 190

Query: 250 LELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFF 309
           LELV +S+TIKYW   ++ D                  K + E EF  +  K++ +IGF 
Sbjct: 191 LELVAASITIKYWNDTINSDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFT 250

Query: 310 IMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLT 369
           I+ I +  G     G++G  YW+DPG+F G     +FKG+                  ++
Sbjct: 251 ILGIVLACGGGPQGGFLGGHYWHDPGSFVGDKPGTQFKGLCSVFVTAAFSYSGIELTAVS 310

Query: 370 AAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVL 428
           AAE  +PRK IP A K+  +                VP++  +L+ GSSS   +ASP V+
Sbjct: 311 AAESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAASPLVI 370

Query: 429 AASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPL 488
           +    G+  +   +NA+IL+S++SVANSA Y+ SR ++ +A +G  PK    VD+ GRP+
Sbjct: 371 SIKNAGIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPV 430

Query: 489 RSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRS 548
            ++L         F A S K+ +VFTWL A+SGLS IF W AI  SHIRFR  M+VQ ++
Sbjct: 431 NAILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKT 490

Query: 549 LGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLAL 608
           L EL + +Q GV+GS+Y  I+LFL LVA FW +L P+ + T D  +FF+ YL++PIL+A 
Sbjct: 491 LDELPYLSQCGVIGSWYGVIVLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIAC 550

Query: 609 YVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           YVG KL+ R+ ++ ++ +++DL + R   D    R E    K  L      KR    WC
Sbjct: 551 YVGHKLYVRNLQVLVKLEDMDLETGRKHIDAHEHRAEILAEKAALSQKSFIKRFWHVWC 609

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  363 bits (933), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 221/596 (37%), Positives = 312/596 (52%), Gaps = 41/596 (6%)

Query: 73  VKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYA 132
           +   R+RN+LDSFKR E                  ++E D +L                 
Sbjct: 49  IDKSRWRNFLDSFKRIE------------------VEEVDPNL----------------- 73

Query: 133 TVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGY 192
               D + +  +   + L+  +K RH+ M++                L  AGPA ++IG+
Sbjct: 74  ---TDIEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGW 130

Query: 193 GIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLEL 252
           GI GT ++ ++ A GELAV +  V+G F T+ +  +D  F FA  + Y  QWL   PLE+
Sbjct: 131 GITGTMIFTMVMALGELAVVF-PVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEI 189

Query: 253 VTSSMTIKYWTTKVD-PDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIM 311
           V +S+T+ YW T V   D                G +GY EAEF F+  KV+ +IGF I+
Sbjct: 190 VAASITVDYWETPVRYTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIIL 249

Query: 312 AICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAA 371
            I +  G     GY+G +YW+DPGAF G +   RFKG                   + +A
Sbjct: 250 GIILVCGGGPVGGYVGGRYWHDPGAFAGHSPGRRFKGFCSVFVTAAFSFAGSELVGIASA 309

Query: 372 EQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAAS 431
           E  NPRK++P AAK+V +R               VPY   +L+GSS    SASP+V+A  
Sbjct: 310 ESKNPRKSVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVIAIV 369

Query: 432 LHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
            HG+  +   +N VIL+SVLSV NS+ Y+ SR L+ L++ G+ PK   Y+DR GRPL  +
Sbjct: 370 THGISGLPSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGI 429

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
                     F A S K+  +F WLLAISG+S   TW +IC  HIRFR  ++V GRS  E
Sbjct: 430 AICSGFGLIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDE 489

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVG 611
           L F++  G++GSY+   +  L LVAQF+ AL P+ +   +A +FF  YLA PI+LA Y+ 
Sbjct: 490 LPFKSPVGIIGSYWGMCLAVLMLVAQFYNALFPIGSSP-NAYDFFSAYLAAPIVLAFYIA 548

Query: 612 FKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            KLW+R+++L I  K+ID+ + R   D  LL+QE  E K  L   P W RV  FWC
Sbjct: 549 HKLWKRNWKLLIPLKDIDIDTGRRETDINLLKQEIAEEKAALAMRPWWYRVYVFWC 604

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  363 bits (931), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 206/546 (37%), Positives = 299/546 (54%), Gaps = 10/546 (1%)

Query: 125 RDDELDYATVNVDS-QPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQA 183
           R+ +LD    N+ S +        + LK+ +K RH+ M++                L   
Sbjct: 58  REYKLDDVDPNLSSTERAAIATARSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIG 117

Query: 184 GPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQ 243
           GPA +++ + + G+ +Y ++QA GEL VA   V+GS+ ++ S  +DP F FA+A+ Y + 
Sbjct: 118 GPAAVILAWILTGSMVYSVVQAIGELCVAL-PVSGSYLSYVSRFIDPSFGFAIAYNYLVG 176

Query: 244 WLCVCPLELVTSSMTIKYWTTKVD-PDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKV 302
            L   PLE+V +S+T+ YW       D                G KGY EAEF F+  KV
Sbjct: 177 NLVTMPLEIVAASITVDYWNVDHKYADGFVALFYVTVLLINFLGVKGYGEAEFVFSIIKV 236

Query: 303 MMMIGFFIMAICINTGAAGTD-GYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXX 361
           + ++GF I+ I +  G    + GYIG KYW++PG F        FKG             
Sbjct: 237 LAIVGFIILGIVLVCGGGSNNTGYIGTKYWHNPGGFA-----HGFKGFAAIFVTSAFSFS 291

Query: 362 XXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGN 421
                 L AAE  NPR+ +P AAK+V +R               VPY +  L  SSS   
Sbjct: 292 GSEMFALGAAESKNPRRDLPKAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDA 351

Query: 422 SASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYV 481
           SASP+V+A    G+  +   IN VIL++VLSV N+  ++SSR  L LA  GY PK F YV
Sbjct: 352 SASPFVIAIKEAGISGLPSVINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYV 411

Query: 482 DRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRG 541
           DR GRPL  ++         F ++S  +  VF W+LA+SGL   FTW +ICV H+RFR+G
Sbjct: 412 DRKGRPLAGLILSMVFGLLSFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQG 471

Query: 542 MQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLA 601
           ++ QGRS  EL F+AQTG+ GS Y   ++ + L  QFWVAL P+ + +  A +FF+ YL+
Sbjct: 472 LRAQGRSTDELAFKAQTGIWGSIYGITLISVVLCFQFWVALFPL-SKSPSAYHFFEQYLS 530

Query: 602 MPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKR 661
           +P+++  Y+G K++ R++RL I AK +DL + R   D ELL+QE +E  E +R+ P W R
Sbjct: 531 LPVVIVFYMGHKVYSRNWRLVIPAKELDLDTGRREVDLELLKQEIKEENESIRSRPIWYR 590

Query: 662 VVDFWC 667
           +  FWC
Sbjct: 591 IYRFWC 596

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  359 bits (922), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 206/598 (34%), Positives = 318/598 (53%), Gaps = 9/598 (1%)

Query: 71  PQVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELD 130
           P V +E+ +N++     +   N   S A +    N S  +  +  ++ K +   R D +D
Sbjct: 11  PSVIDEKNKNYI-----SNQENVVESGASQEDYSNSSYPKSGSKWKDFKDSFK-RMDSVD 64

Query: 131 YATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVI 190
                 D+Q +      + L++ +K RH+ M++                L  AGPA ++I
Sbjct: 65  LDPNLTDAQKIAILTSQSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILI 124

Query: 191 GYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPL 250
           G+G+M T + C+  + GE+AV +  V+G + T+ +  +D  + FA    Y +Q L V PL
Sbjct: 125 GWGLMATMILCMCLSLGEMAVTF-PVSGGYTTYATRFIDESYGFANNINYMMQALVVLPL 183

Query: 251 ELVTSSMTIKYWTTKVDPDXXXXXXX-XXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFF 309
           E+V +S+T+ YW  K                     G KGY EAEF F+  KV+ +IGF 
Sbjct: 184 EIVAASITVDYWGPKSQYRAAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFI 243

Query: 310 IMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLT 369
           I+ + +  G   T  YIG+K+W++PGAF G T  ++FKG+                  L 
Sbjct: 244 ILGVILVCGGGPTHEYIGSKFWSNPGAFVGDTAGQKFKGICSVFVTAAFSFANTELVGLA 303

Query: 370 AAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLA 429
           AAE  +PRK++P AAK+V +R               VPY   +L+GSS    +ASP+VLA
Sbjct: 304 AAETEDPRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLA 363

Query: 430 ASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLR 489
              HG+  +   IN VIL +VLSV NS+ +S SR L  L++ G+ P  F Y+DR GRPL 
Sbjct: 364 LKNHGIKGLPSVINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLV 423

Query: 490 SMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSL 549
           S++         F A S +  ++F W+L++SGLS +F W  I + HIRFR+ +  Q RS+
Sbjct: 424 SIIFSSAFGLLCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSI 483

Query: 550 GELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALY 609
            EL F +  G+ GSYY+  ++ + L+ QFW+AL P +     A NFF+ YL+MPI +A+Y
Sbjct: 484 DELAFASPIGIWGSYYSVFLIIVVLILQFWIALFPGHQKP-SASNFFKAYLSMPIAVAMY 542

Query: 610 VGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +G K++ ++++L I  K +D+ + R   D EL +QE  E    +   P   RV +FWC
Sbjct: 543 LGHKIYTKNWKLLIDPKYMDIDTGRRELDIELFKQELLEQNAIMAKKPFIYRVYNFWC 600

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  360 bits (924), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 213/598 (35%), Positives = 311/598 (52%), Gaps = 24/598 (4%)

Query: 71  PQVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELD 130
           PQ K+  +   L+ FKRA+    + S AD            D +++ K      R  E+ 
Sbjct: 52  PQ-KDVWYTRLLNDFKRADEGETTRSVADS-----------DMEVDGK------RYKEM- 92

Query: 131 YATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVI 190
               +V+    +    ++QL + +  RH++ ++                L   GP  ++I
Sbjct: 93  ---TDVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILI 149

Query: 191 GYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPL 250
            + ++ TCL+ I+ + GELA A+  V G FN + +  V+P F FAV   Y  QW  + PL
Sbjct: 150 AWTLISTCLFTIVNSLGELASAFPVVGG-FNVYITRFVEPSFGFAVNISYLAQWAVLLPL 208

Query: 251 ELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFI 310
           EL  +S+TIKYW  K++ D                  K + E EF  +  K++ + GF I
Sbjct: 209 ELAAASITIKYWNNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAI 268

Query: 311 MAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTA 370
           +   +  G     G+IGAKYW+DPGAF G T   +FKG+                  ++A
Sbjct: 269 LGTVLICGGGPVGGFIGAKYWHDPGAFVGDTPGAQFKGLCSVFVTAAFSYSGTELVGVSA 328

Query: 371 AEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVLA 429
           AE  NPR  IP A+K+  +                VP N  +L+ G SS   +ASP V+A
Sbjct: 329 AESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAASPLVIA 388

Query: 430 ASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLR 489
               G+  V   +NA+IL++++SVANS+ Y+ SR ++ +AQVG  PK F+Y+DR GRPL 
Sbjct: 389 IENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLV 448

Query: 490 SMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSL 549
           ++L         F A S K+  +FTWL A+SGLS +F WFAI +SHIRFRR M  Q RSL
Sbjct: 449 AILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRSL 508

Query: 550 GELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALY 609
            EL + + TGVLGS+Y A +L   LV  FW +L P  +    AE+FF+ YL+ PI L  Y
Sbjct: 509 DELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEGYLSFPIFLICY 568

Query: 610 VGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +  KL++RD+RLFI A  ID+ S R   D E L+++    + +    P + R   FWC
Sbjct: 569 ISHKLYKRDWRLFIPAGQIDVDSGRRALDIEELKEQKLREQAETAKKPFYVRWWIFWC 626

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  359 bits (921), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 219/635 (34%), Positives = 329/635 (51%), Gaps = 41/635 (6%)

Query: 73  VKNERFRNWLDSFKRAETPNASS----STADENAVEN---YSMQ----------EFDNDL 115
           +  E + N  D FK  + P++      ST  +  ++N   YS+Q           FDN+ 
Sbjct: 25  ITKEYWSNVFDDFKLDDQPSSKDRKNLSTTSQQELKNGEIYSLQSNLDFQDGTNHFDNET 84

Query: 116 E-------NKKSNLHIRDDELDYATVNVDSQP-----------VEQQDENAQL----KQT 153
           +        K  N+++ +D+L ++    D +               +DE   L     + 
Sbjct: 85  QIDIVSPDYKNENINVDEDKLPFSDDIRDVKDRSDFSSSFVSSARDKDEETLLATDMNKD 144

Query: 154 IKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAY 213
           +  RH++ ++                L   GPA LVIG+ I+ T L+ +I + GELA A+
Sbjct: 145 LSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLGELAAAF 204

Query: 214 SKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXX 273
             V G F+ +    VDP F FAV   Y +QWL + PLELV +S+TI+YW + ++ D    
Sbjct: 205 PVVGG-FSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYWNSSINSDAWVS 263

Query: 274 XXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWND 333
                         K + E EF  +  K++ +IGFFI+ I ++ G   +  YIG KYW+D
Sbjct: 264 IFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGGKYWHD 323

Query: 334 PGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXX 393
           PGAF G T   +FKG+                  ++AAE  NPR+ IP AAK+  +    
Sbjct: 324 PGAFVGTTSGSKFKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPKAAKRTFWLITG 383

Query: 394 XXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLS 452
                       VPYN  +LM GSSS   ++SP V+A     +H +   +NA+IL+++LS
Sbjct: 384 SYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENGHIHGLPSLMNAIILIAILS 443

Query: 453 VANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDV 512
           VANS+ Y+ SR ++ ++++   PK F  VDR GRP+ ++          F A S K+ +V
Sbjct: 444 VANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLSFVAASDKQAEV 503

Query: 513 FTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFL 572
           FTWL A+SGLS IF W  I + HIRFR+GM VQ  SL EL F +QTG+ GS Y  ++LFL
Sbjct: 504 FTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIWGSIYGIVILFL 563

Query: 573 ALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLIS 632
            LVA FW +L P+ +   +A +FF+ YL+ PILL  Y+  K++ +++R +I A  +DL S
Sbjct: 564 VLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKNWRWYIPASKMDLHS 623

Query: 633 HRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            R   D E++R+E    KE L     + R +  WC
Sbjct: 624 GRKQVDLEVVREELRLEKEHLAQRSFFYRFLHVWC 658

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  356 bits (914), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 207/532 (38%), Positives = 297/532 (55%), Gaps = 3/532 (0%)

Query: 137 DSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMG 196
           D++ +      + LK T+K RH+ M++                L  AGPA ++IG+ + G
Sbjct: 74  DAEKIAIATARSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTG 133

Query: 197 TCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSS 256
           T +Y ++ A GELAV +  V+G F T+ +  +D  F FA+ + Y +QWL   PLE+V++S
Sbjct: 134 TMIYSMVMAVGELAVVF-PVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSAS 192

Query: 257 MTIKYWTTKVD-PDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICI 315
           +T+ YW       D                G KGY EAEF F   KV+ +IGF IMA+ +
Sbjct: 193 ITVNYWGVDAKYRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVIL 252

Query: 316 NTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSN 375
             G     GYIGAKYW+ PGAF G T  ++FKG                   +  +E  N
Sbjct: 253 ICGGGPVGGYIGAKYWHHPGAFVGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESEN 312

Query: 376 PRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGV 435
           PRK++P AAK+V +R               VPYN  +L+G+SS   +ASP+V+A    G+
Sbjct: 313 PRKSVPGAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVIAVVNQGI 372

Query: 436 HVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXX 495
             +   IN VIL+SVLSV NS+ Y  SR L  LA+ G+ PK   Y+DRNGRPL ++    
Sbjct: 373 RGLPSVINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIAS 432

Query: 496 XXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFR 555
                 F A S  E +VF WLLA+SGLS +F+W AIC+ HIRFRR +  QGRS  EL F 
Sbjct: 433 AFGLIAFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFV 492

Query: 556 AQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLW 615
           +  G+ GSY+   +  L L+AQF+V L P      +A++FF  YL+ PI+LA Y+  K+W
Sbjct: 493 STVGIAGSYWGIFICVLMLIAQFYVGLFPAGASP-NAKDFFMAYLSFPIVLAFYIFHKIW 551

Query: 616 RRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +++++L+I+A+++D+ + R   D +LL+QE    +  L   P W R   FWC
Sbjct: 552 KKNWKLYIKAEDMDIDTGRREVDRDLLKQEVAAERADLAARPIWYRCWKFWC 603

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  355 bits (911), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 214/589 (36%), Positives = 306/589 (51%), Gaps = 26/589 (4%)

Query: 98  ADENAVENYSMQ-EFDNDLENKKSNLHIRDDELDYATVNVDS---QPVEQQDEN------ 147
           A + AVE  S   E D + +  K  +H+ D         VD      +E  D N      
Sbjct: 20  AIKTAVEELSPDVESDQNHDYYKDKVHVNDPNKSRFQNFVDGFRELRMEDVDPNLTAAER 79

Query: 148 -------AQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLY 200
                  + LK+ +K RH+ M++                L   GPA +VI + + G+ +Y
Sbjct: 80  AAIATASSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVY 139

Query: 201 CIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIK 260
            ++QA GELAVA   V+GS+ ++ S  ++P F FA+A+ Y I  L   PLEL+ +S+T+ 
Sbjct: 140 SVVQALGELAVAL-PVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVN 198

Query: 261 YWTTKVD-PDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGA 319
           YW       D                G KGY EAEF F+  KV  ++GF I+ I +  G 
Sbjct: 199 YWDVDSKYADAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGG 258

Query: 320 AGTD-GYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRK 378
             +D GYIGA+YW +PG F        FKG                   L AAE  NPRK
Sbjct: 259 GPSDEGYIGARYWYNPGGFA-----HGFKGFAAIFVTSAFSFAGSEMFALAAAETENPRK 313

Query: 379 AIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVV 438
            +P AAK+V +R               VPY    L  +SS   SASP+V+A +  G+  +
Sbjct: 314 DLPRAAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGL 373

Query: 439 QHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXX 498
              +N VIL++VLSV N   Y++SR +L LA  G+ P+ F YVDR GRPL  +L      
Sbjct: 374 PSVVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFG 433

Query: 499 XXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQT 558
              F + S    +VF W+LAISGL+  F W +ICV H+RFRR + VQGRS  EL ++AQT
Sbjct: 434 LLSFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQT 493

Query: 559 GVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRD 618
           G+ GS Y   ++F+ L  QFWVAL P+     +A +FF  YL++P+++  Y   KL+ R 
Sbjct: 494 GIWGSLYGIGLIFIVLCFQFWVALFPIGGSP-NANHFFSAYLSLPVVIFFYTCHKLYTRS 552

Query: 619 FRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +   I++ +ID+ + R   D ELL+QE +E ++ +R+ P W R+  FWC
Sbjct: 553 WTFLIKSSDIDIDTGRREMDLELLKQEIQEEQQYIRSKPIWYRIYRFWC 601

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  352 bits (902), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 210/588 (35%), Positives = 311/588 (52%), Gaps = 17/588 (2%)

Query: 89  ETPNASSSTADENAVENYSMQEFDN------DLENKKSNLHIRDDELDYATVNVDSQPVE 142
           E    S S+   N   N++++E D+       L++K  +  I+    D+A+V      + 
Sbjct: 13  EMITGSKSSEAGNIDANFALEEKDSTLSPLASLDSKVPHEKIQTTT-DFASV------IS 65

Query: 143 QQDE--NAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLY 200
            +D+  N  L + +  RH++ ++                LA  GPA LVI + I+ TCL+
Sbjct: 66  HEDDINNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLF 125

Query: 201 CIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIK 260
            +I A GE+A A+  V G FN + +  +DP   FAV   Y  QWL + PLELV +SMTIK
Sbjct: 126 TVINALGEMAAAFPVVGG-FNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIK 184

Query: 261 YWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAA 320
           YW   ++ D                  K + E EF  +  K++ +IGF I+ I +  G  
Sbjct: 185 YWNETINSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGG 244

Query: 321 GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAI 380
              G+IG KYWN PG+F G     +FKG+                  ++AAE  +PR  I
Sbjct: 245 PHGGFIGGKYWNHPGSFVGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTI 304

Query: 381 PSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVLAASLHGVHVVQ 439
           P AAK+  +                VPY+  +L+ G+SS   ++SP V+A    G+  + 
Sbjct: 305 PKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLP 364

Query: 440 HFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXX 499
             +NA+IL+S++SVANSA Y+ SR ++ +A +G  P+  + VD  GRP+ +++       
Sbjct: 365 SLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGL 424

Query: 500 XXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTG 559
             F A S ++ DVFTWL A+SGLS IF W AI +SHIRFR+ M  Q RSL EL F +QTG
Sbjct: 425 LSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTG 484

Query: 560 VLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDF 619
           V GS+Y  I+LFL LVA FW +L P+   + DAE+FF+ YL+ PILLA Y G KL+ R  
Sbjct: 485 VWGSWYGTIVLFLVLVASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKR 544

Query: 620 RLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
              +   ++DL + R   D ++ R+E    +E+L     +K  +  WC
Sbjct: 545 EFMVGLADMDLDTGRRQVDLDVRREELRREREELAKQSFFKSFLHVWC 592

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  351 bits (901), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/605 (32%), Positives = 317/605 (52%), Gaps = 24/605 (3%)

Query: 67  SKFLPQVKNERFRNW---LDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLH 123
           +K   +V+    ++W     SFKR E         +   VE+ +   +D  +  KK    
Sbjct: 4   TKLESEVETSISKSWTKLFSSFKRME---------EVEVVESLTKSNYDVQVMGKKY--- 51

Query: 124 IRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQA 183
              +++D    +V+         +  L + +  RH++ ++                L   
Sbjct: 52  ---EDMD----DVEKAIFNTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIG 104

Query: 184 GPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQ 243
           GPA LVI + I+ TCL+ I+ A GELA  +  V G FN + + LVDP   FAV   Y  Q
Sbjct: 105 GPASLVIAWTIISTCLFTIVNALGELAAVFPVVGG-FNVYVTRLVDPSLGFAVNINYLAQ 163

Query: 244 WLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVM 303
           W  + PLELV +S+TI+YW   V+ D                  K + E EF  +  K++
Sbjct: 164 WAVLLPLELVAASITIRYWNNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKIL 223

Query: 304 MMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXX 363
            + GF I+ I +  G    +GYIGAKYWNDPG+F G +   +FKG+              
Sbjct: 224 AIGGFTILGIVLICGGGPKNGYIGAKYWNDPGSFVGASPGSQFKGLCSVFVTAAFSYSGT 283

Query: 364 XXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGN-S 422
               ++AAE +NPR  +P A+K+  +                V ++  +L+ +SS  + +
Sbjct: 284 ELVGVSAAESANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVA 343

Query: 423 ASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVD 482
           ASP V+A    G+  +   +NA+IL++++SVANS+ Y+ SR ++ +A++G  P+ F Y+D
Sbjct: 344 ASPLVIAIENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYID 403

Query: 483 RNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGM 542
             GRP+ +++         F A S K+ ++F WL A+SGLS +F W AI +SHIRFRR +
Sbjct: 404 NRGRPIVAIIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRAL 463

Query: 543 QVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAM 602
             QG SL EL + + TGV+GS+Y  +++ L L+A FW +L P  +   D E+FF+ YL++
Sbjct: 464 NTQGYSLDELPYLSMTGVIGSWYGCVVIILVLIASFWTSLFPAGSSGADWESFFKGYLSL 523

Query: 603 PILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRV 662
           PI L  +VG KL++R++   IR+  ID+ + R + D+E L +E +E+ E +       ++
Sbjct: 524 PIFLFCFVGHKLYKRNWSWMIRSNKIDVNTGRRMIDKEELEKEKQEFNEYMARKSFIAKL 583

Query: 663 VDFWC 667
            + WC
Sbjct: 584 WNLWC 588

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  351 bits (900), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 218/551 (39%), Positives = 300/551 (54%), Gaps = 13/551 (2%)

Query: 123 HIRDDELDYATVNVDSQ--PVEQQ---DENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXX 177
             +D   +  TV++D    P E+      NA LK+T+K RH+ M+               
Sbjct: 44  RFKDSFREAETVDLDPSLTPAEKMAILTANAPLKRTLKSRHLQMIGIGGAIGTGLFVGSG 103

Query: 178 XPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVA 237
             LA AGPA ++IG+ + GT +YC++ A GELAV +  V G + T+ S  VD  F FA  
Sbjct: 104 KSLATAGPAGILIGWALTGTMIYCMVMAMGELAVTF-PVAGGYTTYASRFVDESFGFAFN 162

Query: 238 WVYCIQWLCVCPLELVTSSMTIKYWTTKVD-PDXXXXXXXXXXXXXXXXGAKGYAEAEFF 296
            VY + WL   PLE+V +S+T+ YW T     D                G KGY EAEF 
Sbjct: 163 TVYAMGWLITLPLEIVAASITVNYWGTPAKYRDAFVALFYVVIVGINLFGVKGYGEAEFI 222

Query: 297 FNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXX 356
           F+  KV+ +IGF I+ + +  G     GYIG + W++PGAF        FKGV       
Sbjct: 223 FSFIKVIAVIGFIILGVILVCGGGPQGGYIGGRLWHNPGAFA-----NGFKGVCSVFVTA 277

Query: 357 XXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGS 416
                      L AAE +NPRK+IPSAAK+V +R               VPY SD+L+G 
Sbjct: 278 AFSFAGSELVGLAAAETANPRKSIPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQ 337

Query: 417 SSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPK 476
           SS   +ASP+V++    G+  +   IN VIL++VLSV N A +  SR +  LA  G  PK
Sbjct: 338 SSVDAAASPFVISIQNAGIKGLPSVINVVILIAVLSVGNCAVFGCSRSMAALANQGSLPK 397

Query: 477 WFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHI 536
            F Y+DR GRPL  ++         F A SPKE +VF WLLA+SGLS +FTW  I + HI
Sbjct: 398 IFGYIDRTGRPLVGIVVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHI 457

Query: 537 RFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFF 596
           R RR +  Q R+  EL F A T V GS Y+ I++ L L+AQFW+AL P+      A  FF
Sbjct: 458 RVRRALAAQNRTTAELSFTAPTDVWGSVYSLILIILILIAQFWIALFPIGGKP-SAAAFF 516

Query: 597 QNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNG 656
           + YL+ PI +  Y+G K+W+++++LFI+A +ID+ S R   D E L+QE  E K  + + 
Sbjct: 517 EAYLSFPIYIVFYIGHKIWKKNWKLFIKASDIDIDSGRRETDIEALKQEIAEEKAFIASK 576

Query: 657 PKWKRVVDFWC 667
           P + R+  FWC
Sbjct: 577 PFYYRMYKFWC 587

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  349 bits (896), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 202/552 (36%), Positives = 296/552 (53%), Gaps = 6/552 (1%)

Query: 117 NKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXX 176
           N+KS     +D +D  +       V ++D N  L + +  RH++ ++             
Sbjct: 49  NEKSKDSPIEDNIDITS----QSSVTKEDINKSLNKDLSIRHLLTLAVGGAIGVGLFVNS 104

Query: 177 XXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAV 236
              LA  GPA LVI + I+ TCL+ +I + GELA A+  V G FN + +  VDP F FAV
Sbjct: 105 GAALASGGPASLVIDWVIISTCLFTVINSLGELAAAFPVVGG-FNVYITRFVDPSFAFAV 163

Query: 237 AWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFF 296
              Y  QWL + PLELV +S+TIKYW + ++ D                  K + E EF 
Sbjct: 164 NLNYLAQWLVLLPLELVAASITIKYWNSTINSDAWVAIFYTVITLANMLDVKSFGETEFV 223

Query: 297 FNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXX 356
            +  K++ +IGF I+ I ++ G     GY+G KYW++PGAF G T   +FKG+       
Sbjct: 224 LSMVKILAIIGFTILGIVLSCGGGPKGGYLGGKYWHNPGAFVGHTSGTKFKGLCSVFVTA 283

Query: 357 XXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-G 415
                      ++AAE  +PRK IP AAK+  +                VPY+  +LM G
Sbjct: 284 AFSYSGIEMTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSG 343

Query: 416 SSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAP 475
           +SS   +ASP V+A    G+  +   +NA+IL+S++SVANSA Y+ SR ++ +A +G  P
Sbjct: 344 TSSVDAAASPLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLP 403

Query: 476 KWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSH 535
           K    VD+ GRP+ + L         F A S K+ +VFTWL A+SGLS IF W AI +SH
Sbjct: 404 KKLGKVDKRGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISH 463

Query: 536 IRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENF 595
           IRFR+ M  Q RSL E+ + +QTGV GS Y  ++LFL LVA FW +L P+   + D ++F
Sbjct: 464 IRFRQAMIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSF 523

Query: 596 FQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRN 655
           F+ YL++PIL+  Y+G KL+ +++   +  + +DL + R   D  L R E    +  +  
Sbjct: 524 FEGYLSLPILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALDPHLHRAEVIAEEAAVAK 583

Query: 656 GPKWKRVVDFWC 667
               KR    WC
Sbjct: 584 MSFIKRFWHVWC 595

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  347 bits (890), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 191/538 (35%), Positives = 289/538 (53%), Gaps = 10/538 (1%)

Query: 137 DSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMG 196
           +++ +  +   A L + +K RH+ M++                LA AGPA ++IG+G+  
Sbjct: 70  EAEKLAIRTAAAPLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTA 129

Query: 197 TCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSS 256
           T +  +  + GELAV +  V+G + T+ +  +D  + FA  + Y +Q + V PLE+V +S
Sbjct: 130 TMILIMCLSLGELAVTF-PVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAAS 188

Query: 257 MTIKYWTTKVDPDXXXXXXX---XXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAI 313
           +T+ YW T  DP                    G +G+ EAE  F+  KV+ +IGF IM +
Sbjct: 189 VTVGYWDT--DPKYKLAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGV 246

Query: 314 CINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQ 373
            + +G       IG KYWNDPG F G    ++FKGV                  L AAE 
Sbjct: 247 VLISGGGPDHEVIGGKYWNDPGPFVGNAPSDKFKGVCSVFVTAAFSFAGSELIGLAAAET 306

Query: 374 SNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLH 433
             PRK+IP AAK+V +R               VP N++ L+       + SP+V+A  +H
Sbjct: 307 REPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVIAMDMH 366

Query: 434 GVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLC 493
            + V+   IN VIL +V+SV NS+ YSSSR +  LA+ G+ PK F Y+DR GRPL ++  
Sbjct: 367 RIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICF 426

Query: 494 XXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELG 553
                   F A + +E ++F WLLAISGLS  FTW  I ++H+RFR  ++ QGR+  EL 
Sbjct: 427 TSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELS 486

Query: 554 FRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAEN----FFQNYLAMPILLALY 609
           F + TG +GS YA  ++ + LVAQFWVAL P +     A+     FF+ YL+  + + +Y
Sbjct: 487 FTSPTGFIGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMY 546

Query: 610 VGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +  K+W R+++ FI+AK +D+ + R   D EL ++E  + +  L   P   RV +FWC
Sbjct: 547 LAHKIWSRNWKFFIKAKEMDIDTGRRELDLELFKEELAQERALLAQKPFIIRVFNFWC 604

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  342 bits (877), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/531 (37%), Positives = 289/531 (54%), Gaps = 15/531 (2%)

Query: 91  PNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQL 150
           P+  S+ + E A      Q+F +  +        R + +       +++ V        L
Sbjct: 35  PSNGSAASAEEAGSGSKWQDFKDSFK--------RVEPIAVDPNLTEAEKVAIVTAQTPL 86

Query: 151 KQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELA 210
           K  +K RH+ M++                L   GPA L+IG+G  GT +Y ++ A GELA
Sbjct: 87  KHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGELA 146

Query: 211 VAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDP-- 268
           V +  ++G F T+ +  +D  F +A  + Y +QWL V PLE+V++S+T+ +W T  DP  
Sbjct: 147 VIF-PISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGT--DPKY 203

Query: 269 -DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIG 327
            D                G KGY EAEF F+  KV+ ++GF I+ I +N G     GYIG
Sbjct: 204 RDGFVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIG 263

Query: 328 AKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKV 387
            KYW+DPGAF G T   +FKGV                  L A+E   PRK++P AAK+V
Sbjct: 264 GKYWHDPGAFAGDTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVPKAAKQV 323

Query: 388 AYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVIL 447
            +R               VPYN   L+G+SS   +ASP+V+A   HG+  +   +N VIL
Sbjct: 324 FWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVIL 383

Query: 448 LSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSP 507
           ++VLSV NSA Y+ SR ++ LA+  + P+ F YVDR GRPL  +          F A S 
Sbjct: 384 IAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIAFVAASK 443

Query: 508 KETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAA 567
           KE DVF WLLA+SGLS +FTW  IC+ HIRFR+ +  QGR L EL F++ TGV GSY+  
Sbjct: 444 KEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVWGSYWGL 503

Query: 568 IMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRD 618
            M+ +  +AQF+VAL P+      AE FF+ YL+ P+++A+Y+G K+++R+
Sbjct: 504 FMVVIMFIAQFYVALFPVGGSP-SAEGFFEAYLSFPLVMAMYIGHKIYKRN 553

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  339 bits (869), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/483 (38%), Positives = 267/483 (55%), Gaps = 2/483 (0%)

Query: 149 QLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGE 208
            L + +  RH++ ++                L   GPA L+IG+ I+ + L+ +I A GE
Sbjct: 77  NLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGE 136

Query: 209 LAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDP 268
           LA  +  V G FN + +  VDP F FAV   Y I W+   PLELV +S+TI+YW  +++ 
Sbjct: 137 LAATFPIVGG-FNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYWNREINS 195

Query: 269 DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGA 328
           D                  K ++EAEF  +  K++ ++GFFI+ I +  G   T GYIG 
Sbjct: 196 DAWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGG 255

Query: 329 KYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVA 388
           KYWNDPGAF G +   RFKG+                  ++AAE  NPRK IP A K+  
Sbjct: 256 KYWNDPGAFHGDSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKATKRTF 315

Query: 389 YRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVLAASLHGVHVVQHFINAVIL 447
           +                VPYN  +L+ GSSS   SASP V+A    G+  +   +NA+IL
Sbjct: 316 WVITFSYISILTLIGILVPYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMNAIIL 375

Query: 448 LSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSP 507
           +++LSVANS  Y  SR+++ +A     PK F  VD+ GRPL S+          F A S 
Sbjct: 376 IALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIAASD 435

Query: 508 KETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAA 567
           K+ +VFTWL AI GLS IF W  I ++HIRFR  ++ Q RSL EL + +Q+G+ GS+Y  
Sbjct: 436 KQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGSWYGV 495

Query: 568 IMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKN 627
           I+L L L+A FWV+L P+   + DAE FF+ YL+ PIL+A Y+G K++ ++++  I  + 
Sbjct: 496 IILVLVLIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVIPLEE 555

Query: 628 IDL 630
           ID+
Sbjct: 556 IDI 558

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  334 bits (857), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 187/535 (34%), Positives = 283/535 (52%), Gaps = 17/535 (3%)

Query: 140 PVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCL 199
           P++   +   LK+++K RH+IM++                +A  GP  +VIG+ I G+ +
Sbjct: 75  PLDGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQI 134

Query: 200 YCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTI 259
              I   GE+ V +  V G+F  + +  +DP  +F ++ +Y IQW  V PLE+++S+MT+
Sbjct: 135 IGTIHGLGEITVRFPVV-GAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTV 193

Query: 260 KYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGA 319
           +YW   +DP                 GA+G+ EAEF F+  KV+ + GF I+ I +  G 
Sbjct: 194 QYWNQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGG 253

Query: 320 AGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKA 379
                ++GAKYW+DPG          F GV+                 L + E ++P K 
Sbjct: 254 GPDHDFVGAKYWHDPGCLA-----HGFPGVLSVLVVASYSLGGTEMVCLASGE-TDP-KE 306

Query: 380 IPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQ 439
           +PSA K+  +R               VPY ++ L+G SS  NS  P+V+A  LH + V+ 
Sbjct: 307 LPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSSVNNS--PFVIAIKLHQIKVLP 364

Query: 440 HFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXX 499
             +NAVIL+S+LSV NS  ++SSR L  +A  G  P++F Y+DR GRPL  ++       
Sbjct: 365 SIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGL 424

Query: 500 XXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTG 559
             F   S   ++VF WL+AI+GL+    W +I +SHIRFR  M+ QGRSL EL F +  G
Sbjct: 425 LAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVG 484

Query: 560 VLGSYYAAIMLFLALVAQFWVALVPMN---THTLDAENFFQNYLAMPILLALYVGFKLWR 616
           + GS Y+A++  L LVAQF+ AL P+      ++ A+ FFQ+YL   I++ L+VG K++ 
Sbjct: 485 IWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIFY 544

Query: 617 R----DFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           R     +   +    IDL + R   D E+L+QE  E    LR  P + R   FWC
Sbjct: 545 RYKTGKWWSMLPLNKIDLETDRKNIDIEILKQEIAERNRHLRASPWYVRWYHFWC 599

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  332 bits (850), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 199/600 (33%), Positives = 305/600 (50%), Gaps = 38/600 (6%)

Query: 94  SSSTADENAVENY--SMQEFDNDLENKKSNLHIRDDELDYATVNVDSQ------------ 139
           S ST D ++   Y  S  EF   +E+   N  I D+ + + T++  S+            
Sbjct: 5   SLSTQDVSSDIKYKSSKNEFITIIESDNKN--IDDNFIPHDTLSTISRKEKKPPIYRRII 62

Query: 140 -----PVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGI 194
                P +       LK+++K RH+IM++                LA  GP  ++IG+ +
Sbjct: 63  DSFKPPEDGSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAV 122

Query: 195 MGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 254
            G+ +   I   GE+ V +  V G+F ++ +  +DP  +F V+ +Y +QW  V PLE++ 
Sbjct: 123 AGSQIVGTIHGLGEITVRFPVV-GAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIA 181

Query: 255 SSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAIC 314
           S++T++YW   +DP                 GA+G+ EAEF F+  K++ + GF I+ I 
Sbjct: 182 SAITVQYWNDSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIV 241

Query: 315 INTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQS 374
           +  G      YIGAKYW++PG+         FKGV+                 L + E +
Sbjct: 242 LIAGGGPDHEYIGAKYWHNPGSLA-----HGFKGVLSVLVVASYSLGGTEMTCLASGE-T 295

Query: 375 NPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHG 434
           +P K +PSA K+V +R               VPY +  L+G SS  NS  P+V+A  +H 
Sbjct: 296 DP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSSVDNS--PFVIAIKIHN 352

Query: 435 VHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCX 494
           + V+   +NAVIL+S+LSV NS  ++SSR L  +A     P WF Y+DR GRPL  ++  
Sbjct: 353 IKVLPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGIIIN 412

Query: 495 XXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGF 554
                  F   S   T+VF WL+AI+GL+    W +I + H+RFR  M+ Q R+L EL F
Sbjct: 413 SLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDELEF 472

Query: 555 RAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHT---LDAENFFQNYLAMPILLALYVG 611
            +  G+ GS Y+ I+  L LVAQF++AL P+   T     A+ FFQNYL   IL+ L++G
Sbjct: 473 VSAVGIWGSVYSGIVNALILVAQFYIALWPIGGWTDSGTRAKKFFQNYLCALILIVLFIG 532

Query: 612 FKLWRR----DFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            K++ R     +  +I  K+IDL + R   D E+++QE  E K  L + P + R    WC
Sbjct: 533 HKIYYRVTTGHWWEYIALKDIDLDTDRKNVDIEIIKQEIHEKKMYLASKPWYVRQFHVWC 592

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  330 bits (846), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 199/587 (33%), Positives = 300/587 (51%), Gaps = 22/587 (3%)

Query: 92  NASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVN--VDS--QPVEQQDEN 147
           ++S+ T  ++ +   S  E+  +   K S L+   +E     V   +DS   PV+   + 
Sbjct: 17  SSSTETCSDSKLNTKSHNEYTYE-SGKCSLLNGSTEERKRNVVQRVIDSFKPPVDGSFDP 75

Query: 148 AQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACG 207
           + +K+ +K RH+IM++                LA  GP  L+IG+ + GT +   I   G
Sbjct: 76  SNMKRALKSRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIGTIHGLG 135

Query: 208 ELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVD 267
           EL V    V G+F  + +  +DP  +F ++ +Y +QW  V PLE++ S +T+++WT  VD
Sbjct: 136 ELTVRLPVV-GAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFWTQSVD 194

Query: 268 PDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIG 327
           P                 G +G+ EAEF F+  KV+ + GF I+ I +  G   T  Y+G
Sbjct: 195 PIIWVALFYTMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPTHQYVG 254

Query: 328 AKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKV 387
           ++YW+DPG          FKGV                  L + E ++P K +P A K++
Sbjct: 255 SRYWHDPGPLA-----NGFKGVAAVMVTASYSLGGSEMTCLASGE-TDP-KELPHAIKQI 307

Query: 388 AYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVIL 447
            +R               VPY ++ L+G SS  NS  P+VLA  LH V VV H +N VIL
Sbjct: 308 FWRILFFFLVSLTLVGFLVPYTNENLLGGSSAENS--PFVLALYLHHVKVVPHIVNGVIL 365

Query: 448 LSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSP 507
           +S+LSV NS  ++SSR L  +A  G  P  F YVDR GRPL  +L         F     
Sbjct: 366 VSILSVGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFGLLAFLVKFS 425

Query: 508 KETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAA 567
             ++VF+WL+AI+GL+    W +I VSH+RFR  M+ Q +SL EL F +  GV GS YA 
Sbjct: 426 SISNVFSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSVGVWGSVYAG 485

Query: 568 IMLFLALVAQFWVALVPM---NTHTLDAENFFQNYLAMPILLALYVGFKLWRR----DFR 620
           ++ FL LVAQF++AL P+         AE FF+NYL   IL+A++   K + R     + 
Sbjct: 486 VLNFLTLVAQFYIALWPVEGWKDSKSRAEAFFKNYLCALILIAMFAAHKCYFRITTGKWW 545

Query: 621 LFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
              +   +DL + R+  D E++++E  E K+ LRN   + R   +WC
Sbjct: 546 GIKKLSEVDLDTGRVNIDIEIIKEEVAERKKFLRNKAWYTRYYYYWC 592

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  327 bits (838), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 192/556 (34%), Positives = 292/556 (52%), Gaps = 24/556 (4%)

Query: 126 DDELDYATVN-----VDS--QPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXX 178
           DD+  Y   N     VDS   P++   + + LK+T+KPRH+IM++               
Sbjct: 47  DDDGQYNNRNIFQRCVDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGK 106

Query: 179 PLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAW 238
            +A+ GP  +V+G+ I G+ +   +   GE+ V +  V G+F  + +  +DP  +F V+ 
Sbjct: 107 AIAEGGPLGVVLGWTIAGSQIIGTVHGLGEITVRFPVV-GAFANYGTRFLDPSISFVVST 165

Query: 239 VYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFN 298
           +Y +QW  V PLE++ ++MT++YW + +DP                 GA+G+ EAEF F+
Sbjct: 166 IYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGARGFGEAEFAFS 225

Query: 299 CCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXX 358
             K + + GF I+ I +  G      +IGAKYW+DPG          F GV+        
Sbjct: 226 TVKAITVGGFIILCIVLICGGGPDHEFIGAKYWHDPGCLA-----HGFPGVLSVLVVASY 280

Query: 359 XXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSS 418
                    L + E ++P K +PSA K+V +R               VPY +  L+G SS
Sbjct: 281 SLGGIEMTCLASGE-TDP-KGLPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS 338

Query: 419 GGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWF 478
             NS  P+V+A  LH + V+   +NAVIL+SVLSV NS  ++SSR L  +A  G  P WF
Sbjct: 339 VDNS--PFVIAIKLHHIKVLPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWF 396

Query: 479 DYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRF 538
            Y+DR GRPL  ++         F   S   ++VF WL+AI+GL+    W +I +SH+RF
Sbjct: 397 GYIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRF 456

Query: 539 RRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAEN---F 595
           R  M+ QG+SL EL F +  G+ GS Y+A++  L L+AQF+ +L P+   T   E    F
Sbjct: 457 RLAMKAQGKSLDELEFVSAVGIWGSVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIF 516

Query: 596 FQNYLAMPILLALYVGFKLWRR----DFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKE 651
           FQNYL   I++ ++V  K++ R     +      K+IDL + R   D E+++QE  E K+
Sbjct: 517 FQNYLCALIMVFIFVIHKIYYRCQMGKWWGVKELKDIDLETDRKDIDIEIVKQEIAEKKK 576

Query: 652 KLRNGPKWKRVVDFWC 667
            L + P + R   FWC
Sbjct: 577 YLDSRPWYVRQFHFWC 592

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  327 bits (838), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 194/587 (33%), Positives = 294/587 (50%), Gaps = 25/587 (4%)

Query: 96  STADENAVENYSMQEFDNDLENKKSNLHIRDDELDYA--------TVNVDSQPVEQQDEN 147
           +T +  A+++Y    F    +  K +  I +    Y          ++    P++     
Sbjct: 23  TTFEPKALDSYKSSSFRTFTKQSKDDDDIAEGHSSYQPPRNIFQRCIDSFKPPLDGSFHT 82

Query: 148 AQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACG 207
             LK+T+K RH+IM++                LA  GP  L+IG+ I GT +   I   G
Sbjct: 83  HNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVGTIHGLG 142

Query: 208 ELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVD 267
           E+ V +  V G+F  + +  +DP  +F ++ +Y IQW  V PLE++ S+MTI+YW   +D
Sbjct: 143 EITVRFPVV-GAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYWNQSID 201

Query: 268 PDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIG 327
           P                 GA+G+ EAEF F+  KV+ +IGF I+ I +  G      ++G
Sbjct: 202 PVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPDHDFVG 261

Query: 328 AKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKV 387
           A+YW+DPG          F GV+                 L + E +NPR+ +PSA K+ 
Sbjct: 262 ARYWHDPGCLS-----HGFPGVLSVLVVASYSLGGTEMVCLASGE-TNPRE-LPSAIKQT 314

Query: 388 AYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVIL 447
            +R               VPY +  L+G SS  NS  P+V+A  LH +  +   +NAVIL
Sbjct: 315 FWRILFFFLISLTLIGFLVPYTNPNLLGGSSVNNS--PFVIAIKLHHIKALPSIVNAVIL 372

Query: 448 LSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSP 507
           +S++SV NS  ++SSR L  +A  G  PK+F Y+DR GRPL  +L         F   S 
Sbjct: 373 ISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFGLLAFLVKSS 432

Query: 508 KETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAA 567
              +VF WL+AI+GL+    W +I +SHIRFR  M+ QG+SL EL F +  G+ GS Y+A
Sbjct: 433 SMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSAVGMWGSAYSA 492

Query: 568 IMLFLALVAQFWVALVPMN---THTLDAENFFQNYLAMPILLALYVGFKLWRR----DFR 620
           ++  L L+AQF+ AL P+      +  A+ FFQ+YL   I+  L+V  K++ R     + 
Sbjct: 493 LINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLFVCHKVFYRYKTGKWW 552

Query: 621 LFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
             +    IDL + R   D ++L+QE  E    L+  P + R   FWC
Sbjct: 553 AIMDLDKIDLETDRKNIDIDVLKQEIAERNRHLQASPWYVRWYHFWC 599

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  327 bits (838), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/535 (34%), Positives = 286/535 (53%), Gaps = 17/535 (3%)

Query: 140 PVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCL 199
           P +   + + LK+T+K RH+IM++                LA  GP  ++IG+ I G+ +
Sbjct: 76  PEDGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQI 135

Query: 200 YCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTI 259
              I   GE+ V +  V G+F  + +  +DP  +F V+ +Y IQW  V PLE+++S+MT+
Sbjct: 136 IGTIHGLGEITVRFPVV-GAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTV 194

Query: 260 KYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGA 319
           +YW   +DP                 G +G+ EAEF F+  KV+ + GF ++ I +  G 
Sbjct: 195 QYWNESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGG 254

Query: 320 AGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKA 379
                Y+G++YW++PG          F GV+                 L + E ++P K 
Sbjct: 255 GPDHVYVGSRYWHNPGCLA-----NGFPGVLSVMVVASYSLGGTEMTCLASGE-TDP-KE 307

Query: 380 IPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQ 439
           +PSA K+V +R               VPY ++ L+G SS  NS  P+V+A  +H + V+ 
Sbjct: 308 LPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSSVDNS--PFVIAIKIHHIKVLP 365

Query: 440 HFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXX 499
             +NAVIL+S+LSV NS  ++SSR L  +A     P WF Y+DR GRPL  ++       
Sbjct: 366 SIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIITNSLFGL 425

Query: 500 XXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTG 559
             F   S   ++VF WL+AI+GL+    W +I VSHIRFR  M+ QGRSL EL F +  G
Sbjct: 426 LAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELEFVSAVG 485

Query: 560 VLGSYYAAIMLFLALVAQFWVALVPMN--THTLD-AENFFQNYLAMPILLALYVGFKL-- 614
           + GS Y+AI+  L LVAQF+++L P+    ++ D A+ FFQ+YL   I++ +++G K+  
Sbjct: 486 IWGSVYSAIINCLILVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIMVCIWIGHKIYY 545

Query: 615 WRRDFRL--FIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           WR+  ++  F     IDL   R   D ++L+QE  E K  L++ P + R   +WC
Sbjct: 546 WRQTGKIWAFTPLAEIDLDEGRKNIDLDVLKQEIHERKMYLKSRPWYIRFYHYWC 600

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  326 bits (836), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 192/563 (34%), Positives = 292/563 (51%), Gaps = 24/563 (4%)

Query: 112 DNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXX 171
           D+D E+   N+  R        V+    P++   + + LK+T+KPRH+IM++        
Sbjct: 48  DDDGEHSNRNIFQR-------CVDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTG 100

Query: 172 XXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPG 231
                   +A+ GP  +V+G+ I G+ +   I   GE+ V +  V G+F  + +  +DP 
Sbjct: 101 LFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRFPVV-GAFANYGTRFLDPS 159

Query: 232 FNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYA 291
            +F V+ +Y +QW  V PLE++ ++MT++YW + +DP                 GA+G+ 
Sbjct: 160 ISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVIWVAIFYAVIVCINLFGARGFG 219

Query: 292 EAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMD 351
           EAEF F+  K + + GF I++I +  G      +IGAKYW+DPG          F GV+ 
Sbjct: 220 EAEFAFSTVKAITVCGFIILSIVLICGGGPDHEFIGAKYWHDPGCLA-----NGFPGVLA 274

Query: 352 XXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSD 411
                           L + E ++P K +P A K+V +R               VPY + 
Sbjct: 275 VLVVASYSLGGIEMTCLASGE-TDP-KGLPGAIKQVFWRILFFFLASLTLVGFLVPYTNQ 332

Query: 412 QLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQV 471
            L+G SS  NS  P+V+A  LH + V+   +NAVIL+SVLSV NS  ++SSR L  +A  
Sbjct: 333 NLLGGSSVDNS--PFVIAMKLHHIKVLPTIVNAVILISVLSVGNSCIFASSRTLCSMAHQ 390

Query: 472 GYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAI 531
           G  P WF Y+DR GRPL  ++         F   S    DVF WL+AI+GL+    W +I
Sbjct: 391 GLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMADVFNWLMAIAGLATCIVWLSI 450

Query: 532 CVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLD 591
            +SHIRFR  M+ QG+SL EL F +  G+ GS Y+A++  L L+AQF+ +L P+   +  
Sbjct: 451 NLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWSSG 510

Query: 592 AEN---FFQNYLAMPILLALYVGFKLWRR----DFRLFIRAKNIDLISHRIIFDEELLRQ 644
            E    FFQNYL   I+L ++V  K++ +     +      K+IDL + R   D E+++Q
Sbjct: 511 KERAKLFFQNYLCALIMLFIFVVHKIYYKCQTGKWWGVKSLKDIDLETDRKDIDIEIIKQ 570

Query: 645 EDEEYKEKLRNGPKWKRVVDFWC 667
           E  E K  L + P + R   FWC
Sbjct: 571 EIMERKMHLDSRPWYVRQFHFWC 593

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  323 bits (828), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 187/541 (34%), Positives = 284/541 (52%), Gaps = 19/541 (3%)

Query: 136 VDS--QPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYG 193
           VDS   P++   + + LK+T+KPRH+IM++                +A+ GP  +VIG+ 
Sbjct: 62  VDSFKSPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWA 121

Query: 194 IMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELV 253
           I G+ +   I   GE+ V +  V G+F  + +  +DP  +F V+ +Y +QW  V PLE++
Sbjct: 122 IAGSQIIGTIHGLGEITVRFPVV-GAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEII 180

Query: 254 TSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAI 313
            ++MT++YW + +DP                 G +G+ EAEF F+  K + + GF I+ +
Sbjct: 181 AAAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCV 240

Query: 314 CINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQ 373
            +  G      +IGAKYW+DPG          F GV+                 L + E 
Sbjct: 241 VLICGGGPDHEFIGAKYWHDPGCLA-----NGFPGVLSVLVVASYSLGGIEMTCLASGE- 294

Query: 374 SNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLH 433
           ++P K +PSA K+V +R               VPY +  L+G SS  NS  P+V+A  LH
Sbjct: 295 TDP-KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSSVDNS--PFVIAIKLH 351

Query: 434 GVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLC 493
            +  +   +NAVIL+SVLSV NS  ++SSR L  +A  G  P WF Y+DR GRPL  ++ 
Sbjct: 352 HIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMA 411

Query: 494 XXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELG 553
                   F   S   ++VF WL+AI+GL+    W +I +SHIRFR  M+ QG+SL EL 
Sbjct: 412 NSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELE 471

Query: 554 FRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAEN---FFQNYLAMPILLALYV 610
           F +  G+ GS Y+A++  L L+AQF+ +L P+   T   E    FFQNYL   I+L +++
Sbjct: 472 FVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFIFI 531

Query: 611 GFKLWRR----DFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFW 666
             K++ +     +      K+IDL + R   D E+++QE  E K  L + P + R   FW
Sbjct: 532 VHKIYYKCQTGKWWGVKALKDIDLETDRKDIDIEIVKQEIAEKKMYLDSRPWYVRQFHFW 591

Query: 667 C 667
           C
Sbjct: 592 C 592

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  322 bits (826), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 196/541 (36%), Positives = 284/541 (52%), Gaps = 19/541 (3%)

Query: 136 VDS--QPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYG 193
           VDS   P++    +  LK+++K RH+IM++                LA  GP  L+IG+ 
Sbjct: 57  VDSFKPPLDGSFHSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWT 116

Query: 194 IMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELV 253
           + GT +   I   GE+ V +  V G+F  + +  ++P  +F V  +Y +QW  V PLE++
Sbjct: 117 VAGTQMVGTIHGLGEITVRFPVV-GAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEII 175

Query: 254 TSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAI 313
            ++MT++YW + V P                 G +G+ EAEF F+  KV+ +IGF I+ +
Sbjct: 176 AAAMTVEYWGSSVPPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCV 235

Query: 314 CINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQ 373
            +  G      ++GAKYW+DPG          FKGV                  L + E 
Sbjct: 236 VLICGGGPKHEFVGAKYWSDPGPLA-----NGFKGVAAVFVIASYSLGGTEMACLASGE- 289

Query: 374 SNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLH 433
           ++P K +PSA K+V +R               VPY ++ LMG SS  NS  P+V+A  LH
Sbjct: 290 TDP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMGGSSVDNS--PFVIAIRLH 346

Query: 434 GVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLC 493
           G+  +   +NAVIL+S+LSV NS  ++SSR L  +A  G  P+ F Y+DR GRPL  +L 
Sbjct: 347 GIKALPSVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILT 406

Query: 494 XXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELG 553
                   F   S    DVFTWL+AI+GL+    W +I VSHIRFR  M+ QG SL EL 
Sbjct: 407 NLAFGLLAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELE 466

Query: 554 FRAQTGVLGSYYAAIMLFLALVAQFWVALVPM---NTHTLDAENFFQNYLAMPILLALYV 610
           F +  GV GS Y+A +  L LVAQF+V+L P+   ++ +   ENFFQNYL   ILL L+ 
Sbjct: 467 FVSAVGVYGSVYSATINVLILVAQFYVSLWPVGGWSSPSTRTENFFQNYLCSLILLLLFA 526

Query: 611 GFKLWRR----DFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFW 666
           G K++ R     +  F   ++IDL++   + D EL + E  E + KL   P   R+   W
Sbjct: 527 GHKIYYRISTGKWWGFKALRDIDLLTDMRVTDTELSKHELHEKRVKLAQKPLIVRLYHQW 586

Query: 667 C 667
           C
Sbjct: 587 C 587

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  319 bits (817), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/556 (33%), Positives = 287/556 (51%), Gaps = 24/556 (4%)

Query: 126 DDELDYATVN-----VDS--QPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXX 178
           DD   Y+  N     VDS   P++   + + LK+T+KPRH+IM++               
Sbjct: 47  DDNHQYSNRNIFQRCVDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGK 106

Query: 179 PLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAW 238
            +A+ GP  +V+G+ I G+ +   I   GE+ V +  V G+F  + +  +DP  +F V+ 
Sbjct: 107 AIAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRFPVV-GAFANYGTRFLDPSISFVVST 165

Query: 239 VYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFN 298
           +Y +QW  V PLE++ ++MT++YW + +DP                 G +G+ EAEF F+
Sbjct: 166 IYVLQWFFVLPLEIIAAAMTVQYWNSSIDPVVWVAIFYVIIVSINLFGVRGFGEAEFAFS 225

Query: 299 CCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXX 358
             K + + GF I+ I +  G      Y+GAKYW DPG          F G++        
Sbjct: 226 TIKAITVCGFIILCIVLIFGGGPDHEYVGAKYWYDPGCLA-----NGFPGILSVLVVASY 280

Query: 359 XXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSS 418
                    L + E ++P K +PSA K+V +R               VPY +  L+G SS
Sbjct: 281 SLGGIEMTCLASGE-TDP-KGLPSAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSS 338

Query: 419 GGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWF 478
             NS  P+V+A  LH + V+   +N VIL+SVLSV NS  ++SSR L  +A  G  P WF
Sbjct: 339 VDNS--PFVIAIKLHHIKVLPSIVNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWF 396

Query: 479 DYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRF 538
            Y+DR GRPL  ++         F   S    DVF WL+AI+GL+    W +I VSHIRF
Sbjct: 397 GYIDRAGRPLVGIMANSLFGLLAFLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRF 456

Query: 539 RRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMN---THTLDAENF 595
           R  M+ QG+ L EL F +  G+ GS Y+A++  L L+AQF+ +L P+      +  A+ F
Sbjct: 457 RMAMKAQGKKLDELEFVSAVGIWGSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIF 516

Query: 596 FQNYLAMPILLALYVGFKLWRR----DFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKE 651
           FQNYL   I+L +++  K++ +     +      K+IDL + R   D E+++QE  E K 
Sbjct: 517 FQNYLCALIVLFIFIAHKIYYKCQTGQWWGIKALKDIDLETDRKNIDIEIVKQEIAEKKM 576

Query: 652 KLRNGPKWKRVVDFWC 667
            L + P + R   +WC
Sbjct: 577 YLDSCPWYVRHFHYWC 592

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  317 bits (812), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 193/590 (32%), Positives = 300/590 (50%), Gaps = 20/590 (3%)

Query: 87  RAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDS--QPVEQQ 144
           + +   A+S  ++ +AV+   +++  + LE  +     R ++       +DS   PV+  
Sbjct: 4   QKDVEKAASELSNTSAVQRV-LKKRSSVLEESRLLEESRTNKRGLVRRCIDSFKPPVDGS 62

Query: 145 DENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQ 204
            +   LK+T+K RH+IM++                LA  GP  ++IG+ + GT +   I 
Sbjct: 63  FDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIH 122

Query: 205 ACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTT 264
             GE+ V +  V G+F  + +  +DP  +F V+ +Y +QW  V PLE++ S++T+++WTT
Sbjct: 123 GLGEVTVRFPVV-GAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTT 181

Query: 265 KVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDG 324
            VDP                 G + + + +F F+  K++ + GF I+ + +  G   T  
Sbjct: 182 SVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHE 241

Query: 325 YIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAA 384
           +IGA+YW+DPGA         FKGV                  L + E ++P K IP A 
Sbjct: 242 FIGARYWHDPGALA-----NGFKGVAAVMVTASYSLGGSEMTCLASGE-TDP-KEIPHAI 294

Query: 385 KKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINA 444
           K++ +R               VPY +DQL+G S+  NS  P+V+A  +H + V+ H IN 
Sbjct: 295 KQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGGSNVNNS--PFVIAIKMHNIRVLPHIING 352

Query: 445 VILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCA 504
           VIL+S+LSV NS  ++SSR L  +A  G  P+ F YVDR GRPL  +L         F  
Sbjct: 353 VILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLLAFLV 412

Query: 505 TSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSY 564
            S     VFTWL+A++GL+    W +I VSHIRFR  M+ QG+SL EL F +  G+ GS 
Sbjct: 413 KSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVGMWGSV 472

Query: 565 YAAIMLFLALVAQFWVALVPMNTHT---LDAENFFQNYLAMPILLALYVGFKLWRRD--- 618
           Y+ +M  + LVAQF+V+L P+          E FFQNYL   ILL ++V  K++ R    
Sbjct: 473 YSGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIYYRSTTG 532

Query: 619 -FRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            +   +    IDL S R   D E+++ E    K+ +     + R   +WC
Sbjct: 533 QWWKILPLAEIDLESGRKNIDIEVVKHEVAARKKYISEQRWYIRYYHYWC 582

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  316 bits (810), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 193/589 (32%), Positives = 296/589 (50%), Gaps = 41/589 (6%)

Query: 107 SMQEFDNDLENKKSNLHIRDDELDYATVN----------------VDS--QPVEQQDENA 148
           S +EF  ++    S     D +  Y +                  VDS   PV+   + +
Sbjct: 2   STKEFKEEIHTSTSEFTKYDSQKPYYSSGESPEPVVTKRNIFQRCVDSFKPPVDGSFDTS 61

Query: 149 QLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGE 208
            LK+T+K RH+IM++                LA  GP  ++IG+ I G+ +   I   GE
Sbjct: 62  NLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVGTIHGLGE 121

Query: 209 LAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDP 268
           + V +  V G+F  + +  +DP  +F V+ +Y IQW  V PLE++ S++TI+YW + +DP
Sbjct: 122 ITVRFPVV-GAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYWNSSIDP 180

Query: 269 DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGA 328
                            GA+G+ EAEF F+  K + + GF I+ I +  G      +IGA
Sbjct: 181 VVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPDHEFIGA 240

Query: 329 KYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVA 388
           KYW+DPGA         F GV+                 L + E ++P K +PSA K+V 
Sbjct: 241 KYWHDPGALA-----HGFPGVLSVLVVASYSLGGTEMTCLASGE-TDP-KELPSAIKQVF 293

Query: 389 YRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILL 448
           +R               VPY ++ L+G SS  NS  P+V+A  LH +  +   +NAVIL+
Sbjct: 294 WRILFFFLASLTLVGFLVPYTNENLLGGSSVDNS--PFVIAIKLHHIKALPSIVNAVILI 351

Query: 449 SVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPK 508
           S+LSV NS  ++SSR L  +A  G  P++F Y+DR GRPL  ++         F   S  
Sbjct: 352 SILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGLLAFLVKSSS 411

Query: 509 ETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAI 568
            ++VF WL+AI+GL+    W +I +SHIRFR  M+ Q ++L EL F +  G+ GS Y+A+
Sbjct: 412 VSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAVGIWGSAYSAL 471

Query: 569 MLFLALVAQFWVALVPMNTHT---LDAENFFQNYLAMPILLALYVGFKLWRR-------D 618
           +  L L+AQF+++L P+   T     A+ FFQ+YL   I+L ++   K++ R       D
Sbjct: 472 INVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVYYRVSFGKWWD 531

Query: 619 FRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            +     K+IDL + R   D ++++ E  E K  L+  P   R   FWC
Sbjct: 532 VK---PLKDIDLETGRKNVDIDVIKAEIAERKMYLKKKPWIVRWYHFWC 577

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  311 bits (798), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 194/600 (32%), Positives = 303/600 (50%), Gaps = 38/600 (6%)

Query: 93  ASSSTADENAVE-NYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQD------ 145
           +S  + D N V    S  EF   + +   N+   DD+ ++A    D    E ++      
Sbjct: 4   SSWESHDNNGVSAKLSKNEFVTTIFSDNKNI---DDKYEHAESLTDYTKTENRNIFQRVI 60

Query: 146 -----------ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGI 194
                        + LK+++K RH+IM++                LA  GP  LV+G+ I
Sbjct: 61  DSFKPPANGSFHTSNLKRSLKSRHLIMIAIGGSIGTGLFIGSGQALANGGPLALVLGWSI 120

Query: 195 MGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 254
            G+ +   I   GE+ V +  V G+F  + +  +DP  +F ++ +Y +QW  V PLE+++
Sbjct: 121 AGSQIVGTIHGLGEITVRFPVV-GAFANYQTRFLDPSLSFVISTIYVLQWFFVLPLEILS 179

Query: 255 SSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAIC 314
           S++T++YW   +DP                 G +G+ EAEF F+  KV+ + GF I+ I 
Sbjct: 180 SAITVQYWNDTIDPVVFVAIFYCAIVSINLFGVRGFGEAEFVFSTIKVITVTGFIILCII 239

Query: 315 INTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQS 374
           +  G   T  +IGAKYW+DPG          F+G +                 L + E +
Sbjct: 240 LICGGGPTHEFIGAKYWHDPGCLA-----NGFRGFLSVLITASYSLGGTEMTCLASGE-T 293

Query: 375 NPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHG 434
           +P K +PSA K+V +R               VPY ++ L+G SS  NS  P+V+A  LH 
Sbjct: 294 DP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSSVDNS--PFVIAIKLHN 350

Query: 435 VHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCX 494
           + V+   +NAVIL+S+LSV NS  ++SSR L  +A  G  P WF Y+DR GRPL  ++  
Sbjct: 351 IKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLTGIVIN 410

Query: 495 XXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGF 554
                  F   S   ++VF WL+AI+GL+    W +I + HIRFR  M+ Q +++ EL F
Sbjct: 411 SLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINICHIRFRLAMKAQNKTIDELEF 470

Query: 555 RAQTGVLGSYYAAIMLFLALVAQFWVALVPMN--THTLD-AENFFQNYLAMPILLALYVG 611
            +  GV GS Y+AI+  L L+ QF+V+L P+   T + D A  FFQNYL   + L  ++ 
Sbjct: 471 VSAVGVWGSVYSAIINSLILIVQFYVSLWPIGGWTDSKDRAGKFFQNYLCAIVSLIFFIC 530

Query: 612 FKLWRR----DFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            KL+ R     +   I  K+IDL + R   D +++++E +E K+ L   P + R++  WC
Sbjct: 531 HKLYFRYKTKKWWEIIPLKDIDLDTGRKNIDIDIVKEEIKERKQYLATKPWYIRLMHHWC 590

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  306 bits (783), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 198/594 (33%), Positives = 298/594 (50%), Gaps = 43/594 (7%)

Query: 104 ENYSMQEFDNDLENKKSNLHIR-DDELDYATVNVDSQPVEQQDENA-------------- 148
           + Y M + DN L     +L ++  D +      +D    E +++N               
Sbjct: 4   DEYDMSKMDNLLSPSSGDLEMKFSDGIMSKETEIDLDKKEDKNKNIVRRMIDSFKPPLDG 63

Query: 149 -----QLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCII 203
                 LK+ +K RH+IM++                LA  GP  ++IG+ I G+ +   I
Sbjct: 64  SYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTI 123

Query: 204 QACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWT 263
              GE+ + +  V G+F  + + L+DP  +F V+ +Y  QW  V P+EL+ S+MT+++WT
Sbjct: 124 HGLGEITMRFPVV-GAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWT 182

Query: 264 TKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTD 323
           TKVDP                 G K + EAEF F+  KV+ +IGF I++I +  G     
Sbjct: 183 TKVDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDH 242

Query: 324 GYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSA 383
            +IG +YW+ PGA         FKGV                  L +AE ++P K +P A
Sbjct: 243 RFIGTEYWHHPGALA-----NGFKGVASVFVTASYSLGGSEMVCLCSAE-TDP-KELPHA 295

Query: 384 AKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFIN 443
            K+V +R               VPY ++ L+G SS  NS  P+V+A  L G+ V+   IN
Sbjct: 296 IKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSSVNNS--PFVIAIKLSGIRVLPSIIN 353

Query: 444 AVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFC 503
           AVIL+S+LSV NS  ++SSR L  +A  G  P+ F YVDR GRPL  ++         F 
Sbjct: 354 AVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAFL 413

Query: 504 ATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGS 563
             S     VF WL+AI+GL+    W +I +SHIRFR  M+ Q RSL EL F++  GV GS
Sbjct: 414 VKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSSVGVYGS 473

Query: 564 YYAAIMLFLALVAQFWVALVPMNTHTLD---AENFFQNYLAMPILLALYVGFKLWRR--- 617
            Y+A +  L L+AQF+++L P+   T      E+FF+NYL   +L+ ++V  K++ +   
Sbjct: 474 IYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTHKIYFKCST 533

Query: 618 ----DFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
               DF+       IDL + R   D E+++QE  E +  L + P + R  +FWC
Sbjct: 534 GKWFDFK---PLAEIDLETDRKNIDIEIVKQEVREREMYLASKPWYIRFYNFWC 584

>KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 599

 Score =  300 bits (767), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 192/595 (32%), Positives = 302/595 (50%), Gaps = 18/595 (3%)

Query: 82  LDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPV 141
           L+S         SS T        +  ++  + + N+ +    R D ++YA V++     
Sbjct: 14  LESVDTKAWHGESSKTLGSRLTRPFQRKQMSSRM-NRITQSFRRQDAVEYADVDLSMMDE 72

Query: 142 EQQDE----NAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGT 197
           +Q+      N  L++T+  RH++M++                L+ +GP  L+IG+ I+G 
Sbjct: 73  QQRRNYVLANQPLQKTLSQRHLMMIAIGGTLGTGLFIGIGYSLS-SGPGSLLIGFLIVGL 131

Query: 198 CLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSM 257
            ++C++Q+  ELA  Y  V+GS+    S  ++P   F VA  Y + WL   P EL+  +M
Sbjct: 132 MMFCVVQSAAELACQY-PVSGSYAVHVSRFMEPSIGFTVATNYALAWLISFPSELIGCAM 190

Query: 258 TIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINT 317
           T++YW   V+P                 G + Y EAEF+ +  KV+ ++ F I+ I +  
Sbjct: 191 TLQYWNKSVNPAVWVAIFYVFIMSLNMFGVRSYGEAEFWMSLFKVVAIVIFIIIGIVLIC 250

Query: 318 GAA-GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNP 376
           G    + GYIG KYW+DPG+F        FKG+ +                LTA+E S  
Sbjct: 251 GGGPNSTGYIGTKYWHDPGSFAKPV----FKGLCNTFVSAAFSFGGAELVVLTASE-SRK 305

Query: 377 RKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGN-SASPYVLAASLHGV 435
            +++  AAK   +R               VPY ++QL+G  +  + +ASP+V+A S  G 
Sbjct: 306 VESVSRAAKGTFWRIAIFYITTVIVIGCLVPYTNEQLLGGDNDEDITASPFVIALSGQGS 365

Query: 436 HVVQ--HFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLC 493
              +  HF+N VIL++VLSV NSA Y+SSR++  L   G  PK   YVD+ GRPL  +  
Sbjct: 366 MGTKASHFMNTVILIAVLSVCNSAVYASSRIIQALGVCGQLPKICGYVDQKGRPLVGIAI 425

Query: 494 XXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELG 553
                   F   S  E DVFTWL A+  +S  FTWF IC S +RFR  ++ QGRS  E+ 
Sbjct: 426 CGVFGLLGFLVASDNEGDVFTWLFALCSISSFFTWFCICASQVRFRFALRAQGRSSDEIA 485

Query: 554 FRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFK 613
            ++  G+ G +   ++  L +  + +V++ P+      A+ FFQ  L++PI++A+Y+G K
Sbjct: 486 HKSMLGIYGGFLGCLLNALLIAGEIYVSIFPLGGDP-SAKQFFQYCLSIPIMIAVYIGHK 544

Query: 614 LW-RRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           L+  +  R+ I A+ IDL + R I D E  + E  E KEKL + P + R+  FWC
Sbjct: 545 LFANKSKRVLIPAQEIDLETGRKIKDLEQFKHEVLEDKEKLASKPLYYRIYRFWC 599

>TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  293 bits (751), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 185/587 (31%), Positives = 295/587 (50%), Gaps = 16/587 (2%)

Query: 86  KRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQD 145
           K A+T   SSS +   +  N  M    N  +  +  L   D E++      + + ++++ 
Sbjct: 9   KFAKTEALSSSVSLNTSESNSLMGRIKNSFKRHELTLISEDQEINDVP---EQERIQRRL 65

Query: 146 ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQA 205
            +   ++ +  RH+ M++                LA +GP  L+IG+ ++GT ++C++Q+
Sbjct: 66  ASQPYQKVLDQRHLTMIAIGGTLGTGLFIGLGYSLA-SGPGALLIGFLLVGTSMFCVVQS 124

Query: 206 CGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK 265
             EL+  Y  V+GS+ T  S  VD    F V+  Y + WL   P EL+  S+TI YW   
Sbjct: 125 AAELSCQY-PVSGSYATHVSRFVDESVGFTVSTNYALAWLISFPSELIGCSITITYWNQS 183

Query: 266 VDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAA-GTDG 324
           V+P                 G +G+AE EFF +  KV+ +I F I+ I +  G    + G
Sbjct: 184 VNPAVWVAIFYIFIMGLNLFGVRGFAETEFFLSIIKVLAIIIFIIIGIVLIAGGGPDSSG 243

Query: 325 YIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAA 384
           YIG KYW+ PG+F        FK + +                LT+ E  N   +I  AA
Sbjct: 244 YIGTKYWHQPGSFAQPV----FKNLCNTFVSAAFSFGGSELVLLTSTEARNV-SSIARAA 298

Query: 385 KKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVLAASLHGVH--VVQHF 441
           K   +R               VPY  ++L+ GSSS   SASP+V+A S  G     V +F
Sbjct: 299 KGTFWRIAVFYITTVVIIGCLVPYTDERLLNGSSSEDVSASPFVIALSNSGSMGGKVANF 358

Query: 442 INAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXX 501
           +N +IL++VLSV NS  Y+SSR++  L   G  PK   ++D+ GRPL  +          
Sbjct: 359 MNVIILIAVLSVCNSCVYASSRIIQALGAAGQLPKACSFIDKKGRPLVGIAISGVFGLLG 418

Query: 502 FCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVL 561
           F     KE +VFTWL A+  +S  FTWF IC+S +RFR  ++ QGR   ++ +++  GV 
Sbjct: 419 FLVACDKEGEVFTWLFALCSISSFFTWFCICLSQVRFRMALRAQGRPKSDIAYKSMLGVY 478

Query: 562 GSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDF-R 620
           G     ++ FL +  + +VA  P+   +  A  FF+  L++PI++ +Y G + +R D+  
Sbjct: 479 GGIVGCVLNFLLIAGEIYVASSPVGGES-SARGFFEYCLSIPIMIVVYFGHRFYRNDWGN 537

Query: 621 LFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            +I+ +NIDL +   I + EL RQ+ E+ +EK+ + P + R+  FWC
Sbjct: 538 WYIKRRNIDLDTGCSIENVELFRQQREQEQEKISSRPFYYRIYRFWC 584

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  291 bits (745), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 189/597 (31%), Positives = 303/597 (50%), Gaps = 25/597 (4%)

Query: 82  LDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDE------LDYATVN 135
           +D F+  +      ST+  +   N       N+L ++  N   R+D       L Y+ ++
Sbjct: 1   MDEFESTKLSKVQFSTSVLSTPSNEG-----NNLIHRFKNSFKRNDSPAIQEGLLYSELS 55

Query: 136 VDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIM 195
            + + ++    N   K+ +  RH+ M++                LA +GPA L+IG+ ++
Sbjct: 56  -EEEKIQWDLANQPYKKVLDQRHLTMIAIGGTLGTGLFIGLGESLA-SGPASLLIGFLLV 113

Query: 196 GTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTS 255
           G  + C++Q   EL+  Y  V+GS+    S  +DP   F++   Y + WL   P ELV  
Sbjct: 114 GASMLCVVQCGAELSCQY-PVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGC 172

Query: 256 SMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICI 315
           S+TI YW   V+P                 GA+G+AE+EF+ +  K++ +  F I+ I +
Sbjct: 173 SLTISYWAPSVNPAAWVAIAFVLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIVL 232

Query: 316 NTGAA-GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQS 374
             G    + GYIG KYW+DPG+F     +  FK + +                LT+ E +
Sbjct: 233 IAGGGPDSTGYIGTKYWHDPGSF----AVPVFKNLCNTFVSAAYSFSGTEMVVLTSTE-A 287

Query: 375 NPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVLAASLH 433
               ++  AAK   +R               VPYN  +L+ GSSS   +ASP+V+A S  
Sbjct: 288 RSVSSVSRAAKGTFWRIIIFYIVTVIIIGCLVPYNDPRLISGSSSEDITASPFVIALSNT 347

Query: 434 GVH--VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
           G     V HF+NAVIL++V SV NS  Y+SSRL+ GLA  G  PK   Y+DRNGRPL  M
Sbjct: 348 GAMGTRVSHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGM 407

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
                     F   S  +  VFTWL A+  +S   TWF IC   +RFR  M+ QGRS  +
Sbjct: 408 AICGAFGLLGFLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDD 467

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVG 611
           + +R+  G+ G  +  I+  L ++ + +V+  P+ + +  A NFF+  +++PI++A+Y+G
Sbjct: 468 IIYRSTLGIYGGIFGCILNVLLVIGEIYVSAAPVGSPS-SAANFFEYCMSIPIMIAVYIG 526

Query: 612 FKLWRRDFR-LFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            +++RRD+R  +I+  +IDL S   + D E  + E +E K+ + + P + R+  F+C
Sbjct: 527 HRIYRRDWRHWYIKRMDIDLDSGHSLEDFEATKLERDEDKKYVSSKPLYYRIYRFFC 583

>KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  290 bits (742), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 185/591 (31%), Positives = 307/591 (51%), Gaps = 18/591 (3%)

Query: 82  LDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPV 141
           +D+ + +   N S ST+  +  +   ++ F N  +    + +  DDE  Y +V+   + +
Sbjct: 3   VDTKENSSLRNDSVSTSISSIKDTSLLRNFKNSFKRVDQDQNKFDDE-KYNSVDEGQKRL 61

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
             Q     L++T++ RH+ M++                LA +GP  L+IGY I+G  ++C
Sbjct: 62  VDQ----PLRKTLQQRHLTMIAIGGTLGTGLFIGLGESLA-SGPGSLLIGYIIVGIAVFC 116

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
           ++Q+  EL+  Y  V+GS+ T  +  ++  F F VA  YC+ WL   P ELV S+M I+Y
Sbjct: 117 VVQSAAELSCQY-PVSGSYATLVTRFMNESFGFTVATNYCLAWLVCFPSELVGSAMVIRY 175

Query: 262 WTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAA- 320
           W   V+                  G +GYAE EF+ +  K++ +I F I+ I +  G   
Sbjct: 176 WNDSVNSCVWIAIFWVFVMCLNLFGVEGYAETEFWLSIIKIIAIIIFIIIGIVLICGGGP 235

Query: 321 GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAI 380
            + GYIG KYW+DPG+F        FK + +                LT+AE S    +I
Sbjct: 236 NSTGYIGTKYWHDPGSFAHPV----FKSLCNTFVSAAYSFGGCEIVVLTSAE-SRKISSI 290

Query: 381 PSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGN-SASPYVLAASLHGVH--V 437
             AAK   +R               VPY  ++L+ ++S  + +ASP+V+A S  G     
Sbjct: 291 ARAAKGTFWRITIFYLVTIVIIGCLVPYTDNKLISATSSEDVTASPFVIALSNCGAMGTR 350

Query: 438 VQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXX 497
           V HF+N VIL+S +SV+NS  Y+SSR++  L  +   P    Y+DR GRPL  +      
Sbjct: 351 VSHFMNTVILVSTISVSNSCVYASSRIIQALGAMNQLPSICGYIDRRGRPLVGIAICGLF 410

Query: 498 XXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQ 557
               F   +  E  +FTWL +++ ++   TWF+IC   +RFR  ++ QGRS  E+ +++ 
Sbjct: 411 GLLGFLVAAENEAAIFTWLYSLTSVAYFVTWFSICWCQVRFRMALKRQGRSNDEIAYKSM 470

Query: 558 TGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRR 617
            G+ G Y  AI+  + ++ + ++++ P+N  +  A  FFQN L++PI+L  + G K++ +
Sbjct: 471 LGIYGGYVGAILNIVLIIGEVYISIFPLN-ESPSANIFFQNCLSIPIMLVSFFGHKIYCK 529

Query: 618 DFR-LFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            ++  F+RAK+IDL +   I D E+ + E EE KE++ + P + R+  FWC
Sbjct: 530 GWKDWFVRAKDIDLDTGNSITDFEIFKAEIEEEKERIASSPLYYRIYRFWC 580

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score =  290 bits (742), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 188/591 (31%), Positives = 299/591 (50%), Gaps = 18/591 (3%)

Query: 83  DSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVE 142
           D F + E+   S S +      + +++ + +    K S L    ++LDY  +  + + ++
Sbjct: 6   DKFSKFESEALSVSASKVQGAYSSAVRSWKDSF--KPSELSQIPEDLDYHDLT-EREKIQ 62

Query: 143 QQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCI 202
            +  N   ++ +  RH+ M++                L  +GPA L+IGY ++GT ++C+
Sbjct: 63  LRLANQPYQKVLHQRHLSMIAIGGTLGTGLFIGLGAALT-SGPAALLIGYLLVGTSMFCV 121

Query: 203 IQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYW 262
           IQ+  ELA  +  V+GS+ +  S  VD    F VA  Y + WL + P EL+  S+TI YW
Sbjct: 122 IQSAAELACQF-PVSGSYASHVSRFVDESLGFTVATNYTLAWLVLFPSELIGCSLTISYW 180

Query: 263 TTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGT 322
            + ++P                 G + +AE EF  +  KV+ +I F I+ I +  G  G 
Sbjct: 181 NSSINPAVWVSIFLVFVLWINLFGVRIFAETEFILSIIKVLAIIIFIIIGIVLIAGG-GP 239

Query: 323 D--GYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAI 380
           D  GYIG KYW+DPG F        FK +                  LT  E  N   +I
Sbjct: 240 DPGGYIGTKYWHDPGPFAKPV----FKNLCQTFVAAAFSFGGTEMVLLTGTESKNV-SSI 294

Query: 381 PSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGN-SASPYVLAASLHGVH--V 437
             AAK   YR               VPYN  +L+ +SS  + SASP+V+A S  G     
Sbjct: 295 ARAAKGTFYRIAIFYVTTVVVIGCLVPYNDPRLLSASSSEDISASPFVIALSNTGSMGAK 354

Query: 438 VQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXX 497
           V HF+NAVIL++V+SV NS  Y+SSRL+  L   G  PK F Y+DR GRPL  +      
Sbjct: 355 VSHFMNAVILVAVVSVCNSTVYASSRLIQALGTAGQLPKIFGYMDRKGRPLVGIAVSATF 414

Query: 498 XXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQ 557
               F   + K+++VFTWL A+  ++   TWF+IC++ +R+R  M+ + RSL  + +++ 
Sbjct: 415 GLLGFLVATKKQSEVFTWLFALCSVAAFVTWFSICLAQVRYRMAMRARKRSLDSIAYKSI 474

Query: 558 TGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRR 617
            G+ G     I+ FL +  + +V+  P N  +  AE FF+  L++PI++ +++G K+ R 
Sbjct: 475 LGIWGGVVGCIVNFLLVAGEVYVSAFPANAKS-SAEGFFKYTLSIPIMIVVFLGHKIHRN 533

Query: 618 DF-RLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           D+   +++ K++DL +   I D EL + + E  K  L + P + RV  FWC
Sbjct: 534 DWGNWYVKRKDMDLDTGCSIEDFELFQAQKEAEKRALASRPLYYRVYRFWC 584

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  288 bits (738), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 170/511 (33%), Positives = 258/511 (50%), Gaps = 21/511 (4%)

Query: 94  SSSTADENAVENYSMQEFDNDLENKKSNLHIRDDE-----------LDYATVNVDSQPVE 142
           SS++A  +    ++  E       K    H  DD+           L +  ++    P  
Sbjct: 10  SSNSAKTDEKSAFATTERSFVATKKHGAYHYEDDQVQPNKKAYKRNLFHRCIDSFKPPEN 69

Query: 143 QQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCI 202
              +   LK+++K RH+IM++                LA  GP  ++IG+ I GT +   
Sbjct: 70  GSFDPDSLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVGT 129

Query: 203 IQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYW 262
           I   GE+ V +  V G+F  + +  +DP  +F V+ +Y +QW  V PLE++ S+MTI++W
Sbjct: 130 IHGLGEITVRFPVV-GAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFW 188

Query: 263 TTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGT 322
            T +DP                 G +G+ EAEF F+  KV+ + GF I+ I +  G   T
Sbjct: 189 NTSIDPVVWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGPT 248

Query: 323 DGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPS 382
             Y+GA+YW+DPGA         FKGV                  L + E ++P K +PS
Sbjct: 249 HEYVGARYWHDPGALA-----HGFKGVASVFVTASYSLGGSEMACLASGE-TDP-KELPS 301

Query: 383 AAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFI 442
           A K+V +R               VPY +  L+G SS  NS  P+V+A +L+ + V+   I
Sbjct: 302 AIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSSVNNS--PFVIACNLYHIKVLPSII 359

Query: 443 NAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXF 502
           NAVIL+S++SV NS  ++SSR L  +A  G  P+ F YVDR GRPL  ++         F
Sbjct: 360 NAVILVSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLFGLLAF 419

Query: 503 CATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLG 562
              S   ++VF WL+AI+GL+    W +I VSHIRFR  M+ Q ++L EL F +  G+ G
Sbjct: 420 LVKSSSMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDELEFVSAVGIWG 479

Query: 563 SYYAAIMLFLALVAQFWVALVPMNTHTLDAE 593
           S Y+A++  L L+AQF+++L P+   T  A 
Sbjct: 480 SVYSAVVNVLILIAQFYISLWPVGGWTDSAS 510

>Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)
          Length = 583

 Score =  285 bits (730), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 185/591 (31%), Positives = 300/591 (50%), Gaps = 16/591 (2%)

Query: 82  LDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPV 141
           ++S K ++   ++S  +  +   N  +  F N    K+++     D L Y+ +  + + +
Sbjct: 4   IESNKLSKAQFSTSVISTTSNDGNNLIHRFKNSF--KRNDSSAIQDGLLYSELT-EEEKI 60

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
           +    N   K+ +  RH+ M++                LA +GPA L+IG+ ++G  + C
Sbjct: 61  QWDLANQPYKKVLSQRHLTMIAIGGTLGTGLFIGLGESLA-SGPASLLIGFLLVGASMLC 119

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
           ++Q   EL+  Y  V+GS+    S  +DP   F++   Y + WL   P ELV  S+TI Y
Sbjct: 120 VVQCGAELSCQY-PVSGSYALHASRFIDPSVGFSIGINYLLMWLISYPSELVGCSLTISY 178

Query: 262 WTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAA- 320
           W   V+P                 GA+G+AE+EF+ +  K++ +  F I+ I +  G   
Sbjct: 179 WAPSVNPAAWVAIAFVLSMLLNMFGARGFAESEFYMSIFKIVALFIFIIIGIILIAGGGP 238

Query: 321 GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAI 380
            + GYIG KYW+DPG+F        FK + +                LT+ E  N   ++
Sbjct: 239 DSTGYIGTKYWHDPGSFAPPV----FKNLCNTFVSAAYSFSGTEMVVLTSTEARNV-SSV 293

Query: 381 PSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVLAASLHGV--HV 437
             AAK   +R               VPYN  +L+ GSSS   +ASP+V+A S  G     
Sbjct: 294 SRAAKGTFWRIVIFYIVTVIIIGCLVPYNDSRLINGSSSEDITASPFVIALSNTGTMGKR 353

Query: 438 VQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXX 497
           V HF+NAVIL++V SV NS  Y+SSRL+ GLA  G  P+   Y+DRNGRPL  M      
Sbjct: 354 VSHFMNAVILIAVFSVCNSCVYASSRLIQGLATAGQLPRICAYMDRNGRPLVGMAICGAF 413

Query: 498 XXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQ 557
               F   S  +  VFTWL A+  +S   TWF IC   +RFR  M+ QGRS  ++ +R+ 
Sbjct: 414 GLLGFLVVSKNQGTVFTWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSS 473

Query: 558 TGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRR 617
            G+ G     I+  L ++ + +V+  P+ + +  A NFF+  +++PI++A+Y+G +++R+
Sbjct: 474 LGIYGGIVGCILNVLLVIGEIYVSAAPVGSPS-SAANFFEYCMSIPIMIAVYIGHRIYRK 532

Query: 618 DFR-LFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           D+R  +I+ ++IDL S   + D E  + E +  K  + + P + R+  F+C
Sbjct: 533 DWRHWYIKRRDIDLDSGHSLEDFEATKLERDHDKRYVASRPLYYRIYRFFC 583

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  274 bits (701), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 166/487 (34%), Positives = 243/487 (49%), Gaps = 18/487 (3%)

Query: 90  TPNASSSTADENAVENY-SMQEF-DNDLENKKS----NLHIRDDELDYATVNVDS--QPV 141
           +P+       E+ +E Y S QE   +D   K +     +  R    +     VDS   P 
Sbjct: 5   SPSKYYDKGIESHLEAYASGQEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDSFKPPE 64

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
           +    +  LK+++K RH++M++                LA  GP  L+IG+ I GT +  
Sbjct: 65  DGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVG 124

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
            I   GE+ V +  V G+F  + +  ++P  +F V  +Y +QW  V PLE++ ++MT++Y
Sbjct: 125 TIHGLGEITVRFPVV-GAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEY 183

Query: 262 WTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAG 321
           W T V P                 G +G+ EAEF F+  KV+ ++GF I+ I +  G   
Sbjct: 184 WDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGP 243

Query: 322 TDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIP 381
              ++GAKYW+DPG          FKGV                  L + E ++P K +P
Sbjct: 244 KKEFVGAKYWHDPGPLA-----NGFKGVAGVLVIASYSLGGTEMACLASGE-TDP-KELP 296

Query: 382 SAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHF 441
           SA K+V +R               VPY +  LMG SS  NS  P+V+A  LHG++ +   
Sbjct: 297 SAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSSVDNS--PFVIAIRLHGINALPSI 354

Query: 442 INAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXX 501
           +NAVIL+S+LSV NS  ++SSR L  +A  G  P+ F Y+DR GRPL  +L         
Sbjct: 355 VNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLA 414

Query: 502 FCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVL 561
           F   S    DVFTWL+AI+GL+    W +I +SHIRFR  M+ QG  L EL F +  G+ 
Sbjct: 415 FLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVGIY 474

Query: 562 GSYYAAI 568
           GS Y+AI
Sbjct: 475 GSVYSAI 481

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  274 bits (701), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 166/487 (34%), Positives = 243/487 (49%), Gaps = 18/487 (3%)

Query: 90  TPNASSSTADENAVENY-SMQEF-DNDLENKKS----NLHIRDDELDYATVNVDS--QPV 141
           +P+       E+ +E Y S QE   +D   K +     +  R    +     VDS   P 
Sbjct: 5   SPSKYYDKGIESHLEAYASGQEIKSSDFSEKTTPENDGVRRRSTNRNVLQRMVDSFKPPE 64

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
           +    +  LK+++K RH++M++                LA  GP  L+IG+ I GT +  
Sbjct: 65  DGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVG 124

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
            I   GE+ V +  V G+F  + +  ++P  +F V  +Y +QW  V PLE++ ++MT++Y
Sbjct: 125 TIHGLGEITVRFPVV-GAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEY 183

Query: 262 WTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAG 321
           W T V P                 G +G+ EAEF F+  KV+ ++GF I+ I +  G   
Sbjct: 184 WDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGP 243

Query: 322 TDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIP 381
              ++GAKYW+DPG          FKGV                  L + E ++P K +P
Sbjct: 244 KKEFVGAKYWHDPGPLA-----NGFKGVAGVLVIASYSLGGTEMACLASGE-TDP-KELP 296

Query: 382 SAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHF 441
           SA K+V +R               VPY +  LMG SS  NS  P+V+A  LHG++ +   
Sbjct: 297 SAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSSVDNS--PFVIAIRLHGINALPSI 354

Query: 442 INAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXX 501
           +NAVIL+S+LSV NS  ++SSR L  +A  G  P+ F Y+DR GRPL  +L         
Sbjct: 355 VNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLA 414

Query: 502 FCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVL 561
           F   S    DVFTWL+AI+GL+    W +I +SHIRFR  M+ QG  L EL F +  G+ 
Sbjct: 415 FLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSGVGIY 474

Query: 562 GSYYAAI 568
           GS Y+AI
Sbjct: 475 GSVYSAI 481

>TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  276 bits (706), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 175/590 (29%), Positives = 297/590 (50%), Gaps = 16/590 (2%)

Query: 83  DSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVE 142
           D F + +T   S S + E+   + +++++ +    K+ +L    D L+Y  +  + +  +
Sbjct: 6   DKFIKNDTDTLSVSASKEHGAYSSAVRDWRDSF--KRQDLLEMPDALEYNDLT-EREKTQ 62

Query: 143 QQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCI 202
            +  +   K+ +  RH+ M+S                L  +GPA L+IGY ++G  ++C+
Sbjct: 63  LKLASQPYKKVLSQRHLTMISIGGTLGTGLFIGLGAALT-SGPAALLIGYLLVGASMFCV 121

Query: 203 IQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYW 262
           IQ+  ELA  +  V GS+++  +  VD    F V   Y + WL + P EL+  S+TI YW
Sbjct: 122 IQSASELACQF-PVTGSYSSHVTRFVDESVGFTVGTNYTLAWLVLFPSELIGCSLTISYW 180

Query: 263 TTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAA-G 321
            + ++P                 G + +AE EF  +  KV+ ++ F I+ I +  G    
Sbjct: 181 NSTINPAVWVAIFLVFVLWINLFGVRLFAETEFVLSIIKVLAIVIFIIIGIVLIAGGGQD 240

Query: 322 TDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIP 381
           + GYIG +YW+DPG F        FK + +                LT  E  N   +I 
Sbjct: 241 SGGYIGTRYWHDPGPFAKPV----FKNLCNTFVSAAFSYGGSEMVLLTGTESKNI-SSIA 295

Query: 382 SAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGN-SASPYVLAASLHGV--HVV 438
            AAK   YR               VPYN  +L+ +SS  + SASP+V+A    G     V
Sbjct: 296 RAAKGTFYRIAIFYITTVVVIGCLVPYNDPRLLNASSSEDISASPFVIALGNTGSMGSKV 355

Query: 439 QHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXX 498
            +F+NA+IL+SV+SV NS  Y+SSRL+  L   G+ P    Y+D  GRPL  +       
Sbjct: 356 SNFMNAIILVSVVSVCNSTVYASSRLIQALGAAGHLPGICGYMDMKGRPLVGIAITGAFG 415

Query: 499 XXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQT 558
              F   + K+++VFTWL A+  ++   TWF IC++ +RFR  M+ + RS   + +R+  
Sbjct: 416 LLGFLVATNKQSEVFTWLFALCSIASFVTWFCICLAQVRFRLAMKARKRSKEHIAYRSML 475

Query: 559 GVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRD 618
           G+ G     I+ FL +  + +V+  P++  +  AE FF+  L++PI++ +++G K++R D
Sbjct: 476 GIYGGIAGCIVNFLLIAGEIYVSAWPVDGKS-SAEGFFEYDLSIPIMIIVFLGHKIYRND 534

Query: 619 FR-LFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           ++  +++ +++DL +   I + EL + + E  KE L   P + R+  FWC
Sbjct: 535 WKNWYVKRRDMDLDTGCSIENLELFQSQKESEKEDLACKPLYYRIYRFWC 584

>TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  276 bits (707), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 185/576 (32%), Positives = 294/576 (51%), Gaps = 26/576 (4%)

Query: 104 ENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQL-------KQTIKP 156
            NYS   F    E  K +    D+   Y+ ++ D      +DE  Q+       K+++  
Sbjct: 43  RNYSEGTF---FERFKDSFTRVDNIEPYSELDGDKY---TKDEQIQMTLAAQPYKKSLHQ 96

Query: 157 RHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKV 216
           RH+ M++                LA +GPA L+IG+ I+GT ++C++Q+  EL+  Y  V
Sbjct: 97  RHLTMIAIGGTLGTGLFIGLGYSLA-SGPASLLIGFLIVGTSMFCVVQSAAELSCQY-PV 154

Query: 217 NGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXX 276
           +GS+ T  S  +D    F V+  Y + WL   P EL+  SMTI YW   ++P        
Sbjct: 155 SGSYATHVSRFLDESLGFTVSTNYALAWLISFPSELIGISMTISYWNDSINPCVWIAIFY 214

Query: 277 XXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAA-GTDGYIGAKYWNDPG 335
                    G KG+AE EF+ +  KV+ +I F I+ I +  G    + GYIG KYW+DPG
Sbjct: 215 VFIMILNLFGVKGFAETEFWLSLIKVIAIIIFIIVGIVLICGGGPESSGYIGTKYWHDPG 274

Query: 336 AFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXX 395
           +F        FKG+ +                LTAAE  N   AI  AAK   +R     
Sbjct: 275 SFAPPV----FKGLCNTFVSAAFSFGGSELVLLTAAESKNI-SAISRAAKGTFWRIAVFY 329

Query: 396 XXXXXXXXXXVPYNSDQLMGSSSGGN-SASPYVLA--ASLHGVHVVQHFINAVILLSVLS 452
                     VPYN  +L+G +S  + SASP+VLA  +S      + +F+N VIL++V+S
Sbjct: 330 IATVVIIGCLVPYNDRRLLGGASDEDVSASPFVLALGSSTDLGRKLSNFMNFVILIAVVS 389

Query: 453 VANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDV 512
           VANS  Y+SSR++  L   G  P    Y+D++GRPL  +          F   S  E  V
Sbjct: 390 VANSCVYASSRVIQALGSSGQLPSICGYIDKSGRPLVGIAICGVFGLLGFLVASSNERTV 449

Query: 513 FTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFL 572
           FTWL A+  +S  FTWF IC S +RFR  ++ Q RS  ++ F++  G+ G    +I+  L
Sbjct: 450 FTWLFALCSISSFFTWFCICFSQVRFRLALKKQNRSTDDIAFKSMLGIYGGILGSILNIL 509

Query: 573 ALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKN-IDLI 631
            ++ + +V+  P+   +  AE FF+N L++P++L +++  + +R+++R + ++ + IDL 
Sbjct: 510 LIMGEIYVSASPLGEPS-SAEAFFENCLSIPLMLLVFIAHRFYRKNWRDWYKSLDEIDLD 568

Query: 632 SHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +     D EL + + E+ K K+++ P + ++  FWC
Sbjct: 569 TGCSYDDIELFKHQREQIKHKIQSKPLYYKIYRFWC 604

>Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {ON}
           YPL274W (SAM3) - High affinity S-adenosylMethionine
           Permease [contig 184] FULL
          Length = 596

 Score =  276 bits (705), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 180/539 (33%), Positives = 281/539 (52%), Gaps = 22/539 (4%)

Query: 142 EQQDENAQL-----KQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMG 196
           E+Q  N +L     ++++  RH++M+S                LA +GP  L+IG+ I+G
Sbjct: 67  EEQRRNYELANQPYEKSLSQRHLMMISIGGTLGTGLFIGLGFSLA-SGPGSLLIGFLIVG 125

Query: 197 TCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSS 256
             ++C++Q+  E+A  Y  V+GSF+T  S  ++P   F V+  Y + WL   P EL+  +
Sbjct: 126 LMMFCVVQSAAEMACQY-PVSGSFSTHVSRFMEPSIGFTVSTNYALAWLISFPSELIGCA 184

Query: 257 MTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICIN 316
           +T++YW++ V+                  G +GY EAEF+ +  KV+ ++ F I+ I + 
Sbjct: 185 ITLRYWSS-VNGAVWVAIFYVFIMQLNLFGVRGYGEAEFWMSLFKVVAIVIFIIIGIVLI 243

Query: 317 TGAA-GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSN 375
            G    + GYIG KYW++PG+F        FKG+ +                LTA+E S 
Sbjct: 244 CGGGPHSSGYIGTKYWHNPGSFAKPV----FKGLCNTFISAAFSFGGAELVVLTASE-SK 298

Query: 376 PRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGN-SASPYVLAASLHG 434
             +++  AAK   +R               VPY  D+L+G  +G + +ASP+V+A S  G
Sbjct: 299 KVESVSRAAKGTFWRIAIFYITTVVVIGCLVPYTDDRLLGGDTGEDITASPFVIALSGQG 358

Query: 435 VH--VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSML 492
                V HF+NAVIL++VLSV NS  Y+SSR++  L   G  P+   Y+D+ GRPL  + 
Sbjct: 359 SMGTKVSHFMNAVILIAVLSVCNSCVYASSRVIQALGACGQLPRACGYIDKKGRPLVGIA 418

Query: 493 CXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGEL 552
                    F     K+ DVFTWL A+  +S  FTWF ICVS +RFR  ++ QGRS  E+
Sbjct: 419 ICGVFGLLGFLVACDKQDDVFTWLFALCSISSFFTWFCICVSQVRFRLALRAQGRSTDEI 478

Query: 553 GFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILL---ALY 609
             ++  G+ G     ++  L +  + +V++ P+      AE FFQ  +++PI++   AL+
Sbjct: 479 AHKSMLGIYGGILGGVLNILLIAGEIYVSIFPLGGSP-SAEQFFQYCMSIPIMIVVYALH 537

Query: 610 VGFKLWRRDF-RLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
             +K  RRD  R+ +    IDL S R I D EL + E EE K ++   P + R+  FWC
Sbjct: 538 KTYKATRRDAKRILVPLSEIDLDSGRRIQDIELFKHELEEDKARIAAKPLYYRIYRFWC 596

>SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 586

 Score =  273 bits (697), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 177/544 (32%), Positives = 274/544 (50%), Gaps = 19/544 (3%)

Query: 135 NVDSQPVEQQDENAQL------KQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPL 188
           NVD   +E  +    L      K+T+  RH+ M+S                L  +GP  L
Sbjct: 51  NVDLSQMEDYERTNYLLAHQPYKRTLSQRHLTMISIGGTLGTGLFIGLGYSLT-SGPGNL 109

Query: 189 VIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVC 248
           +IG+ I+G  ++C++Q   EL+  Y  V+GSF T  S  +D    F V+  Y + WL   
Sbjct: 110 LIGFTIIGISIFCVVQCAAELSCQY-PVSGSFATHVSRFIDSSVGFTVSTNYALAWLISF 168

Query: 249 PLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGF 308
           P EL+  ++T++YW   V+P                 G +G+AE EF+ +  K+  ++ F
Sbjct: 169 PSELIGCAITLRYWNDSVNPAVWIAIFYVFIMCLNLFGVRGFAETEFWLSLIKIAAIVIF 228

Query: 309 FIMAICINTGAA-GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXX 367
            I+ I +  G    ++GYIGAKYW+DPGAF        FKG+ +                
Sbjct: 229 IIIGIVLICGGGPHSNGYIGAKYWHDPGAFVKPV----FKGLCNTFVSAAFSFGGAELVV 284

Query: 368 LTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGN-SASPY 426
           LTA E S   ++I  AAK   +R               VP   ++L+G++S  + +ASP+
Sbjct: 285 LTANE-SRKIESISRAAKGTFWRIAVFYITTVVIIGCLVPSTDERLLGAASDVDVTASPF 343

Query: 427 VLAASLHGVH--VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRN 484
           V+A S  G     V HF+NAVIL++VLSV NS  Y++SR++  L      P +  Y+DR 
Sbjct: 344 VIALSNTGSFGDKVSHFMNAVILIAVLSVCNSCVYAASRVIQSLGASRQLPSFCGYIDRK 403

Query: 485 GRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQV 544
           GRPL  +          F   S KE +VFTWL A+  +S  FTWF IC S +RFR  ++ 
Sbjct: 404 GRPLVGIGICGVFGLLGFLVASSKEGEVFTWLFALCSISSFFTWFCICFSQVRFRLALRA 463

Query: 545 QGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPI 604
           QGRS  E+ +++  G  G     ++  L +  + +V+L P+     +AE FFQ  L++PI
Sbjct: 464 QGRSSDEIAYKSMLGFWGGVLGCVLNILLIAGEIYVSLFPLGGSP-NAEGFFQYCLSIPI 522

Query: 605 LLALYVGFKLWRRDFR-LFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVV 663
           ++ +Y   +++R ++    I  K IDL + R   D EL++ E    K ++ + P + R+ 
Sbjct: 523 MIFVYFCHRIYRNNWTDWIISTKKIDLDTGRKAEDLELMKHEILTEKARIASKPLYYRIY 582

Query: 664 DFWC 667
            FWC
Sbjct: 583 RFWC 586

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score =  271 bits (694), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 179/565 (31%), Positives = 287/565 (50%), Gaps = 16/565 (2%)

Query: 108 MQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXX 167
           ++ F N  + K ++  +  + L Y+ ++ + + V+    N   K+ +  RH+ M++    
Sbjct: 30  VRRFKNSFKRKDAS--VIQEGLLYSELS-EEEKVQWDLANQPYKKVLDQRHLTMIAIGGT 86

Query: 168 XXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFL 227
                       LA +GPA L+IG+ ++G  + C++Q   EL+  Y  V+GS+    S  
Sbjct: 87  LGTGLFIGLGESLA-SGPASLLIGFLLVGASMLCVVQCGAELSCQY-PVSGSYALHASRF 144

Query: 228 VDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGA 287
           +DP   F+V   Y + WL   P ELV  S+T+ YW   V+P                 GA
Sbjct: 145 IDPSAGFSVGINYLLMWLISFPSELVGCSLTMTYWAPSVNPAVWVAIAFTLSMLLNLFGA 204

Query: 288 KGYAEAEFFFNCCKVMMMIGFFIMAICINTGAA-GTDGYIGAKYWNDPGAFRGQTKIERF 346
           +G+AE+EF+ +  K++ +  F I+ I +  G    + GYIG KYW DPG+F        F
Sbjct: 205 RGFAESEFYMSIFKIVALFIFIIIGIILIAGGGPESTGYIGTKYWYDPGSFAPPA----F 260

Query: 347 KGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXV 406
           K   +                LT+AE  +   ++  AAK   +R               V
Sbjct: 261 KNFCNTFVSAAYSFSGTEMVVLTSAEARDV-SSVSRAAKGTFWRIAVFYIVTVIIIGCLV 319

Query: 407 PYNSDQLM-GSSSGGNSASPYVLAASLHGVH--VVQHFINAVILLSVLSVANSAFYSSSR 463
           PYN  +L+ GSSS   +ASP+V+A S  G     V  F+NAVIL++V SV NS  Y+SSR
Sbjct: 320 PYNDPRLINGSSSEDITASPFVIALSNTGAMGTRVSQFMNAVILIAVFSVCNSCVYASSR 379

Query: 464 LLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLS 523
           L+ GLA  G  PK   Y+DRNGRPL  M          F   S  +  VFTWL A+  +S
Sbjct: 380 LIQGLATAGQLPKICGYMDRNGRPLVGMAICGAFGLLGFLVVSKDQGTVFTWLFALCSIS 439

Query: 524 QIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALV 583
              TWF IC   IRFR  M+ QG+   ++ +++  G+ G      +  L ++ + +V+  
Sbjct: 440 FFTTWFCICFCQIRFRMAMKAQGKPDDDIIYKSPLGIYGGVVGCTLNVLLVIGEIYVSAA 499

Query: 584 PMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFR-LFIRAKNIDLISHRIIFDEELL 642
           P+   +  A NFF+  +++PI++A+Y+G +++RRD+R  +I+ ++IDL S   + D E  
Sbjct: 500 PVGMPS-SAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKREDIDLDSGHSLEDLEAT 558

Query: 643 RQEDEEYKEKLRNGPKWKRVVDFWC 667
           +   ++ KE + + P + R+  F+C
Sbjct: 559 KLRRDQEKEYVASRPLYYRLYRFFC 583

>KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON} 
          Length = 585

 Score =  271 bits (694), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 173/565 (30%), Positives = 290/565 (51%), Gaps = 17/565 (3%)

Query: 108 MQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXX 167
           +  F +  +    +  I +D+  Y       + V+ +     LK+ +  RH+ M++    
Sbjct: 33  LYRFRDSFKRVDLDATIDEDDSKYTA----EEKVQLRLAKQPLKKALMQRHLTMIAIGGT 88

Query: 168 XXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFL 227
                       LA +GP  L+IG+ ++G  ++C++Q+  EL+  Y  V+GS+ T  +  
Sbjct: 89  LGTGLFIGLGYSLA-SGPGCLLIGFILVGLSMFCVVQSAAELSCQY-PVSGSYATHVTRF 146

Query: 228 VDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGA 287
           +D    F V+  Y + WL   P EL+ S+M I+YW   VDP                 G 
Sbjct: 147 IDESIGFTVSTNYALAWLISFPSELMGSAMVIQYWNDSVDPAVWIAIFYLFVMFLNLFGV 206

Query: 288 KGYAEAEFFFNCCKVMMMIGFFIMAICINTGAA-GTDGYIGAKYWNDPGAFRGQTKIERF 346
           +G+AE EF+ +  K++ +I F I+ I +  G   G+ GYIG KYW++PG+F        F
Sbjct: 207 EGFAETEFWLSIIKILAIIIFIIIGIVLICGGGPGSSGYIGTKYWHNPGSFAHPV----F 262

Query: 347 KGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXV 406
           K + +                LTAAE S    AI  AAK   +R               V
Sbjct: 263 KSLCNTFVSAAFSFGGAELVLLTAAE-SKKISAISRAAKGTFWRIAVFYITTVVIIGCLV 321

Query: 407 PYNSDQLMGSSSGGN-SASPYVLAASLHGV--HVVQHFINAVILLSVLSVANSAFYSSSR 463
           PY  ++L+G+SS  + +ASP+V+A +  G     V +F+N +IL++V+SV NS  Y+SSR
Sbjct: 322 PYTDERLLGASSDEDVTASPFVIALTNAGSMGSSVANFMNVIILVAVISVCNSCVYASSR 381

Query: 464 LLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLS 523
           ++  L   G  P+   Y+D+ GRPL  ++         F     +E  VFTWL A+  +S
Sbjct: 382 VIQALGSAGQLPRICGYIDKKGRPLVGIVICGIFGLLAFLIDCSEEGTVFTWLFALCSIS 441

Query: 524 QIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALV 583
             FTWF IC S +R+R  ++ Q RS  E+ +++  G+ G    +++  L ++ + +V++ 
Sbjct: 442 SFFTWFCICFSQVRYRIALKKQNRSNDEIAYKSMLGIYGGILGSLLNILLIMGELYVSIS 501

Query: 584 PMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFR-LFIRAKNIDLISHRIIFDEELL 642
           P++  +  A  FF+N L++PI++ +Y+  K +++ +R LFI  K+IDL + R + +  L 
Sbjct: 502 PLD-ESPSASAFFENCLSIPIMIVVYIFHKTYKKGWRSLFIPLKHIDLDTGRAVENLALF 560

Query: 643 RQEDEEYKEKLRNGPKWKRVVDFWC 667
           +Q+ EE K  + + P + RV  FWC
Sbjct: 561 KQQREEQKIIIASKPFYYRVYRFWC 585

>KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} similar
           to uniprot|Q7LGU1 Saccharomyces cerevisiae YPL274W SAM3
           High-affinity S-adenosylmethionine permease, required
           for utilization of S-adenosylmethionine as a sulfur
           source; has similarity to S-methylmethionine permease
           Mmp1p
          Length = 588

 Score =  269 bits (688), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 180/587 (30%), Positives = 301/587 (51%), Gaps = 26/587 (4%)

Query: 96  STADENAVEN-YSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPV-EQQDENAQL--- 150
           +   EN  ++ Y+ ++    L  +  +   R + ++   +++D+  + + Q  N  L   
Sbjct: 13  TQVSENFTQSLYTDEDGSRSLFTRVKDSFKRQELVETEGIDLDTYSMTDYQRTNYLLAKQ 72

Query: 151 --KQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGE 208
             ++ +  RH+ M++                LA +GP  L+IG+ + G  ++C++Q   E
Sbjct: 73  PYQKNLSQRHLTMIAIGGTLGTGLFIGIGWSLA-SGPGNLLIGFLLTGLAIFCVVQCAAE 131

Query: 209 LAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDP 268
           L+  Y  V+GSF +  S  VDP + F V   YC+ W    P EL+  +MTI YW + V+P
Sbjct: 132 LSCQY-PVSGSFASHVSRFVDPSWGFTVTTNYCLAWSISFPSELIGCAMTIGYWDSSVNP 190

Query: 269 DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAIC-INTGAAGTDGYIG 327
                            G +G+AE E+  +  K++ +I F I+ +  I  G   ++GYIG
Sbjct: 191 VVWVIIFWLFIMALNLFGVRGFAETEYVLSIFKILAIIIFLIIGVVLICGGGPNSNGYIG 250

Query: 328 AKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKV 387
            KYW+DPG+F+       FK + +                LTAAE S   ++I  AAK  
Sbjct: 251 TKYWHDPGSFKAPV----FKSLCNTFVSAAFSFGGTELVVLTAAE-SRKVESISRAAKGT 305

Query: 388 AYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGN-SASPYVLAASLHGV--HVVQHFINA 444
            +R               VPY  ++L+G  +  + +ASP+V+A +  G     V +F+NA
Sbjct: 306 FWRVIVFYVSTVVVIGCLVPYTDERLLGGDTSEDIAASPFVIALANTGKFGERVSNFMNA 365

Query: 445 VILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCA 504
           VIL++VLSV NS  Y++SR++  L   G  P    YVDR GRPL  +L         F  
Sbjct: 366 VILIAVLSVCNSCVYAASRVIQSLGASGQLPSICGYVDRKGRPLFGILVVGLFGFLPFIV 425

Query: 505 TSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSY 564
            S K ++VF WL A+  +S +F WF+IC S++R+R  ++ Q RS  E+ +++  G+ G+Y
Sbjct: 426 ASNKVSEVFDWLFALCSISSMFIWFSICYSYLRYRWALKKQNRSADEIAYKSMLGIWGAY 485

Query: 565 YAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLF-I 623
              ++  L +V + +V+L P+   +  AE FF+  L++PI++A+Y+G K +  +++ F I
Sbjct: 486 LGLLLSALLIVGEIYVSLFPLG-ESPSAEAFFKYCLSIPIMIAVYIGHKSYTGNWKSFVI 544

Query: 624 RAKNIDL---ISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
               IDL   +SH    D E+++ E E  + KL + P + R+  FWC
Sbjct: 545 PLSGIDLDTGLSHS---DVEIMKHELEIQRVKLASKPLYYRIFRFWC 588

>Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W
           (REAL)
          Length = 590

 Score =  267 bits (683), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 191/598 (31%), Positives = 302/598 (50%), Gaps = 25/598 (4%)

Query: 80  NWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQ 139
           N  D F + ET +    T  E + ++ S+     D   K+SNLH+  ++L+      +S+
Sbjct: 8   NESDKFTKIETESTMIPTGLERSDKSESLIRRMKD-SFKQSNLHVIPEDLE------NSE 60

Query: 140 PVEQQDENAQL-----KQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGI 194
             EQ+    +L     ++ +  RH+ M++                LA +GPA L+IG+ I
Sbjct: 61  QTEQEKIQWKLASQPYQKVLSQRHLTMIAIGGTLGTGLFIGLGYSLA-SGPAALLIGFLI 119

Query: 195 MGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 254
           +GT ++C++Q+  EL+  +  V+GS+ T  S  +D    F VA  Y + WL   P EL+ 
Sbjct: 120 VGTSMFCVVQSAAELSCQF-PVSGSYATHVSRFIDESVGFTVATNYALAWLISFPSELIG 178

Query: 255 SSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAIC 314
            S+TI YW   V+P                 G KG+AE EF  +  KV+ +I F I+ I 
Sbjct: 179 CSLTISYWNQTVNPAVWVAIFYTFIMVLNLFGVKGFAETEFALSIIKVVAIIIFIIIGIV 238

Query: 315 INTGAA-GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQ 373
           +  G    + GYIG KYW++PGAF        FK + +                LT+ E 
Sbjct: 239 LIAGGGPNSTGYIGTKYWHNPGAFAKPV----FKNLCNTFVSAAFSFGGSELVLLTSTE- 293

Query: 374 SNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVLAASL 432
           S    AI  AAK   +R               VPYN  +L+ GS+S   SASP+V+A   
Sbjct: 294 SKDISAISRAAKGTFWRIAIFYITTVVIIGCLVPYNDSRLLSGSTSEDISASPFVIALRN 353

Query: 433 HGVH--VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRS 490
            G     V +F+N VIL++V+SV NS  Y+SSRL+  L   G  P    Y+DR GRPL  
Sbjct: 354 TGSMGAKVSNFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPSVCSYMDRKGRPLVG 413

Query: 491 MLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLG 550
           +          F   S KE +VFTWL A+  +S  FTWF IC+S +RFR  ++ QGRS  
Sbjct: 414 IGISGAFGLLGFLVASNKEDEVFTWLFALCSISSFFTWFCICLSQVRFRMALKTQGRSKD 473

Query: 551 ELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYV 610
           E+ +++  GV G     ++  L +  + +V+  P+ + +  A+ FF+  L++PI++ +Y+
Sbjct: 474 EIAYKSILGVYGGVLGCVLNALLIAGEVYVSAAPVGSPS-SAKAFFEYCLSIPIMIVVYI 532

Query: 611 GFKLWRRD-FRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
             +++R+D  R +I+   IDL +   + + EL + + E  K+ + + P + ++  FWC
Sbjct: 533 AHRIYRKDRRRWYIKRSEIDLDTGCSVENLELFKAQKEAEKQLIASKPFYYKIYRFWC 590

>YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}
           SAM3High-affinity S-adenosylmethionine permease,
           required for utilization of S-adenosylmethionine as a
           sulfur source; has similarity to S-methylmethionine
           permease Mmp1p
          Length = 587

 Score =  267 bits (682), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 191/598 (31%), Positives = 302/598 (50%), Gaps = 28/598 (4%)

Query: 80  NWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQ 139
           N  D F + ET    S+T   ++  + S+     D   K+SNLH+  ++L+      +S+
Sbjct: 8   NESDKFTKIET---ESTTIPNDSDRSGSLIRRMKD-SFKQSNLHVIPEDLE------NSE 57

Query: 140 PVEQQDENAQL-----KQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGI 194
             EQ+    +L     ++ +  RH+ M++                LA +GPA L+IG+ +
Sbjct: 58  QTEQEKIQWKLASQPYQKVLSQRHLTMIAIGGTLGTGLFIGLGYSLA-SGPAALLIGFLL 116

Query: 195 MGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 254
           +GT ++C++Q+  EL+  +  V+GS+ T  S  +D    F VA  Y + WL   P EL+ 
Sbjct: 117 VGTSMFCVVQSAAELSCQF-PVSGSYATHVSRFIDESVGFTVATNYALAWLISFPSELIG 175

Query: 255 SSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAIC 314
            ++TI YW   V+P                 G +G+AE EF  +  KV+ +  F I+ I 
Sbjct: 176 CALTISYWNQTVNPAVWVAIFYVFIMVLNLFGVRGFAETEFALSIIKVIAIFIFIIIGIV 235

Query: 315 INTGAA-GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQ 373
           +  G    + GYIGAKYW+DPGAF        FK + +                LT+ E 
Sbjct: 236 LIAGGGPNSTGYIGAKYWHDPGAFAKPV----FKNLCNTFVSAAFSFGGSELVLLTSTES 291

Query: 374 SNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVLAASL 432
            N   AI  AAK   +R               VPYN  +L+ GS+S   SASP+V+A S 
Sbjct: 292 KNI-SAISRAAKGTFWRIAIFYITTVVIIGCLVPYNDPRLLSGSNSEDVSASPFVIALSN 350

Query: 433 HGVH--VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRS 490
            G     V +F+N VIL++V+SV NS  Y+SSRL+  L   G  P    Y+DR GRPL  
Sbjct: 351 TGSMGAKVSNFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPSVCSYMDRKGRPLVG 410

Query: 491 MLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLG 550
           +          F   S KE +VFTWL A+  +S  FTWF IC+S IRFR  ++ QGRS  
Sbjct: 411 IGISGAFGLLGFLVASKKEDEVFTWLFALCSISSFFTWFCICMSQIRFRMALKAQGRSND 470

Query: 551 ELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYV 610
           E+ +++  GV G     ++  L +  + +V+  P+ + +  AE FF+  L++PI++ +Y 
Sbjct: 471 EIAYKSILGVYGGILGCVLNALLIAGEIYVSAAPVGSPS-SAEAFFEYCLSIPIMIVVYF 529

Query: 611 GFKLWRRDFR-LFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
             + +RRD++  +I+   IDL +   + + EL + + E  ++ + + P + ++  FWC
Sbjct: 530 AHRFYRRDWKHFYIKRSEIDLDTGCSVENLELFKAQKEAEEQLIASKPFYYKIYRFWC 587

>TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON} 
          Length = 587

 Score =  260 bits (664), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 184/599 (30%), Positives = 287/599 (47%), Gaps = 46/599 (7%)

Query: 74  KNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYAT 133
               FR +++SFKR            + AV   S  E+D   E +K        + D AT
Sbjct: 30  SRSHFREFMESFKR------------DGAVTVPSDLEYDELTEEEKV-------QWDLAT 70

Query: 134 VNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYG 193
                QP          K+ +  RH+ M++                LA +GP  L+IG+ 
Sbjct: 71  -----QP---------YKKVLDQRHLTMIAIGGTLGTGLFIGLGLSLA-SGPGSLLIGFM 115

Query: 194 IMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELV 253
           ++G  + C++Q   EL+  Y  V+GS+    S  +DP   F+V   Y + WL   P ELV
Sbjct: 116 LVGISMLCVVQCGAELSCQY-PVSGSYALHASRFIDPSVGFSVGMNYLLMWLVSFPSELV 174

Query: 254 TSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAI 313
             S+T+ YW   V+P                 G +G+AE EF+ +  KV+ +  F I+ I
Sbjct: 175 GCSLTLSYWNNSVNPAVWVAIFFVFVMLLNLFGVRGFAETEFYMSIFKVISLFVFIIIGI 234

Query: 314 CINTGAA-GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAE 372
            + TG   G  GYIG KYW DPG+F        FK   +                LT+ E
Sbjct: 235 VLITGGGPGNTGYIGTKYWQDPGSF----ATPAFKNFCNTFVSAAYSFSGTEMVVLTSTE 290

Query: 373 QSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVLAAS 431
             +   +I  AAK   +R               VPYN ++L+ G++S   SASP+V+A S
Sbjct: 291 VRDI-SSISRAAKGTFWRIALFYIVTVVIIGCLVPYNDERLLSGATSEDISASPFVIALS 349

Query: 432 LHGV--HVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLR 489
             G       +F+N VIL++V+SV N   Y+SSRL+ GLA  G  P    Y+DRNGRPL 
Sbjct: 350 NTGSMGSKAANFMNVVILVAVVSVCNWCVYASSRLIQGLATAGQLPSICGYMDRNGRPLV 409

Query: 490 SMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSL 549
            +          F   S  ++ VFTWL A+  +S   TWF IC   IRFR  M+ Q RS 
Sbjct: 410 GIAITGVFGLLGFLVASKDQSTVFTWLFALCSISFFTTWFCICFCQIRFRMAMKAQKRSA 469

Query: 550 GELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALY 609
            ++ + +  G+ G     ++  L +  + +V+  P+   +  AENFFQ  +++PI++ +Y
Sbjct: 470 DDIVYISPLGIYGGVLGCVLNVLLVAGEIYVSAFPVGQPS-SAENFFQYCMSIPIMIVVY 528

Query: 610 VGFKLWRRDF-RLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
           +G +++R+D+   +I+AK+ID  S   + + + ++   E+ K  + + P + +V  F+C
Sbjct: 529 LGHRIYRKDWSHWYIKAKDIDRDSGYTLAELDNIKMRKEKDKAHIASRPFYYKVYRFFC 587

>ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]
           {ON} similar to uniprot|Q7LGU1 Saccharomyces cerevisiae
           YPL274W SAM3 High-affinity S-adenosylmethionine
           permease, required for utilization of
           S-adenosylmethionine as a sulfur source; has similarity
           to S-methylmethionine permease Mmp1p
          Length = 585

 Score =  256 bits (655), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 171/537 (31%), Positives = 266/537 (49%), Gaps = 20/537 (3%)

Query: 143 QQDENAQLKQTIKP-------RHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIM 195
            + E  QLK   +P       RH+ M++                LA  GP  L+IG+ ++
Sbjct: 57  SEKEKIQLKLASQPYEKVLSQRHLTMIAIGGTLGTGLFIGLGYSLA-CGPGALLIGFLLV 115

Query: 196 GTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTS 255
           GT ++C++Q+  EL+  +  V+GS+ T  S  +D    F VA  Y + WL   P EL+  
Sbjct: 116 GTSIFCVVQSAAELSCQF-PVSGSYATHVSRFIDQSIGFTVATNYALSWLISFPSELIGC 174

Query: 256 SMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICI 315
           S+TI YW    +P                 G +G+AE EF  +  K++ +I F I+ I +
Sbjct: 175 SLTISYWDQTTNPAVWVAIFYVFIMTLNLFGVRGFAEVEFVLSVIKILAIIIFIIIGIIL 234

Query: 316 NTGAA-GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQS 374
             G    + GYIG KYW+DPG+F        FK + +                LT+ E S
Sbjct: 235 IAGGGPDSKGYIGTKYWHDPGSFNNPV----FKNLCNTFVSAAFSFGGSELVLLTSKE-S 289

Query: 375 NPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVLAASLH 433
               AI  AAK   +R               VPY  D+L+ G S    +ASP+V+A S  
Sbjct: 290 KSVSAISRAAKGTFWRIAIFYITTVVIIGCLVPYTDDRLLNGRSDEDVTASPFVIALSNT 349

Query: 434 GV--HVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSM 491
           G     V  F+N VIL++V+SV NS  Y++SR++  L   G  PK   Y+DR GRPL  +
Sbjct: 350 GSMGKKVSDFMNVVILIAVVSVCNSCVYAASRVIQALGASGQLPKICGYIDRRGRPLVGI 409

Query: 492 LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGE 551
                     F   S +E+ VFTWL A+  +S  FTWF IC S IRFR  ++ QGRS  +
Sbjct: 410 AISGIFGLLGFLVASSEESKVFTWLFALCSISSFFTWFCICYSQIRFRMALKYQGRSTDQ 469

Query: 552 LGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVG 611
           + +++  GV G     I+  L +  + +V+  P+   +  AE FF+  L++PI++++YV 
Sbjct: 470 IAYKSMLGVYGGILGCILNILLIAGEIYVSASPVGEKS-TAEGFFEYCLSIPIMISVYVL 528

Query: 612 FKLWRRDF-RLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFWC 667
            +++R+D+   +I+  +IDL +   + + EL +++ EE K      P + ++  F C
Sbjct: 529 HRIYRKDWTHWYIKRSDIDLDTGCSVENIELFKEQREEEKIYAATKPFYYKIYRFLC 585

>AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL274W
           (SAM3)
          Length = 497

 Score =  252 bits (643), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 161/491 (32%), Positives = 249/491 (50%), Gaps = 19/491 (3%)

Query: 182 QAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYC 241
           Q+GP  L+IG+ I+G  ++C+IQ+  EL+  Y  V+GSF++  S  ++P   F V+  Y 
Sbjct: 21  QSGPGTLLIGFLIVGVSIFCVIQSAAELSCQY-PVSGSFSSHVSRFIEPSLGFTVSCAYA 79

Query: 242 IQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCK 301
           + WL   P ELV  +MTI YW   + P                   +G+AE+EF+ +  K
Sbjct: 80  LSWLISFPNELVGLAMTIGYWNEDIPPAVWVLIGYLLVIGLNLFAVRGFAESEFWLSIIK 139

Query: 302 VMMMIGFFIMAICINTGAA--GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXX 359
           V+ +I F I+ I I  G      +GY+G KYW+DPGAFR       F   +         
Sbjct: 140 VLAIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAFR-----PPFFSSLCQTFVSAAF 194

Query: 360 XXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSG 419
                   L  A +S   ++I  AAK   +R               VPY S  L G S  
Sbjct: 195 TFGGAELVLLTANESRKIESISRAAKGTFWRIAIFYISTVIVIGCLVPYTSPALDGESI- 253

Query: 420 GNSASPYVLAASLHGVHV--VQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKW 477
              ASP+V+A S  G     V HF+NAVI+ +VLSV NS  Y++SR++  L   G  P+ 
Sbjct: 254 --RASPFVIALSNTGSFGTNVSHFMNAVIVAAVLSVCNSCVYAASRVIQSLGACGQLPEI 311

Query: 478 FDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIR 537
           F Y+D+ GRPL  +          F   + K  DVF WL A+  ++  F WF ICVS +R
Sbjct: 312 FGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWLFALCSIAAFFVWFCICVSQLR 371

Query: 538 FRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQ 597
           +RR ++VQG    E+ +++  G        ++ FL +  + +V++        D E FFQ
Sbjct: 372 YRRALKVQGFPTEEIAYQSMLGKWSGVIGTLLNFLLICGEIYVSV-----KDGDVETFFQ 426

Query: 598 NYLAMPILLALYVGFKLWRRDFRLF-IRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNG 656
           N +++P+L+  Y   +L+RRD++ + I A+++DL + R   D E+++ E    + ++ + 
Sbjct: 427 NCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGRKPEDLEMMKHELIVSRARIASS 486

Query: 657 PKWKRVVDFWC 667
           P + R   FWC
Sbjct: 487 PWYYRAYRFWC 497

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  251 bits (641), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 170/563 (30%), Positives = 261/563 (46%), Gaps = 25/563 (4%)

Query: 93  ASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQ 152
            S S  DE + E Y ++ F N + N +    + +D  D           E + +NA++K+
Sbjct: 37  GSLSLKDEKSKELYPLRSFPNGV-NGQDTFSMEEDIQDED---------EGEVQNAEVKR 86

Query: 153 TIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVA 212
            +K RH+ M++               PL  AGP   +I Y  MG+  Y + Q+ GE+A  
Sbjct: 87  ELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA-T 145

Query: 213 YSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXX 272
           +  V  SF  F    + P F  A  ++Y   W     LEL      I++WT  V      
Sbjct: 146 FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAVPLAAWI 205

Query: 273 XXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWN 332
                          K Y E EF+    KV+ +IGF I   C+  GA G  G +G +YW 
Sbjct: 206 SIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA-GVTGPVGFRYWR 264

Query: 333 DPGAFR----GQTKIE-RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKV 387
           +PGA+      + K E RF G +                 +TA E +NPRK +P A KKV
Sbjct: 265 NPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKV 324

Query: 388 AYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVIL 447
            +R               VPYN  +L  ++S   S SP+++A    G  V+ H  NAVIL
Sbjct: 325 VFRILTFYIGSLLFIGLLVPYNDPKLTSATSY-VSTSPFIIAIENSGTKVLPHIFNAVIL 383

Query: 448 LSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSP 507
            +++S ANS  Y  SR+L GL++   APK+F    + G P  ++          +  TS 
Sbjct: 384 TTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALAYMETST 443

Query: 508 KETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAA 567
               VF WLL I+G++  F W  I VSHIRF + ++ +G S  EL F+A+     +YYA 
Sbjct: 444 GGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPGLAYYAT 503

Query: 568 IMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKN 627
             + + ++ Q + +  P    T +  NF   Y+++ + LA+++ F+L  R  R   + ++
Sbjct: 504 FFMVVIILIQGFTSFTP----TFNGVNFLAAYISVFLFLAIWILFELIFRC-RFVWKIED 558

Query: 628 IDLISHRIIFDEELLRQEDEEYK 650
           +D+ S R   D E +  E+ E K
Sbjct: 559 VDIDSDRR--DIEAIVWEEPEPK 579

>Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W
           (REAL)
          Length = 586

 Score =  251 bits (640), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 181/586 (30%), Positives = 296/586 (50%), Gaps = 28/586 (4%)

Query: 76  ERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVN 135
           ++  N  D F + ET +A+     +++     M+   +    K+SNL++  ++L+     
Sbjct: 4   QKTENESDKFTKIETESATIPGGSDHS--GSLMRRMKDSF--KQSNLNVITEDLE----- 54

Query: 136 VDSQPVEQQDENAQL-----KQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVI 190
            +S+  EQ+    +L     ++ +K RH+ M++                LA +GPA L+I
Sbjct: 55  -NSEQSEQEKIQWKLASQPYQKVLKQRHLTMIAIGGTLGTGLFIGLGYSLA-SGPAALLI 112

Query: 191 GYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPL 250
           G+ ++GT ++C++Q+  EL+  +  V+GS+ T  S  +D    F VA  Y + WL   P 
Sbjct: 113 GFLLVGTSMFCVVQSAAELSCQF-PVSGSYATHVSRFIDQSIGFTVATNYALSWLISFPS 171

Query: 251 ELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFI 310
           EL+  S+TI YW   V+P                 G KG+AE EF  +  KV+ +  F I
Sbjct: 172 ELIGCSLTISYWNQTVNPAVWVAIFYVFIMCLNLFGVKGFAETEFALSIIKVISIFIFII 231

Query: 311 MAICINTGAA-GTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLT 369
           + I +  G    + GYIG +YW++PG+F        FK + +                LT
Sbjct: 232 IGIVLIAGGGPNSTGYIGTRYWHNPGSFAKPV----FKNLCNTFVSAAFSFGGSELVLLT 287

Query: 370 AAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM-GSSSGGNSASPYVL 428
           + E  N   +I  AAK   +R               VPYN  +L+ GS+S   SASP+V+
Sbjct: 288 STESKNI-SSISRAAKGTFWRIAIFYITTVVIIGCLVPYNDPRLLNGSTSEDISASPFVI 346

Query: 429 AASLHGVH--VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGR 486
           A S  G     V +F+N VIL++V+SV NS  Y+SSRL+  L   G  P+   Y+DR GR
Sbjct: 347 ALSNTGSMGTRVSNFMNVVILVAVVSVCNSCVYASSRLIQALGASGQLPEICAYMDRKGR 406

Query: 487 PLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQG 546
           PL  +          F   S KE +VFTWL A+  +S  FTWF IC+S +RFR  ++ QG
Sbjct: 407 PLVGIGISGIFGLLGFLVASNKEGEVFTWLFALCSISSFFTWFCICMSQVRFRMALKAQG 466

Query: 547 RSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILL 606
           RS  E+ +++  GV G     ++  L +  + +V+  P+   T  A+ FF+  L++PI++
Sbjct: 467 RSKNEIAYKSMLGVYGGVLGCVLNALLIAGEIYVSAAPVG-GTSTAKGFFEYCLSIPIMI 525

Query: 607 ALYVGFKLWRRDFR-LFIRAKNIDLISHRIIFDEELLRQEDEEYKE 651
            +Y+  +++R D++  +I+   IDL +   + + EL  ++ +  KE
Sbjct: 526 VVYISHRIYRGDWKNWYIKKSKIDLDTGCSVENLELFNEQKQAEKE 571

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  247 bits (631), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 163/565 (28%), Positives = 262/565 (46%), Gaps = 30/565 (5%)

Query: 109 QEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXX 168
           ++++   E   S+L I+    + A V+++S       +  Q+K+ +KPRH+ M++     
Sbjct: 5   KDYEATREKDGSHLIIKPSIAEDA-VSMESL---GSVKETQVKRALKPRHISMIALGGTI 60

Query: 169 XXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLV 228
                     PL+ AGP   +I Y  +GT  Y + Q+ GE+A  +  V  SF  F    +
Sbjct: 61  GTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQSLGEMA-TFIPVTSSFTVFTQRFL 119

Query: 229 DPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAK 288
            P    A  ++Y + W     LEL      I++WT  V                     K
Sbjct: 120 SPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVK 179

Query: 289 GYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIE---- 344
            Y E EF+  C KV+ ++GF I A  +  GA G  G +G +YW +PG + G   I     
Sbjct: 180 YYGEVEFWIACIKVLAIVGFIIYAFIMVCGA-GKTGPVGFRYWRNPGPW-GPGIISKDVN 237

Query: 345 --RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXX 402
             RF G +                 +TA E +NPRK +P A  KV +R            
Sbjct: 238 EGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFI 297

Query: 403 XXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSS 462
              VP+N D  + S     S+SP+V+A    G  V+ H  NAVIL +++S  NS  Y  S
Sbjct: 298 GLLVPFN-DPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGS 356

Query: 463 RLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGL 522
           R+   +A  G APK+  +  ++G P  ++L         +  +S   + VF WLL I+ +
Sbjct: 357 RIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAV 416

Query: 523 SQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVAL 582
           +  FTW  I +SHIRF + ++ QG S  +L F+A+    G+YYAA  + + ++ Q + A 
Sbjct: 417 AGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAF 476

Query: 583 VPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELL 642
            P         +FF  Y+++ +    ++GF++W R   LFI+ ++IDL + R        
Sbjct: 477 AP----KFKVSDFFTAYISVMLFFVFWIGFQIWFRG-PLFIKTEDIDLDTDR-------- 523

Query: 643 RQEDEEYKEKLRNGPKWKRVVDFWC 667
           R+ D+   E+ +    W++   FW 
Sbjct: 524 REIDDVVWEEQKPRNLWEK---FWA 545

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  246 bits (629), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 166/557 (29%), Positives = 256/557 (45%), Gaps = 25/557 (4%)

Query: 99  DENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRH 158
           DE   E Y +  F   +          D E  ++  +V     + +  NA++K+ +K RH
Sbjct: 43  DEKNKELYPLHSFSTRV----------DGEDTFSMGDVIRDEDQGEVRNAEVKRELKQRH 92

Query: 159 VIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNG 218
           + M++               PLA AGP   +I Y  MG+  Y + Q+ GE+A  +  V  
Sbjct: 93  IGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQSLGEMA-TFIPVTS 151

Query: 219 SFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXX 278
           SF  F    + P F  A  ++Y   W     LEL      I++WT KV            
Sbjct: 152 SFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTNKVPLAAWISIFWVI 211

Query: 279 XXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFR 338
                    K Y E EF+    KV+ +IGF I   C+  GA G  G +G +YW +PGA+ 
Sbjct: 212 ITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGA-GVTGPVGFRYWRNPGAWG 270

Query: 339 ----GQTKIE-RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXX 393
                + K E RF G +                 +TA E +NPRK +P A KKV +R   
Sbjct: 271 PGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILT 330

Query: 394 XXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSV 453
                       VPYN  +L  ++S   S SP+++A    G  V+ H  NAVIL +++S 
Sbjct: 331 FYIGSLLFIGLLVPYNDPKLTTATSY-VSVSPFIIAIENSGTKVLPHIFNAVILTTIISA 389

Query: 454 ANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVF 513
           ANS  Y  SR+L GL++   APK+     + G P  ++          +  TS     VF
Sbjct: 390 ANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGALAYMETSTGGDKVF 449

Query: 514 TWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLA 573
            WLL I+G++  F W  I +SHIRF + ++ +G S  EL F+A+     +Y+AA  + + 
Sbjct: 450 EWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMPGLAYFAATFMIII 509

Query: 574 LVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISH 633
           ++ Q + A  P      D  +F   Y+++ + LA+++ F++  R  R   + +++D+ S 
Sbjct: 510 ILIQGFTAFAP----KFDGIDFLAAYISIFLFLAIWILFEIIFRC-RFIWKIEDVDIDSD 564

Query: 634 RIIFDEELLRQEDEEYK 650
           R   D E +  ED E K
Sbjct: 565 RR--DIEAIVWEDHEPK 579

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  244 bits (622), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 154/508 (30%), Positives = 242/508 (47%), Gaps = 16/508 (3%)

Query: 146 ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQA 205
           +  Q+K+ +KPRH+ M++               PL+ AGP   +I Y  +GT  Y + Q+
Sbjct: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97

Query: 206 CGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK 265
            GE+A  +  V  SF  F    + P    A  ++Y + W     LEL      I++WT  
Sbjct: 98  LGEMA-TFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDA 156

Query: 266 VDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGY 325
           V                     K Y E EF+  C KV+ ++GF I A  +  GA G  G 
Sbjct: 157 VPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGA-GKTGP 215

Query: 326 IGAKYWNDPGAFRGQTKIE------RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKA 379
           +G +YW +PG + G   I       RF G +                 +TA E +NPRK 
Sbjct: 216 VGFRYWRNPGPW-GPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274

Query: 380 IPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQ 439
           +P A  KV +R               VP+N D  + S     S+SP+V+A    G  V+ 
Sbjct: 275 VPRAINKVFFRILFFYILSLLFIGLLVPFN-DPKLKSEDSYISSSPFVIAIENSGTKVLP 333

Query: 440 HFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXX 499
           H  NAVIL +++S  NS  Y SSR+L  +   G APK+  +  ++G P  ++L       
Sbjct: 334 HIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGF 393

Query: 500 XXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTG 559
             +  +S   + VF WLL I+ ++  F W  I V+HIRF + ++ QG S  +L F+A+  
Sbjct: 394 LAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFM 453

Query: 560 VLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDF 619
             G+YYAA  + + ++ Q + A  P      +  +FF  Y+++ +  A+++GF++W R  
Sbjct: 454 PWGAYYAAFFIGVIIIIQGFTAFAP----KFNVSDFFTAYVSVILFFAVWIGFQIWFRG- 508

Query: 620 RLFIRAKNIDLISHRIIFDEELLRQEDE 647
            LF + ++IDL + R   D ++  +EDE
Sbjct: 509 PLFKKTEDIDLDTDRREIDNDVW-EEDE 535

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  243 bits (620), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 172/580 (29%), Positives = 264/580 (45%), Gaps = 34/580 (5%)

Query: 92  NASSSTADENAV-ENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQL 150
           N+SS   +E  V E YS +     +  ++    + DD    A    +S P E+++   +L
Sbjct: 18  NSSSIIKEEEFVDEQYSGENVTKAITTER---KVEDD----AAKETESSPQERREVKRKL 70

Query: 151 KQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELA 210
           KQ    RH+ M++               PLA AGP   +I Y  MGT +Y + Q+ GE+ 
Sbjct: 71  KQ----RHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEM- 125

Query: 211 VAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDX 270
           V +  V  SF+ F    + P       ++Y + W     LEL      I+YWT  V    
Sbjct: 126 VTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAA 185

Query: 271 XXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKY 330
                            K Y E EF     KV+ ++GF I + C+  GA  +DG IG +Y
Sbjct: 186 WIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRY 245

Query: 331 WNDPGAFRGQTKIE------RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAA 384
           W +PGA+ G   I       RF G +                 +TA E +NPRKA+P A 
Sbjct: 246 WRNPGAW-GPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAI 304

Query: 385 KKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINA 444
           KKV  R               VPYN D  + S     S+SP++++    G  V+    NA
Sbjct: 305 KKVVVRILVFYILSLFFIGLLVPYN-DPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNA 363

Query: 445 VILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCA 504
           V+L+++LS  NS  Y  SR+L  L++   AP++   V R G P  S+L         F  
Sbjct: 364 VVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLE 423

Query: 505 TSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSY 564
            S      F WLL I+G++  F W  I  SHIRF + ++ +G S  +L ++AQ     +Y
Sbjct: 424 VSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAY 483

Query: 565 YAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIR 624
           YA+  + L ++ Q + A  P    T    +F   Y+++ + LA+++ F++W +  RL  +
Sbjct: 484 YASFFIALIVLIQGFTAFAP----TFQPIDFVAAYISIFLFLAIWLSFQVWFKC-RLLWK 538

Query: 625 AKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVD 664
            ++ID+ S R        RQ +E    +     +W+RV D
Sbjct: 539 LQDIDIDSDR--------RQIEELVWIEPECKTRWQRVWD 570

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  242 bits (618), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 164/600 (27%), Positives = 272/600 (45%), Gaps = 35/600 (5%)

Query: 75  NERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLE---NKKSNL--HIRDDEL 129
           N  + +  +  +  + P  +S+     A       + D D+E    KK+ +   +  D+L
Sbjct: 2   NSHYASQSEDIELIDNPEYTSNNLSTTASNTNKKYDSDTDMEPSQRKKAAMAGKLFSDQL 61

Query: 130 DYATVNVDSQPVEQQD------------ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXX 177
            Y     D+      D            ++ ++K+ +K RH+ M++              
Sbjct: 62  SYNVSVADNSSAANGDLDLSDTEEAGHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGIS 121

Query: 178 XPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVA 237
            PL  AGP   +I Y  MG+ +Y I Q+ GE+A  +  V  S   F    + P F     
Sbjct: 122 TPLGNAGPVGALIAYIFMGSIIYFITQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVTNG 180

Query: 238 WVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFF 297
           ++Y   W     +E+      I+YWT  V                     K Y E EF+ 
Sbjct: 181 YMYWFNWAITYAVEISVVGQVIQYWTDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWV 240

Query: 298 NCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIE------RFKGVMD 351
              KV+ +IG+ I A+ I  G + + G IG +YW +PG + G   I       RF G + 
Sbjct: 241 ASIKVLAIIGYLIYALVIVCGGS-SQGPIGFRYWRNPGPW-GPGIISKDVNEGRFLGWVS 298

Query: 352 XXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSD 411
                           +TA E +NPRK++P A  KV +R               VPYN D
Sbjct: 299 SLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPYN-D 357

Query: 412 QLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQV 471
             + S     ++SP+V++    G + +    NAV++L+++S ANS  Y  SR+L  LAQ 
Sbjct: 358 HTLSSGDSYIASSPFVISIQNAGTYALPDIFNAVVMLTIISAANSNVYVGSRVLYALAQT 417

Query: 472 GYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAI 531
           G APK F YV ++G P   ++         F   +      F WL+ IS L+ +  WF I
Sbjct: 418 GNAPKQFAYVTKHGVPWLGVIVTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWFFI 477

Query: 532 CVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLD 591
            +SHIRF + ++ +G S  +L F+A+    G+YY+A  +F+ +  Q + A  P +T T  
Sbjct: 478 ALSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYSAFFVFVIIFIQGFEAFTPWDTTT-- 535

Query: 592 AENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKE 651
              FF +Y+++ +L+ +++G +L+ R  R  ++ ++ID+ + R   + E +  ED+E K 
Sbjct: 536 ---FFTSYISLILLVVVFIGCQLYYR-CRFLLKVEDIDIDTDR--REIEAIIWEDDEPKN 589

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  242 bits (617), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 167/557 (29%), Positives = 256/557 (45%), Gaps = 25/557 (4%)

Query: 99  DENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRH 158
           DE + E Y ++ F   + N +    + D   D           E + +NA++K+ +K RH
Sbjct: 43  DEKSKELYPLRSFPTRV-NGEDTFSMEDGIGDED---------EGEVQNAEVKRELKQRH 92

Query: 159 VIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNG 218
           + M++               PL  AGP   +I Y  MG+  Y + Q+ GE+A  +  V  
Sbjct: 93  IGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA-TFIPVTS 151

Query: 219 SFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXX 278
           SF  F    + P F  A  ++Y   W     LEL      I++WT KV            
Sbjct: 152 SFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVI 211

Query: 279 XXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFR 338
                    K Y E EF+    KV+ +IGF I   C+  GA G  G +G +YW +PGA+ 
Sbjct: 212 ITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGA-GVTGPVGFRYWRNPGAWG 270

Query: 339 ----GQTKIE-RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXX 393
                + K E RF G +                 +TA E +NPRK++P A KKV +R   
Sbjct: 271 PGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILT 330

Query: 394 XXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSV 453
                       VPYN  +L  S+S   S SP+++A    G  V+ H  NAVIL +++S 
Sbjct: 331 FYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLPHIFNAVILTTIISA 389

Query: 454 ANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVF 513
           ANS  Y  SR+L GL++   APK+     + G P  ++          +  TS     VF
Sbjct: 390 ANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVF 449

Query: 514 TWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLA 573
            WLL I+G++  F W  I +SHIRF + ++ +G S  EL F+A+     +YYAA  + + 
Sbjct: 450 EWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTII 509

Query: 574 LVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISH 633
           ++ Q + A  P      +  +F   Y+++ + LA+++ F+   R  R   +  ++D+ S 
Sbjct: 510 IIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RFIWKIGDVDIDSD 564

Query: 634 RIIFDEELLRQEDEEYK 650
           R   D E +  ED E K
Sbjct: 565 RR--DIEAIVWEDHEPK 579

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  239 bits (611), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 158/555 (28%), Positives = 257/555 (46%), Gaps = 29/555 (5%)

Query: 86  KRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQD 145
           K +E    S  T  E  +E+Y M  F  +  +++            A  + DSQ      
Sbjct: 3   KTSEKEGMSQKT--ETRLEDYEMGSFAEEALDQE------------AQSSQDSQLGSSGH 48

Query: 146 ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQA 205
               +++ +KPRHV M++               PL  AGP   +I Y  MG+  YC+ Q+
Sbjct: 49  GRNAVQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQS 108

Query: 206 CGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK 265
            GE+A  +  V  SF  F    +      A  ++YC  W     LEL      I+YWT+ 
Sbjct: 109 LGEMA-TFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSA 167

Query: 266 VDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGY 325
           V                     K Y E +F+    KV+ +IGF +  +C+  GA G  G 
Sbjct: 168 VPNAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGA-GKTGP 226

Query: 326 IGAKYWNDPGAFRGQTKIE------RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKA 379
           +G +YW +PG + G   I       RF G +                 ++A E +NPRK 
Sbjct: 227 VGFRYWRNPGPW-GDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKT 285

Query: 380 IPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQ 439
           +P A  KV +R               VP+N ++L  S S  ++ SP+++A    G  ++ 
Sbjct: 286 VPKAINKVFFRILLFYVGSLFFIGLLVPFNDEKLTSSDSY-SAGSPFIIAIQNSGTKILP 344

Query: 440 HFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXX 499
              NAVIL +++S ANS  Y  SR+L GLA+   AP++F   +R+G P  ++L       
Sbjct: 345 DIFNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGF 404

Query: 500 XXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTG 559
             + + S   +  F WLL I+ ++  F+W  I + H+RF + +++QG S  +L F+A+  
Sbjct: 405 LGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLM 464

Query: 560 VLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDF 619
             G+YY+A  + L ++ Q + +L P    T +  NFF  Y+++ + L ++  F+ W R  
Sbjct: 465 PWGAYYSAFFITLIIIIQGFTSLAP----TFNVSNFFAAYISVFMFLVIWAVFQCWYRT- 519

Query: 620 RLFIRAKNIDLISHR 634
           R+  R +++D+ S R
Sbjct: 520 RIIHRIEHVDIDSDR 534

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  239 bits (609), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 164/563 (29%), Positives = 260/563 (46%), Gaps = 25/563 (4%)

Query: 93  ASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQ 152
            S S  DE + E Y ++ F   + N +    + ++  D           E + +NA++K+
Sbjct: 37  GSLSLKDEKSKELYPLRSFPTGV-NGQDTFSMEENLQDED---------EGEVQNAEVKR 86

Query: 153 TIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVA 212
            +K RH+ M++               PLA AGP   +I Y  MG+  + + Q+ GE+A  
Sbjct: 87  ELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFSVTQSLGEMA-T 145

Query: 213 YSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXX 272
           +  V  SF  F    + P F  A  ++Y   W     LEL      I++WT KV      
Sbjct: 146 FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKVPLAAWI 205

Query: 273 XXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWN 332
                          K Y E EF+    KV+ +IGF I   C+  GA G  G +G +YW 
Sbjct: 206 SIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGA-GVTGPVGFRYWR 264

Query: 333 DPGAFR----GQTKIE-RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKV 387
           +PGA+      + K E RF G +                 +TA E +NPRK +P A KKV
Sbjct: 265 NPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAIKKV 324

Query: 388 AYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVIL 447
            +R               VPYN  +L  ++S   S SP+++A    G  V+ H  NAVIL
Sbjct: 325 VFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSPFIVAIQNSGTKVLPHIFNAVIL 383

Query: 448 LSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSP 507
            +++S ANS  Y  SR+L GL++   APK+     + G P  ++          +  TS 
Sbjct: 384 TTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALAYMETST 443

Query: 508 KETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAA 567
               VF WLL I+G++  F W  I +SHIRF + ++ +G S  EL F+A+     +YY++
Sbjct: 444 GGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYSS 503

Query: 568 IMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKN 627
             + + ++ Q + A  P      +  +F   Y+++ + +A+++ F+   R  R   + ++
Sbjct: 504 FFMIIIIIIQGFTAFAP----KFNGSSFLAAYISIFLFIAVWILFECIFRC-RFIWKIED 558

Query: 628 IDLISHRIIFDEELLRQEDEEYK 650
           +D+ S R   D E +  ED E K
Sbjct: 559 VDIDSDRR--DIEAIVWEDHEPK 579

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  238 bits (608), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 156/529 (29%), Positives = 246/529 (46%), Gaps = 16/529 (3%)

Query: 127 DELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPA 186
           D L  AT N  +   E+  ++  +K+ +KPRH+ M++               PL  AGP 
Sbjct: 71  DCLQSAT-NTGTLCTEEHVKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPV 129

Query: 187 PLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLC 246
             +I Y  +GT ++ + Q+ GE+ V +  V  SF  F    + P F  A  ++Y   W  
Sbjct: 130 GALIAYIFVGTIIFSVTQSLGEM-VTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAM 188

Query: 247 VCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMI 306
              +EL      I++WTT V                     K Y E EF+    KV+ ++
Sbjct: 189 TFAVELSVLGKVIQFWTTAVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLV 248

Query: 307 GFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIE-----RFKGVMDXXXXXXXXXX 361
           GF I  +CI +GA G  G  G +YW DPGA+      E     RF G +           
Sbjct: 249 GFLIFCLCITSGA-GPHGPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQ 307

Query: 362 XXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGN 421
                 +TA E +NPRKA+P A KKV  R               VP+N  +L  ++S   
Sbjct: 308 GTELVGITAGEAANPRKAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSATSF-V 366

Query: 422 SASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYV 481
           S+SP+++A    GV ++    N VIL++++S  NS  Y  SR+L GLA    AP++F   
Sbjct: 367 SSSPFIIAIQNSGVSLLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRT 426

Query: 482 DRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRG 541
            + G P  ++L         F   +     VF WLL+I  ++  F W  I +SHIRF + 
Sbjct: 427 TKTGVPFVAVLFTSLFGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKA 486

Query: 542 MQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLA 601
           ++ +G S   L F+A      +YYA   + L ++ Q + A  P      +  +F  +Y++
Sbjct: 487 LEYRGISRNSLPFKAIFMPWLAYYATAFIILIILIQGFTAFAP----RFNVSDFVASYIS 542

Query: 602 MPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYK 650
           + + + ++  F+  ++  R+F + ++IDL S R   D E +R ED+  K
Sbjct: 543 LLLFVIIWGVFQAMKKC-RIFWKVEDIDLDSDRK--DIEDIRWEDDSPK 588

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  237 bits (604), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 157/539 (29%), Positives = 249/539 (46%), Gaps = 28/539 (5%)

Query: 120 SNLH------IRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXX 173
           SNLH      + DDE        +S   E Q ++ ++K+ +K RH+ M++          
Sbjct: 76  SNLHQHGTTSLHDDE--------ESDTEEAQYQDTRVKRALKQRHIGMIALGGTIGTGLF 127

Query: 174 XXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFN 233
                PL+ AGP   +I Y  MG+ +Y + Q+ GE+A  +  V  S   F    + P F 
Sbjct: 128 VGIATPLSNAGPVGSLIAYIFMGSVVYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFG 186

Query: 234 FAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEA 293
            A  ++Y   W     +E+      I+YWT  V                     K Y E 
Sbjct: 187 VANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIGIFWVIVTLMNFFPVKVYGEF 246

Query: 294 EFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAF-----RGQTKIERFKG 348
           EF+    KV+ ++G+ I A+ I  G +   G IG +YW +PG +       +T   RF G
Sbjct: 247 EFWIASIKVLAIMGYLIYALIIVCGGS-HQGPIGFRYWRNPGPWGPGIISDKTGEARFLG 305

Query: 349 VMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPY 408
            +                 +TA E +NPRK++P A  KV +R               VP+
Sbjct: 306 WVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPF 365

Query: 409 NSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGL 468
           N D+L  + S   ++SP+V++    G   +    NAV+LL+++S ANS  Y  SR+L  L
Sbjct: 366 NDDRL-ANDSAVIASSPFVISIQNAGTRALPDIFNAVVLLTIISAANSNVYVGSRVLYAL 424

Query: 469 AQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTW 528
           A  G APK F YV + G P   ++C        F   +      F WL+ IS L+ +  W
Sbjct: 425 ALTGNAPKIFSYVTKYGVPYMGVICTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAW 484

Query: 529 FAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTH 588
             I +SHIRF + ++ +G S  +L F+A+    G+YYA+  + + +  Q + A  P    
Sbjct: 485 LFISLSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQAFTP---- 540

Query: 589 TLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDE 647
             D   FF +Y+++ +L  L+ G +L+ R  R   + ++ID+ S R    E ++ +EDE
Sbjct: 541 KFDVSTFFTSYISLILLAVLFSGCQLYYR-CRFIWKVEDIDIDSDRREI-EAIIWEEDE 597

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  236 bits (602), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 162/583 (27%), Positives = 264/583 (45%), Gaps = 49/583 (8%)

Query: 106 YSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQD-------------------- 145
           + MQ   ++ E  +S  +  DD+ D  TV  D++ +E++D                    
Sbjct: 26  FEMQSIHSNAEKLRSTTYAYDDKKD-MTVTYDNEILEKKDSKSDIFTSVNRYASHPSEAR 84

Query: 146 -------------ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGY 192
                        ++ ++K+ +KPRH+ M++               PL ++GP   +I Y
Sbjct: 85  ISSDEYDHQEAEFKDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAY 144

Query: 193 GIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLEL 252
             MGT +Y + QA GE+A  +  V  S   F S  + P F  +  ++Y   W     +E+
Sbjct: 145 IFMGTVVYFVTQALGEMA-TFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEI 203

Query: 253 VTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMA 312
                 I++WTTKV                       Y E EF+    KV+ ++G+ I A
Sbjct: 204 SVVGQVIEFWTTKVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYA 263

Query: 313 ICINTGAAGTDGYIGAKYWNDPGAFRG----QTKIE-RFKGVMDXXXXXXXXXXXXXXXX 367
           + I  G +   G IG +YW    A  G    + K E RF G +                 
Sbjct: 264 LVIVCGGS-KQGPIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVG 322

Query: 368 LTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYV 427
           +TA E +NPRK++P A  KV +R               VPYN D  + S++   ++SP+V
Sbjct: 323 ITAGEAANPRKSVPRAINKVVFRIVIFYILSLFFIGLLVPYN-DPKLNSATSYIASSPFV 381

Query: 428 LAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRP 487
           ++    G   + H  NA+I+++++S ANS  Y SSR+L  LA  G+APK F  V   G P
Sbjct: 382 ISIENAGTRALPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVP 441

Query: 488 LRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGR 547
              ++         F   +    + F WL+ IS L+ +  W  I +SH+RF   ++ +G 
Sbjct: 442 FLGVIVTALMGLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGI 501

Query: 548 SLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLA 607
           S  +L F+A+    GSYYA   + + +  Q + A  P      D  +FF  Y+++ +L  
Sbjct: 502 SRDDLPFKARFMPYGSYYACFFITVIIFIQGFTAFSP----KFDVASFFTAYISLILLAV 557

Query: 608 LYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYK 650
           L++G +L+ R  R F + ++ID+ + R   DE  +  ED+E K
Sbjct: 558 LFIGCQLYYRC-RFFWKVEDIDIDTDRREIDE--IVWEDDEPK 597

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  233 bits (595), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 152/556 (27%), Positives = 255/556 (45%), Gaps = 25/556 (4%)

Query: 86  KRAETPNASSSTADEN-AVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQ 144
           K+ E P  +      +  +++Y +    N + +  S + I   E + A           Q
Sbjct: 3   KKQEEPLKNGKIKSSSYELDDYPLHRRTNSVHSIPSQITIESQEEEIA---------NGQ 53

Query: 145 DENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQ 204
              A++K+ +K RH+ M++               PL  AGP   +I Y  MGT +Y + Q
Sbjct: 54  IREAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQ 113

Query: 205 ACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTT 264
           + GE+A  +  V  SF  F    + P F  A  ++Y   W     LEL      I++WT+
Sbjct: 114 SLGEMA-TFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTS 172

Query: 265 KVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDG 324
            V                     + Y E EF+    KV+ ++GF I  +C+  GA G  G
Sbjct: 173 AVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGA-GVTG 231

Query: 325 YIGAKYWNDPGAFRGQTKIER------FKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRK 378
            +G +YW +PG   G   I +      F G +                 +TA E +NPRK
Sbjct: 232 PVGFRYWRNPGPM-GPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 290

Query: 379 AIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVV 438
           ++P A KKV +R               VPYN  +L    S   +ASP++++    G  ++
Sbjct: 291 SVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSY-VAASPFIISIQNSGTPIL 349

Query: 439 QHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXX 498
            H  NAVIL +++S ANS  Y  SR++ GL++   AP+     ++NG P  S++      
Sbjct: 350 PHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFG 409

Query: 499 XXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQT 558
              +  TS      F WLL I+G++  F+W  I +SH+RF + ++ +G S  +L F+A+ 
Sbjct: 410 ALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKF 469

Query: 559 GVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRD 618
               +YYA   + L ++ Q + +  P    + D  +F   Y++  + +A+++ F+LW R 
Sbjct: 470 MPGLAYYAIFFMTLIIIIQGFTSFCP----SFDGIDFLAAYISCFLFIAIWIVFQLWFRC 525

Query: 619 FRLFIRAKNIDLISHR 634
            RL  + +++D+ + R
Sbjct: 526 -RLIWKIEDVDIDTDR 540

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  233 bits (595), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 161/539 (29%), Positives = 244/539 (45%), Gaps = 20/539 (3%)

Query: 95  SSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTI 154
           SSTA E   E +  ++  +  E  +    +         V++D    E   ++A++K+ +
Sbjct: 31  SSTASE---EPFGCKDTKSTDEKTRVVSQVSPMRTGSPNVSIDYMD-EGNVQDAEVKRAL 86

Query: 155 KPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYS 214
           KPRH+ M++               PLA AGP   +I Y  MGT  Y + Q+ GE+A  + 
Sbjct: 87  KPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQSLGEMA-TFI 145

Query: 215 KVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXX 274
            V  SF  F    + P F  A  ++Y   W     LEL      I++WT  V        
Sbjct: 146 PVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFWTFAVPLGAWIAI 205

Query: 275 XXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDP 334
                        K Y E EF+  C KV+ ++GF I A  +  GA G  G +G +YW +P
Sbjct: 206 FWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGA-GKTGPVGFRYWRNP 264

Query: 335 GAFRGQTKIE------RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVA 388
           G + G   I       RF G +                 +TA E  NPR+ +P A  KV 
Sbjct: 265 GPW-GPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKNPRRTVPRAINKVF 323

Query: 389 YRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILL 448
           +R               VP+N D  + S     S+SP+V+A    G  V+ H  NAVIL 
Sbjct: 324 FRILFFYILSLLFIGLLVPFN-DPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILS 382

Query: 449 SVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPK 508
           +++S  NS  Y  SR+L GLA+   APK F    ++G P  S+L         +   S  
Sbjct: 383 TIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAAFGFLAYLNLSNS 442

Query: 509 ETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAI 568
              VF WLL I+ ++  F W  I ++HIRF + ++ +  S  +L F+A+    G+YY+A 
Sbjct: 443 AQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPWGAYYSAF 502

Query: 569 MLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKN 627
            + L ++ Q + A  P      +  NFF  Y+++ + LA++V F++  R    FI  KN
Sbjct: 503 FISLIIIIQGFTAFAP----KFNVSNFFAAYISVFLFLAIWVVFQIRFRT--RFILTKN 555

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  232 bits (592), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 163/594 (27%), Positives = 265/594 (44%), Gaps = 32/594 (5%)

Query: 78  FRNWLDSFKRAETPNASSSTADENAVENYSMQEF------DNDLENKKSNLHIRDDELDY 131
            RN + S KR E    S+  +   + +N+ + E       DN ++ K  N  +      Y
Sbjct: 4   LRNIIRS-KRNEDSTESNDDS-TTSYDNFEIIEIQHNDSKDNSIKKKIPNSELASLTHAY 61

Query: 132 ATVNV----DSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAP 187
           +   V    D    E   E+ Q+K+ +K RH+ M++               PLA AGP  
Sbjct: 62  SRSRVEPEHDEDAEEADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVG 121

Query: 188 LVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCV 247
            +I Y  MG+ +Y + QA GE+A  +  V  S   F    + P F  A  ++Y   W   
Sbjct: 122 ALIAYIFMGSIVYFVTQALGEMA-TFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAIT 180

Query: 248 CPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIG 307
             +E+      I+YWT  V                     K Y E EF+    KV+ ++G
Sbjct: 181 FAVEISVVGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVG 240

Query: 308 FFIMAICINTGAAGTDGYIGAKYWNDPGAFRG----------QTKIE-RFKGVMDXXXXX 356
           + + A+ I  G +   G IG +YW +PGA+             +K E RF G +      
Sbjct: 241 YLLYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINA 300

Query: 357 XXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGS 416
                      +TA E +NPRK +P A  KV +R               VP+ +D  +  
Sbjct: 301 AFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPF-TDSRLSD 359

Query: 417 SSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPK 476
            +   ++SP+V++    G  ++    NA+++++VLS ANS  Y  SR+L  LA    APK
Sbjct: 360 DTTVIASSPFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPK 419

Query: 477 WFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHI 536
            F  V R G P   ++C        F          F WL+ IS L+ +  W  I ++H+
Sbjct: 420 IFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHV 479

Query: 537 RFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFF 596
           RF + ++ +G S  +L F+A+    GSYYAA  +F+ +  Q + A  P      D   FF
Sbjct: 480 RFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSPH----FDVTTFF 535

Query: 597 QNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYK 650
            +Y+++ +L  +++G +L+ R  R   + +++D+ S R   ++ +   ED+E K
Sbjct: 536 TDYISLILLAVVFIGAQLYYR-CRFLWKLEDVDIDSDRREIEDAI--WEDDEPK 586

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  231 bits (588), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 155/522 (29%), Positives = 238/522 (45%), Gaps = 20/522 (3%)

Query: 148 AQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACG 207
            ++++ +K RH+ M++               PLA AGP   +I Y  MGT +Y + Q+ G
Sbjct: 64  GEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLG 123

Query: 208 ELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVD 267
           E+A  +  V  SF+ F    + P       ++Y + W     LEL      I+YWT  V 
Sbjct: 124 EMA-TFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVP 182

Query: 268 PDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIG 327
                               K Y E EF     KV+ ++GF I + CI  GA   DG IG
Sbjct: 183 LAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIG 242

Query: 328 AKYWNDPGAFR----GQTKIE-RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPS 382
            +YW +PGA+        K E RF G +                 +TA E +NPRKA+P 
Sbjct: 243 FRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPR 302

Query: 383 AAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFI 442
           A KKV  R               VPYN D  + S     SASP++++    G  V+    
Sbjct: 303 AIKKVVIRILVFYILSLFFIGLLVPYN-DPKLDSDGTFVSASPFMISIENSGTKVLPDIF 361

Query: 443 NAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXF 502
           NAV+L+++ S  NS  Y  SR+L  L++   APK    V R G P  ++L         F
Sbjct: 362 NAVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAF 421

Query: 503 CATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLG 562
             TS      F WLL I+G++  F W  I  SHIRF + ++ +G S  +L ++A+     
Sbjct: 422 LETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFL 481

Query: 563 SYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLF 622
           +YYA+  + L ++ Q + A  P    T    +F   Y+++ +   +++ F+LW +  RL 
Sbjct: 482 AYYASFFIALIVLIQGFTAFAP----TFQPVDFVAAYISVFLFAIIWLSFQLWFKC-RLI 536

Query: 623 IRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVD 664
            + ++ID+ S R        R+ +E+   +     +W+RV D
Sbjct: 537 CKLQDIDIDSDR--------REIEEQVWIEPECKTRWQRVWD 570

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  231 bits (590), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 163/532 (30%), Positives = 245/532 (46%), Gaps = 23/532 (4%)

Query: 98  ADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQD--ENAQLKQTIK 155
             E  VE Y+  + D  L  K S  H+R   +  A+ ++  + ++     E AQ+K+ +K
Sbjct: 50  GSEGEVE-YAKSDEDATL-TKASKRHVRASSVSTASSSIAEEDIDATGVVEEAQVKRELK 107

Query: 156 PRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSK 215
           PRH+ M++               P+  AGP   +I Y  MGT ++ + Q+ GE+A  +  
Sbjct: 108 PRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQSLGEMA-TFIP 166

Query: 216 VNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXX 275
           V  SF  F S  V   F  A  ++Y   W     LEL      I++WT KV         
Sbjct: 167 VTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKVPLAAWISIF 226

Query: 276 XXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPG 335
                       K Y E EF+    KV+ +IGF I  +C+  GA G  G +G +YW  PG
Sbjct: 227 WVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGA-GITGPVGFRYWRHPG 285

Query: 336 ----AFRGQTKIE-RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYR 390
                   + K E RF G +                 +TA E +NPRK++P A KKV+ R
Sbjct: 286 PWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVSVR 345

Query: 391 XXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSV 450
                          VPYN D  + S+    SASP+++A    G  V+ H  NAVIL ++
Sbjct: 346 ILLFYILSLFFIGLLVPYN-DPKLSSTDSYVSASPFIIAIQNSGTKVLPHIFNAVILTTI 404

Query: 451 LSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKET 510
           +S ANS  Y  SR+L GL+    APK+F    RNG P  ++L         +  TS    
Sbjct: 405 ISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNGVPFIAVLFTAAFGALAYMETSAGGQ 463

Query: 511 DVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIML 570
           + F WLL I+G++  F W +I +SHIRF + ++ +G S  +L ++A      +YY A  +
Sbjct: 464 NAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGLAYYGAFFV 523

Query: 571 FLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYV------GFKLWR 616
            L ++ Q + A  P      D+  F   Y++  + L +Y+        +LWR
Sbjct: 524 TLIILIQGFTAFAP----KFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  231 bits (588), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 148/510 (29%), Positives = 237/510 (46%), Gaps = 15/510 (2%)

Query: 146 ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQA 205
            + Q+K+ +K RH+ M++               PL  +GP   +I Y  MG+ +Y I Q+
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 206 CGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK 265
            GE+A  +  V  S   F    + P F  A  ++Y   W     +E+      I+YWT K
Sbjct: 149 LGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDK 207

Query: 266 VDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGY 325
           V                     K Y E EF+    KV+ ++G+ + A+ I  G + + G 
Sbjct: 208 VPLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGS-SQGP 266

Query: 326 IGAKYWNDPGAF-----RGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAI 380
           IG +YW +PG +            RF G +                 +TA E +NPRK +
Sbjct: 267 IGFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 326

Query: 381 PSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQH 440
           P A  KV +R               VPYN D+ + S+S   ++SP+V++    G  V+  
Sbjct: 327 PRAINKVVFRIALFYIMSLFFIGMLVPYN-DERLASTSAVIASSPFVISIQNAGTKVLPD 385

Query: 441 FINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXX 500
             NA+++++++S ANS  Y  SR+L  LA  G APK F +V R G P   ++        
Sbjct: 386 IFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLL 445

Query: 501 XFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGV 560
            F   +      F WL+ IS L+ +  W  I +SHIRF + ++ +G S  +L F+A+   
Sbjct: 446 AFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMP 505

Query: 561 LGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFR 620
            G+YYA   + + +  Q + A  P      D   FF +Y+++ IL  L++G +++ R  R
Sbjct: 506 FGAYYATFFVTVIIFIQGFQAFSPH----WDTTAFFTSYISLIILAVLFIGCQIFYRC-R 560

Query: 621 LFIRAKNIDLISHRIIFDEELLRQEDEEYK 650
            F R ++ID+ S R   + E +  ED+E K
Sbjct: 561 FFWRVEDIDIDSDR--REIEAVIWEDDEPK 588

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  230 bits (586), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 153/514 (29%), Positives = 243/514 (47%), Gaps = 15/514 (2%)

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
           E Q   A++K+ +K RH+ M++               PL+ AGP   +I Y  M T +Y 
Sbjct: 69  EGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYS 128

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
           ++Q+ GE+A  +  V  +F  F S  + P F  A  ++Y   W     LEL      I++
Sbjct: 129 VVQSLGEMA-TFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEF 187

Query: 262 WTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAG 321
           WTT V                     K Y E EF+    KV+ ++GF I  +C+  GA G
Sbjct: 188 WTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA-G 246

Query: 322 TDGYIGAKYWNDPGAFR----GQTKIE-RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNP 376
             G +G +YW +PGA+      + K E RF G +                 +TA E +NP
Sbjct: 247 ITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 306

Query: 377 RKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVH 436
           RK++P A KKV +R               VPYN D  + SS    S+SP+++A    G  
Sbjct: 307 RKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYN-DPKLNSSDSYVSSSPFIIAIENSGTK 365

Query: 437 VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXX 496
           V+ H  NAV+L +++S  NS  Y  SR++ GLA++  AP +F   +  G P  ++     
Sbjct: 366 VLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSA 425

Query: 497 XXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRA 556
                +   S      F WLL I+G++  FTW  I   HIRF + ++ +G S  +L F+A
Sbjct: 426 FGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKA 485

Query: 557 QTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWR 616
           +     +YYA   + + ++ Q + A  P    T    +F   Y+++ + +A+++G ++W 
Sbjct: 486 KFMPWLAYYALFFMVVIILIQGFTAFAP----TFSGVDFAAAYVSVFLFIAIWLGAQIWF 541

Query: 617 RDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYK 650
           R  R+F R   +D+ + R   D E +  +DE  K
Sbjct: 542 RC-RIFHRLDEVDIDTDRR--DIEAVVWDDEPPK 572

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  229 bits (583), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 151/526 (28%), Positives = 240/526 (45%), Gaps = 17/526 (3%)

Query: 137 DSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMG 196
           + + +  + E   +++ +K RH+ M++               PL  AGP   +I Y  M 
Sbjct: 14  EIREISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMA 73

Query: 197 TCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSS 256
           T  Y + Q+ GE+A  +  V  SF  F    V P F  A  ++Y   W     LEL    
Sbjct: 74  TLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVG 132

Query: 257 MTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICIN 316
             I++WT  V                     K Y E EF+    KV+ ++GF I   C+ 
Sbjct: 133 QVIQFWTFAVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMV 192

Query: 317 TGAAGTDGYIGAKYWNDPGAFRGQTKIE------RFKGVMDXXXXXXXXXXXXXXXXLTA 370
            GA G  G +G +YW  PGAF G   I       RF G +                 +TA
Sbjct: 193 CGA-GVTGPVGFRYWRHPGAF-GPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITA 250

Query: 371 AEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAA 430
            E +NPRK +P A KKV +R               VPY+ D  + S+    SASP+++A 
Sbjct: 251 GEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYD-DWKLTSTDSYVSASPFIIAI 309

Query: 431 SLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRS 490
              G HV+ H  NAVI+ +++S  NS  Y  SR++ GL+    AP       ++G P  +
Sbjct: 310 ENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVA 369

Query: 491 MLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLG 550
           +L         +  TS      F WLL I+G++  FTW  I +SHIRF + ++++G S  
Sbjct: 370 VLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRD 429

Query: 551 ELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYV 610
           +L F+A+     +YY    + L ++ Q + +  P N       +F   Y+++ + +A+++
Sbjct: 430 DLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFCPWN-----GIDFLTAYISVFMFIAIWI 484

Query: 611 GFKLWRRDFRLFIRAKNIDLISHRIIFDEEL-LRQEDEEYKEKLRN 655
            F+ W R  RL  R +++D+ + R   +E + + QE   + +K  N
Sbjct: 485 AFQAWFRC-RLIWRVEDVDIDTDRRAVEEAVWIEQEPRGFWDKFWN 529

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  230 bits (587), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 161/597 (26%), Positives = 270/597 (45%), Gaps = 36/597 (6%)

Query: 77  RFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLE---------NKKSNLHIRDD 127
           +FR+++ +    ++ +  S T+ + +   Y M++   D +         + ++++H    
Sbjct: 3   KFRSFIKARAVGDSDDTRSQTSGDGS--PYEMEDIVPDEKIRLQKLKHVSTQADVHSVTG 60

Query: 128 ELDYATVN--VD-------SQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXX 178
            L  + +N  VD       S  +E +    ++K+ +K RH+ M++               
Sbjct: 61  SLTRSRLNSRVDDGAESDGSDELEAEVHETKVKRALKQRHIGMIALGGTIGTGLFVGIST 120

Query: 179 PLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAW 238
           PL+ AGP   +I Y  MGT +Y + Q+ GE+A  +  V  S   F    + P F  A  +
Sbjct: 121 PLSVAGPVGSLIAYIFMGTIIYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGY 179

Query: 239 VYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFN 298
           +Y   W     +E+      I+YWT  V                     K Y E EF+  
Sbjct: 180 MYWFNWAITYAVEISVIGQVIQYWTKAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIA 239

Query: 299 CCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAF-----RGQTKIERFKGVMDXX 353
             KV+ ++G+ I A+ I  G +   G IG +YW  PGAF            +F G +   
Sbjct: 240 FVKVLAIVGYLIYALVIVCGGS-HQGPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASL 298

Query: 354 XXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQL 413
                         +TA E +NPRK +P A  KV +R               +PYN D+ 
Sbjct: 299 INAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGMLLPYN-DKR 357

Query: 414 MGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGY 473
           + +     ++SP+V++       V+    NAV++++V+S ANS  Y  SR+L  LA  G 
Sbjct: 358 LSAQDAVIASSPFVISIKNAHTKVLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGN 417

Query: 474 APKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICV 533
           APK F YV R G P   ++C        F   +      F WL+ IS L+ +  W  I +
Sbjct: 418 APKQFSYVTRYGVPYLGVVCTASLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISL 477

Query: 534 SHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAE 593
           +HIRF + ++ +G S  +L F+A+    G+YYAA  + + +  Q + A  P      D  
Sbjct: 478 AHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGYQAFCPW-----DVS 532

Query: 594 NFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYK 650
            FF +Y+++ +L  L VG +L+ R  R  ++ ++ID+ + R   + E +  ED+E K
Sbjct: 533 TFFTSYISLILLAVLVVGCQLYYRG-RFLLKLEDIDIDTDR--REIESIVWEDDEPK 586

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  230 bits (587), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 154/520 (29%), Positives = 246/520 (47%), Gaps = 19/520 (3%)

Query: 140 PVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCL 199
           P + +  + Q+K+ +KPRH+ M++               PL+++GP   +I Y  MG+ +
Sbjct: 92  PAKGKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVV 151

Query: 200 YCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTI 259
           Y + Q+ GE+A  +  V  S   F    + P    +  ++Y   W      EL  +   I
Sbjct: 152 YFVTQSLGEMA-TFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQII 210

Query: 260 KYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGA 319
           +YWT KV                     K Y E EF+ +  KV+ ++G+ I A+ I  G 
Sbjct: 211 QYWTYKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGG 270

Query: 320 AGTDGYIGAKYWNDPGAFR----GQTKIE-RFKGVMDXXXXXXXXXXXXXXXXLTAAEQS 374
           +   G IG +YW    AF      + K E RF G +                 ++A E +
Sbjct: 271 S-RQGPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAA 329

Query: 375 NPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHG 434
           NPRK +P A  KV +R               VPYN D+ +   S   ++SP+V++    G
Sbjct: 330 NPRKTVPRAINKVIFRIALFYILSLFFIGLLVPYN-DKRLSDGSAIIASSPFVISMLNAG 388

Query: 435 VHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCX 494
              +    NAVIL++VLS ANS  Y +SR+L  LA  G APK F YV+R G P   +   
Sbjct: 389 TSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVT 448

Query: 495 XXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGF 554
                  F   S      F WL+ IS L+ +  WF IC +HIRF + ++ +G S  +L F
Sbjct: 449 CLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPF 508

Query: 555 RAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKL 614
           +A+    G+YYAA  + L +  Q + A  P +T     ++FF +Y+++ +   LY+G  +
Sbjct: 509 KARFMPWGAYYAAFFVGLIIFIQGYDAFTPWDT-----KSFFTSYISLILFGVLYLGCLI 563

Query: 615 WRRDFRLFIRAKNIDLISHR-----IIFDEELLRQEDEEY 649
           + R  RL I+ ++ID+ + R      +++E+  R   E++
Sbjct: 564 YYRG-RLLIKIEDIDIDTDRKEVEAYVWEEDAPRNWWEKF 602

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  230 bits (587), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 158/543 (29%), Positives = 253/543 (46%), Gaps = 21/543 (3%)

Query: 113 NDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXX 172
           N + N  + L +   E D   +N D +  E   E+  +K+ +K RH+ M++         
Sbjct: 74  NSITNSLTRLQVVSHETD---INEDEE--EAHYEDKHVKRALKQRHIGMIALGGTIGTGL 128

Query: 173 XXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGF 232
                 PL+ AGP   +I Y  MGT +Y + Q+ GE+A  +  V  S   F    + P F
Sbjct: 129 FVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAF 187

Query: 233 NFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAE 292
             +  ++Y   W     +E+      I+YWT KV                     K Y E
Sbjct: 188 GVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGE 247

Query: 293 AEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFR----GQTKIE-RFK 347
            EF+    KV+ ++G+ I A+ I  G +   G IG +YW +PGA+        K E RF 
Sbjct: 248 FEFWVASVKVLAIMGYLIYALIIVCGGS-HQGPIGFRYWRNPGAWGPGIISSDKSEGRFL 306

Query: 348 GVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVP 407
           G +                 +TA E +NPRK +P A  KV +R               VP
Sbjct: 307 GWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVP 366

Query: 408 YNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLG 467
           YN D  + +SS   ++SP+V++    G + +    NAV+L++V+S ANS  Y  SR+L  
Sbjct: 367 YN-DSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYS 425

Query: 468 LAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFT 527
           LA+ G APK F YV R G P   ++C        F   +      F WL+ IS L+ +  
Sbjct: 426 LARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCA 485

Query: 528 WFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNT 587
           W  I ++HIRF + ++ +G S  +L F+A+    G+YYAA  + + +  Q + A  P   
Sbjct: 486 WLFISLAHIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP--- 542

Query: 588 HTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDE 647
                  FF +Y+++ +L  +++G +++ +  R   + ++ID+ S R   + E +  ED+
Sbjct: 543 --FKVSEFFTSYISLILLAVVFIGCQIYYK-CRFIWKLEDIDIDSDR--REIEAIIWEDD 597

Query: 648 EYK 650
           E K
Sbjct: 598 EPK 600

>Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar to
           Ashbya gossypii AER405C
          Length = 587

 Score =  229 bits (585), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 159/565 (28%), Positives = 278/565 (49%), Gaps = 17/565 (3%)

Query: 109 QEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXX 168
           + FD  + + + +  I  +++D + +N D +       +   ++T+  RH+ M+S     
Sbjct: 34  KRFDKFIGSFQRHEAIIPEDVDLSLLN-DYERSNFILAHQPYQKTLSQRHLTMISIGGTL 92

Query: 169 XXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLV 228
                      LA    A L+    +  + ++C+IQA  EL+  Y  V+GSF+T  S  +
Sbjct: 93  GTGLFIGIGSSLASGPGALLLGFLLVGLS-IFCVIQAAAELSCQY-PVSGSFSTHVSRFI 150

Query: 229 DPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAK 288
           +P   F V+  Y + WL   P ELV  ++TI YW   V P                   +
Sbjct: 151 EPSVGFMVSTSYALSWLISFPSELVGLTLTIGYWNNSVSPGIWVAIFYLLIMAMNLFSVR 210

Query: 289 GYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTD--GYIGAKYWNDPGAFRGQTKIERF 346
           G+AE E++ +  K++ +  F I+ I +  G    +  GY+G KYW+DPGAF    K   F
Sbjct: 211 GFAETEYWLSIIKIIAITIFIIIGIVVICGGGPNNQAGYLGTKYWHDPGAF----KKPYF 266

Query: 347 KGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXV 406
            G+ +                LTA E S   ++I  AAK   +R               V
Sbjct: 267 SGICNTFVSAAFSFGGAELVLLTANE-SRKVESISRAAKGTFWRIAIFYISTVAVISCLV 325

Query: 407 PYNSDQLMGSSSGGNSASPYVLAASLHGV--HVVQHFINAVILLSVLSVANSAFYSSSRL 464
           PY+++ L+G+  G  + SP+V++ +  G     V HF+NA+IL +VLSV NS+ Y++SR+
Sbjct: 326 PYDNETLLGNGEG-VANSPFVISLANTGQFGKNVSHFMNAIILAAVLSVCNSSVYAASRV 384

Query: 465 LLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQ 524
           +  L   G  P    Y+D+ GRPL  +          F       T+VF WL A+  ++ 
Sbjct: 385 IQALGACGQLPSVCGYIDKKGRPLVGIAICGVFGLLAFLVEYDNVTEVFNWLFALCSIAA 444

Query: 525 IFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVAL-V 583
             TW++IC+S +RFRR ++VQG    E+ + +  G+       ++  + +  + +VA+  
Sbjct: 445 FVTWWSICLSQLRFRRALKVQGLGKEEIAYESMMGIWSGVVGIVLNTMLICGEIYVAIHA 504

Query: 584 PMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRL-FIRAKNIDLISHRIIFDEELL 642
            ++ H+  A+ FFQ  +++P+++ +Y   +++ +++   F+RAK+IDL + +   D EL+
Sbjct: 505 SIDEHS--AKTFFQYCMSIPVMITVYAAHRIYNKNWHTWFVRAKDIDLSTGKKAEDIELM 562

Query: 643 RQEDEEYKEKLRNGPKWKRVVDFWC 667
           + E    + K+   P + R+  FWC
Sbjct: 563 KHEIMVSRAKIAASPLYYRIYRFWC 587

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  228 bits (582), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 155/561 (27%), Positives = 248/561 (44%), Gaps = 29/561 (5%)

Query: 93  ASSSTADENAVENYSMQEFDNDLENKKS--NLHIRDDELDYATVNVDSQPVEQQDENAQL 150
           +S  T  +   + + M  + N+ +N  S  N    DDE D               +  Q+
Sbjct: 9   SSPLTQGKTRSDEFQMYVYSNETQNGGSGHNSSFEDDEGDL--------------QEGQV 54

Query: 151 KQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELA 210
           K+ +KPRHV M++               PL+ AGP   +I Y  MG+ +Y + Q+ GE+A
Sbjct: 55  KRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYFVTQSMGEMA 114

Query: 211 VAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDX 270
             +  V  S   F +  + P F  A  ++Y   W     +E+      I+YWT  V    
Sbjct: 115 -TFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLAA 173

Query: 271 XXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKY 330
                            + Y E EF+    KV+ ++G+ + A+ I  G +   G IG +Y
Sbjct: 174 WIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGS-KQGPIGFRY 232

Query: 331 WNDPGAF-----RGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAK 385
           W +PG +      G     RF G +                 +TA E +NPRK +P A  
Sbjct: 233 WRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPRKTVPKAIN 292

Query: 386 KVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAV 445
           KV +R               VPYN   L   +S   ++SP+V++    G  ++    NAV
Sbjct: 293 KVFFRILFFYILSLFFVGLLVPYNHPGLDKHTSV-IASSPFVISIQSAGTRILPDIFNAV 351

Query: 446 ILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCAT 505
           +L++++S ANS  Y  SR+L  LA  G APK F YV   G P   ++C        F   
Sbjct: 352 VLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGLLAFLVV 411

Query: 506 SPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYY 565
                + F WL+ IS L+ +  W  I +SHIRF + ++ +G S  +L F+++    G+YY
Sbjct: 412 DDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYY 471

Query: 566 AAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRA 625
           AA  + + +  Q + A  P          FF  Y+++ +L  ++   +L+ R  R F R 
Sbjct: 472 AAFWVAVIIFVQGFQAFCP----KFKVAEFFTGYISLILLAVVFCLAQLYYRC-RFFNRL 526

Query: 626 KNIDLISHRIIFDEELLRQED 646
           ++ID+ S R   D  +  +E+
Sbjct: 527 EDIDIDSDRREIDALIWEEEE 547

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  228 bits (581), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 146/499 (29%), Positives = 234/499 (46%), Gaps = 15/499 (3%)

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
           E    + ++K+ +K RH+ M++               PL+ AGP   +I Y  MG+ +Y 
Sbjct: 59  EAGYHDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYF 118

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
           I Q+ GE+A  +  V  S   F    + P F  A  ++Y   W     +E+      I++
Sbjct: 119 ITQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQF 177

Query: 262 WTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAG 321
           WT+ V                     K Y E EF+    KV+ ++G+ I A+ I  G + 
Sbjct: 178 WTSAVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGS- 236

Query: 322 TDGYIGAKYWNDPGAFRGQTKIE------RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSN 375
           + G IG +YW +PG + G   I       RF G +                 +TA E +N
Sbjct: 237 SQGPIGFRYWRNPGPW-GPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 295

Query: 376 PRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGV 435
           PRK++P A  KV +R               VP+N D  + S+    ++SP+V++    G 
Sbjct: 296 PRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFN-DPRLASNVAVIASSPFVISIQNAGT 354

Query: 436 HVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXX 495
            V+ H  NAV++L+++S ANS  Y  SR+L  L+Q G APK F YV R+G P   ++   
Sbjct: 355 RVLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATS 414

Query: 496 XXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFR 555
                 F   +      F WL+ IS L+ +  W  I +SHIRF + ++ +G S  +L F+
Sbjct: 415 LLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFK 474

Query: 556 AQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLW 615
           A+    G+YYAA  + + +  Q + A  P      D   FF  Y+++ IL+ L +G +L+
Sbjct: 475 AKLMPWGAYYAAFFVTVIIFIQGFEAFSP----KFDVSGFFTAYISLIILVVLLIGCQLY 530

Query: 616 RRDFRLFIRAKNIDLISHR 634
            R  R   + ++ID+ + R
Sbjct: 531 YRC-RFLWKLEDIDIDTDR 548

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  228 bits (582), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 170/594 (28%), Positives = 272/594 (45%), Gaps = 33/594 (5%)

Query: 77  RFRNWLDSFKRAETPNASSSTADENAVE----NYSMQEFDNDLE---NKKSNLHIRDDEL 129
           +FRN L + K  +   ++S++     +E     Y  ++F +  E    KK+     DD +
Sbjct: 2   KFRNILKNEKNEKNEASASTSHASEDIEIIPSRYDNEKFYSATEATHKKKTGSTGFDDTI 61

Query: 130 DYA-TVNVDSQPVEQQD--------ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPL 180
               T++    P   +D         + ++K+ +K RH+ M++               PL
Sbjct: 62  SLTHTLSRSRIPTSMEDEDAEEAEVHDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPL 121

Query: 181 AQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVY 240
           + +GP   +I Y  MGT +Y + Q+ GE+A  +  V  S   F    + P F  A  ++Y
Sbjct: 122 SNSGPVGALIAYIFMGTIIYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMY 180

Query: 241 CIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCC 300
              W     +E+      I+YWT KV                     K Y E EF+    
Sbjct: 181 WFNWAITYAVEVSVIGQVIQYWTFKVPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASI 240

Query: 301 KVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIE------RFKGVMDXXX 354
           KV+ ++G+ I A+ I  G +   G IG +YW +PGA  G   I       RF G +    
Sbjct: 241 KVIAIVGYLIYALIIVCGGS-HQGPIGFRYWRNPGAM-GAGIISSDLGEARFLGWVSSLI 298

Query: 355 XXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM 414
                        +TA E +NPRK++P A  KV +R               VPYN D  +
Sbjct: 299 NAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIVLFYIMSLFFVGLLVPYN-DPRL 357

Query: 415 GSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYA 474
            +SS   ++SP+V++    G  V+    NAV+L++V+S ANS  Y  SR+L  LAQ G A
Sbjct: 358 SASSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTVISAANSNVYVGSRVLYALAQSGNA 417

Query: 475 PKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVS 534
           PK F YV R+G P   ++C        F   +      F WL+ IS L+ +  W  I ++
Sbjct: 418 PKQFAYVTRHGVPYLGVICTALLGLLAFLVVNHNANTAFNWLINISTLAGLCAWLFISLA 477

Query: 535 HIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAEN 594
           HIRF + ++ +G S  +L F+A+    G+YYA+  + + +  Q + A  P      D   
Sbjct: 478 HIRFMQALKFRGISRDDLPFKAKFMPWGAYYASFFVTVIIFIQGFQAFAP----KFDVSE 533

Query: 595 FFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEE 648
           FF  Y+++ +L+ L+ G +L+ R  R   + ++ID+ S R   D   +  ED+E
Sbjct: 534 FFTAYISLILLVVLFAGCQLYYRC-RFLWKLEDIDIDSDRREIDA--IVWEDDE 584

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  227 bits (579), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 158/572 (27%), Positives = 259/572 (45%), Gaps = 23/572 (4%)

Query: 75  NERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATV 134
           NE     +    + E  + S+   +E     Y  Q+ +  +  K S   I +D       
Sbjct: 2   NESVDMRMSKVSQYEINSISTIKEEELICARYDGQDTEEAVAGKSS---INNDSAK---- 54

Query: 135 NVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGI 194
             ++ P     +  ++K+ +K RH+ M++               PLA AGP   +I Y  
Sbjct: 55  ETETSP----RKGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLF 110

Query: 195 MGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 254
           MGT +Y + Q+ GE+A  +  V  SF+ F    + P       ++Y + W     LEL  
Sbjct: 111 MGTVIYSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSV 169

Query: 255 SSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAIC 314
               I+YWT  V                     K Y E EF     KV+ ++GF   + C
Sbjct: 170 LGQIIQYWTDAVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFC 229

Query: 315 INTGAAGTDGYIGAKYWNDPGAFR----GQTKIE-RFKGVMDXXXXXXXXXXXXXXXXLT 369
           I  GA  + G IG +YW +PGA+      + K E RF G +                 +T
Sbjct: 230 IVCGAGQSGGPIGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGIT 289

Query: 370 AAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLA 429
           A E +NPR+A+P A KKV  R               VPYN D  + S     S+SP++++
Sbjct: 290 AGEAANPRRAVPRAIKKVVVRILVFYILSLFFIGLLVPYN-DPKLDSEGTFVSSSPFMIS 348

Query: 430 ASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLR 489
               G  V+    NAV+L+++LS  NS  Y  SR+L  L++   AP++   V + G P  
Sbjct: 349 IENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYF 408

Query: 490 SMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSL 549
           ++L         F  TS     VF WLL I+G++  F W  I +SHIRF + ++ +G S 
Sbjct: 409 AVLSTSAFGFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISR 468

Query: 550 GELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALY 609
            +L +RA+     +YYA+  + L ++ Q + A  P    T    +F   Y+++ + +A++
Sbjct: 469 DDLPYRARMMPFLAYYASFFIALIVLIQGFTAFAP----TFQPIDFIAAYISVFLFIAIW 524

Query: 610 VGFKLWRRDFRLFIRAKNIDLISHRIIFDEEL 641
           + F++W +  R   + +++D+ S R   +E++
Sbjct: 525 LLFQVWFKC-RFVWKLQDVDIDSDRRDIEEQV 555

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  227 bits (579), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 147/509 (28%), Positives = 237/509 (46%), Gaps = 14/509 (2%)

Query: 144 QDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCII 203
           Q  + ++K+ +K RH+ M++               PL  +GP   +I Y  MG+ +Y I 
Sbjct: 95  QYHDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSIT 154

Query: 204 QACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWT 263
           Q+ GE+A  +  V  S   F    + P F  A  ++Y   W     +E+      I+YWT
Sbjct: 155 QSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWT 213

Query: 264 TKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTD 323
            KV                     K Y E EF+    KV+ + G+ + A+ I  G + + 
Sbjct: 214 KKVPLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGS-SQ 272

Query: 324 GYIGAKYWNDPGAFRG-----QTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRK 378
           G IG +YW +PG +            RF G +                 +TA E +NPRK
Sbjct: 273 GPIGFRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 332

Query: 379 AIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVV 438
           ++P A  KV +R               VPY+ D  + S S   ++SP+V++    G  ++
Sbjct: 333 SVPRAINKVVFRIALFYIMSLFFIGLLVPYD-DPRLSSDSAVVASSPFVISIQNAGTKIL 391

Query: 439 QHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXX 498
               NA+++++V+S ANS  Y  SR+L  LAQ G APK F YV R+G P   +LC     
Sbjct: 392 PDIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALG 451

Query: 499 XXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQT 558
              F   +      F WL+ IS L+ +  W  I +SHIRF + ++ +G S  +L F+A+ 
Sbjct: 452 LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKF 511

Query: 559 GVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRD 618
               +YYA   + + +  Q + A  P      D   FF  Y+++ IL  L++G +++ R 
Sbjct: 512 MPWAAYYATFFVTVIIFIQGFQAFSPH----FDVTAFFTAYISLIILAVLFIGCQIYYRC 567

Query: 619 FRLFIRAKNIDLISHRIIFDEELLRQEDE 647
            R F + ++ID+ + R    EE++ ++DE
Sbjct: 568 -RFFWKLEDIDIDTDRREI-EEVIWEDDE 594

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  226 bits (576), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 149/524 (28%), Positives = 241/524 (45%), Gaps = 20/524 (3%)

Query: 137 DSQPVEQQDEN----AQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGY 192
           D  P E + E      ++K+ +K RH+ M++               PL  AGP   +I Y
Sbjct: 43  DEFPEEHEQEGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAY 102

Query: 193 GIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLEL 252
             MGT +Y I Q+ GE+A  +  V  S   F    + P F  A  ++Y   W     +EL
Sbjct: 103 IFMGTVVYSITQSLGEMA-TFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVEL 161

Query: 253 VTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMA 312
                 I YWT+ V                     + Y E EF+    KV+ ++G+ I A
Sbjct: 162 SVVGQIINYWTSVVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYA 221

Query: 313 ICINTGAAGTDGYIGAKYWNDPGAF------RGQTKIERFKGVMDXXXXXXXXXXXXXXX 366
             +  G + + G IG + W +PG +        QT+  RF G +                
Sbjct: 222 FIVVCGGS-SQGPIGFRNWRNPGPWGTGVISSNQTE-ARFLGWVSSLIKAAFTYQGTELV 279

Query: 367 XLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPY 426
            +TA E  NPRK +P A  KV +R               VPYN  ++  +S    +ASP+
Sbjct: 280 GITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPF 339

Query: 427 VLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGR 486
           V++    G  ++    NAV+L++V+S ANS  Y  SR++  LAQ G APK F YV+R+G 
Sbjct: 340 VISIRNAGTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGV 399

Query: 487 PLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQG 546
           P+  ++         F   +      F WL+ IS L+ +  W  I ++HIRF + ++ +G
Sbjct: 400 PVLGVMVTALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRG 459

Query: 547 RSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILL 606
            S   L F+A+     +YYAA  +F+ +  Q + A  P      D   FF  Y+++ ++L
Sbjct: 460 ISRDALPFKAKFMPWAAYYAASFVFVIIFIQGYTAFSP----KFDVTQFFTAYISLMLML 515

Query: 607 ALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYK 650
            +++G +++ +  R   + ++ID+ ++R   D   +  ED+E K
Sbjct: 516 VVFIGCQIYYKC-RFLWKLEDIDIDTNRREIDA--IVWEDDEPK 556

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  226 bits (576), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 162/536 (30%), Positives = 250/536 (46%), Gaps = 19/536 (3%)

Query: 120 SNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXP 179
           S++ +  +  D+A    +S+  E      ++K+ +KPRHV M++               P
Sbjct: 47  SDVQVSSELYDHA----ESEEGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKP 102

Query: 180 LAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWV 239
           L+ +GP   +I Y  MG+ +Y + Q+ GE+A  +  V  S   F    + P F  A  ++
Sbjct: 103 LSLSGPVGSLIAYIFMGSVVYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFGVANGYM 161

Query: 240 YCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNC 299
           Y   W     +EL      I YWT  V                     K Y E EF    
Sbjct: 162 YWFNWAITYAVELSVLGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVAS 221

Query: 300 CKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIE-----RFKGVMDXXX 354
            KV+ ++G+ + A+ I  G + + G IG +YW +PG +   T  +     RF G +    
Sbjct: 222 IKVIAIVGYLLYALIIVCGGS-SQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLV 280

Query: 355 XXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM 414
                        +TA E SNPRK +P A  KV +R               VPYNS QL 
Sbjct: 281 NASFTYQGTELVGITAGEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLE 340

Query: 415 GSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYA 474
            S+S   ++SP+V++    G  V+    NAV+L+++LS  NS  Y  SR+L  LA  G A
Sbjct: 341 -SNSAVIASSPFVISIQNAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNA 399

Query: 475 PKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVS 534
           PK F YV + G P   ++C        F AT+      F WL+ IS L+ +  WF I V+
Sbjct: 400 PKQFSYVTKQGVPYLGVICTALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVA 459

Query: 535 HIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAEN 594
           HIRF + ++++G S   L F+A+    G+YYAA  + L +  Q + A  P      D   
Sbjct: 460 HIRFMQCLKLRGISRDSLPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFAP----RFDVSE 515

Query: 595 FFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYK 650
           FF  Y+++ +L+ L++  +L+ R  R   + ++ID+ S R   D   +  ED+E K
Sbjct: 516 FFTAYISLILLVVLFILCQLYYRC-RFLTKIEDIDIDSDRREIDA--IIWEDDEPK 568

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  225 bits (574), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 148/507 (29%), Positives = 232/507 (45%), Gaps = 16/507 (3%)

Query: 125 RDDELDYATVNVDSQPV---EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLA 181
           +D+ L    ++ DS  +   E     A++K+ +KPRHV M++               PL 
Sbjct: 45  KDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLW 104

Query: 182 QAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYC 241
            AGP   +I + ++GT  Y + Q+ GE+A  +  V  SF  F    + P    A  ++Y 
Sbjct: 105 NAGPVGSLIAFMLIGTLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFISPAVGAANGYMYW 163

Query: 242 IQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCK 301
             W     LEL      I+YWT  V  +                  K Y E EF+    K
Sbjct: 164 FSWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIK 223

Query: 302 VMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRG-----QTKIERFKGVMDXXXXX 356
           V+ +IGF I ++C+  GA G +G IG +YW  PG +            RF G +      
Sbjct: 224 VIAIIGFLIYSLCMVCGA-GPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISA 282

Query: 357 XXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGS 416
                      +TA E  NPRKA+P A  KV +R               VPYN  +L GS
Sbjct: 283 AFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGS 342

Query: 417 SSGGNSA-SPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAP 475
            +G   A SP+++A       V+ H  NAVIL +++S  NS  Y  SR+L GL++   AP
Sbjct: 343 DNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAP 402

Query: 476 KWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSH 535
           K+F    ++G P  ++L         +   S    +VF WLL I+ ++   TW  I +SH
Sbjct: 403 KFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISH 462

Query: 536 IRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENF 595
           IRF + ++ +G S  +L ++A+     +YYAA  + + ++ Q + A  P      +  +F
Sbjct: 463 IRFMQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAFAPH----FNVSDF 518

Query: 596 FQNYLAMPILLALYVGFKLWRRDFRLF 622
           F  Y+++ +   ++  F+   R  +LF
Sbjct: 519 FAAYISVFLFFIVWAIFQTIYRT-KLF 544

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  225 bits (573), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 154/572 (26%), Positives = 255/572 (44%), Gaps = 20/572 (3%)

Query: 89  ETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENA 148
           ET  A     D +A  + S     +  E K   + I  + +      V+S      +++ 
Sbjct: 8   ETYPAGKQHNDRSAESSESSDVLHHRKETKNEGIFINQENMS----EVESL---YGNDDP 60

Query: 149 QLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGE 208
            +K+ +KPRH+ M+S               P+  AGP   ++ Y  MGT  +C+ Q+ GE
Sbjct: 61  DVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGE 120

Query: 209 LAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDP 268
           +A  +  V  SF  +    + P    A  ++Y   W     LEL      I+YWT  V  
Sbjct: 121 MA-TFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAVPL 179

Query: 269 DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGA 328
                              + Y E EF+    KV+ + GF I A+ +  G + ++G +G 
Sbjct: 180 SVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGF 238

Query: 329 KYWNDPG----AFRGQTKIE-RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSA 383
           +YW +PG          K E RF G +                 +TA E  NPRK +P A
Sbjct: 239 RYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKA 298

Query: 384 AKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFIN 443
             KV +R               VPY   +L  +S    + SP+V+A    G  V+    N
Sbjct: 299 INKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVFN 358

Query: 444 AVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFC 503
            VIL+++LS  NS  Y  SR+L GL++ G AP  F   ++ G P  ++L         + 
Sbjct: 359 GVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYL 418

Query: 504 ATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGS 563
             S     VF WLL I+ ++  F W  I +SHIRF + ++ +G S  +L F+A+    G+
Sbjct: 419 NISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGA 478

Query: 564 YYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFI 623
           YYAA  + + ++ Q + +  P    +     F  +Y+++ + +  ++GF++  +  RL +
Sbjct: 479 YYAAFFITVIILIQGFDSFAPEFVFS----EFIADYISVFLFIVCWLGFQVLFKT-RLIL 533

Query: 624 RAKNIDLISHRIIFDEELLRQEDEEYKEKLRN 655
           R +++D+ + R   D  L+  +D+E K  L+ 
Sbjct: 534 RKEDVDIDTDRREID-ALVWSDDDEPKTLLQK 564

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  226 bits (575), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 149/507 (29%), Positives = 238/507 (46%), Gaps = 16/507 (3%)

Query: 149 QLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGE 208
            +K+ +K RH+ M++               PL+ AGP   +I Y  MGT +Y I Q+ GE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 209 LAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDP 268
           +A  +  V  S   F    + P F  +  ++Y   W     +E+      I+YWT KV  
Sbjct: 165 MA-TFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPL 223

Query: 269 DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGA 328
                              K Y E EF+    KV+ ++G+ I A+ I  G +   G IG 
Sbjct: 224 AAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGS-HQGPIGF 282

Query: 329 KYWNDPGAFR----GQTKIE-RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSA 383
           +YW +PGA+      + K E RF G +                 +TA E +NPRK +P A
Sbjct: 283 RYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 342

Query: 384 AKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFIN 443
             KV +R               VPYN  +L   SS   ++SP+V++    G + +    N
Sbjct: 343 INKVVFRIVIFYIMSLFFIGLLVPYNEPRL-SPSSAVIASSPFVISIQNAGTYALPDIFN 401

Query: 444 AVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFC 503
           AV+L++V+S ANS  Y  SR+L  LAQ G APK F YV + G P   +L         F 
Sbjct: 402 AVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFL 461

Query: 504 ATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGS 563
             +      F WL++IS L+ +  W  I ++HIRF + ++ +G S  +L F+A+    G+
Sbjct: 462 VVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGA 521

Query: 564 YYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFI 623
           YYA+  + + +  Q + A  P +        FF +Y+++ +L  +++  +L+ +  R   
Sbjct: 522 YYASFFVTIIIFIQGFQAFCPFSV-----SEFFTSYISLILLAVVFISCQLYYKC-RFIW 575

Query: 624 RAKNIDLISHRIIFDEELLRQEDEEYK 650
           + ++ID+ S R   + E +  ED+E K
Sbjct: 576 KLEDIDIDSDR--REIEAIIWEDDEPK 600

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  224 bits (572), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 148/510 (29%), Positives = 236/510 (46%), Gaps = 15/510 (2%)

Query: 146 ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQA 205
            +A++K+ +K RH+ M++               PL QAGP   +I Y  MGT +Y + Q+
Sbjct: 69  HDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQS 128

Query: 206 CGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK 265
            GE+A  +  V  SF  F    + P    A  ++Y   W     LEL      I+YWT  
Sbjct: 129 LGEMA-TFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYA 187

Query: 266 VDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGY 325
           V                     K Y E EF+    KV+ ++GF +  +C+  GA G  G 
Sbjct: 188 VPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGA-GVTGP 246

Query: 326 IGAKYWNDPG----AFRGQTKIE-RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAI 380
           +G +YW +PG        + K E RF G +                 ++A E +NPRKA+
Sbjct: 247 VGFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAV 306

Query: 381 PSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQH 440
           P A KKV +R               VPYN D L  + S   ++SP+++A    G  V+ H
Sbjct: 307 PRAIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSY-VASSPFIIAIKNSGTPVLPH 365

Query: 441 FINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXX 500
             NAVI  +++S  NS  Y  SR+L GL++   APK      + G P  ++L        
Sbjct: 366 IFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGAL 425

Query: 501 XFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGV 560
            +  TS    + F WLL I+ ++  FTW  I +SHIRF + ++ +G S  +L F+A    
Sbjct: 426 AYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMP 485

Query: 561 LGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFR 620
             +YYA+ ++F+ ++ Q + A  P         +F   Y+++ + + ++  F++  R  R
Sbjct: 486 GLAYYASFLMFVIIIIQGFTAFAP----KFSGSDFAAAYISIFLFIGIWCLFQIIFRC-R 540

Query: 621 LFIRAKNIDLISHRIIFDEELLRQEDEEYK 650
              + +++D+ + R   D E +  ED E K
Sbjct: 541 FIHKVEDVDIDTDR--RDIEAVVWEDAEPK 568

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  225 bits (573), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 150/528 (28%), Positives = 244/528 (46%), Gaps = 15/528 (2%)

Query: 126 DDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGP 185
            DE     +  D++  E   +  ++K+ +KPRHV M++               PL+ +GP
Sbjct: 91  QDEPSTDPLGSDTESGEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGP 150

Query: 186 APLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWL 245
              +I Y  MGT +Y + Q+ GE+A  +  V  S   F S  + P F  A  ++Y   W 
Sbjct: 151 VGALIAYIFMGTVVYFVTQSMGEMA-TFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWA 209

Query: 246 CVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMM 305
               +EL  +   I+YWT  V                     + Y E EF+    KV+ +
Sbjct: 210 ITFAVELSVTGQVIEYWTEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAI 269

Query: 306 IGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRG----QTKIE-RFKGVMDXXXXXXXXX 360
           +G+ I A+ I  G +   G IG +YW +PG +      + K E RF G +          
Sbjct: 270 VGYLIYALVIVCGGS-KQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTY 328

Query: 361 XXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGG 420
                  +TA E +NPR+ +P A  KV +R               VPYN   L  +++  
Sbjct: 329 QGTELVGITAGEAANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTV- 387

Query: 421 NSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDY 480
            ++SP+V++    G   +    NAV+L++++S ANS  Y  SR+L  LA  G APK F  
Sbjct: 388 IASSPFVISIQNAGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSS 447

Query: 481 VDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRR 540
           V   G P   ++         F   +    + F WL+ IS L+ +  W  I +SHIRF +
Sbjct: 448 VTPQGVPFMGVIVTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQ 507

Query: 541 GMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYL 600
            ++ +G S  +L F+++    G+YYAA  + + +  Q + A  P          FF +Y+
Sbjct: 508 CLKQRGISRDDLPFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPH----FKVTEFFTSYI 563

Query: 601 AMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEE 648
           ++ +L+ ++ G +L+ R  R F R ++ID+ S R   + + L  ED+E
Sbjct: 564 SLMLLVVVFCGAQLFYRC-RFFNRLEDIDIDSDRR--EADALIWEDDE 608

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  224 bits (572), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 163/610 (26%), Positives = 273/610 (44%), Gaps = 53/610 (8%)

Query: 82  LDSFKRAETPNASSSTADENAVENYSMQEFDNDLE------------------NKKSNLH 123
           +++  ++ T +   S  ++++++  S  + ++++E                  N K    
Sbjct: 4   VNNIIKSRTCDEKQSNFEKHSIQEVSTDQIEHEMEVIDAHDKLSSYCTDEKQYNMKKKRL 63

Query: 124 IRDDELDYATVNVDSQPVEQ-----------------QDENAQLKQTIKPRHVIMMSXXX 166
           ++DD +    +  +S P  Q                   E+  +K+ +K RH+ M++   
Sbjct: 64  LQDDAIASVNLITNSLPRSQIASHEVGDEEEDDEEEAHYEDKHVKRALKQRHIGMIALGG 123

Query: 167 XXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSF 226
                       PL++AGP   +I Y  MGT +Y I Q+ GE+A  +  V  S   F   
Sbjct: 124 TIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQSLGEMA-TFIPVTSSITVFSKR 182

Query: 227 LVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXG 286
            + P F  A  ++Y   W     +E+      I+YWT KV                    
Sbjct: 183 FLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLAVWIAIFWVLITLMNFFP 242

Query: 287 AKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIE-- 344
            K Y E EF+    KV+ ++G+ I A+ I  G +   G IG +YW +PGA+ G   I   
Sbjct: 243 VKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-HQGPIGFRYWRNPGAW-GPGIISSD 300

Query: 345 ----RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXX 400
               RF G +                 +TA E +NPRK +P A  KV +R          
Sbjct: 301 KNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLF 360

Query: 401 XXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYS 460
                VPYN  +L  SS+   ++SP+V++    G + +    NAV+L++V+S ANS  Y 
Sbjct: 361 FIGLLVPYNEPRLSASSAV-IASSPFVISIQNAGTYALPDIFNAVVLITVISAANSNVYV 419

Query: 461 SSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAIS 520
            SR+L  LAQ G APK F YV + G P   +L         F   +      F WL+ IS
Sbjct: 420 GSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFLVVNNNANTAFNWLINIS 479

Query: 521 GLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWV 580
            L+ +  W  I ++HIRF + ++ +G S  +L F+A+    G+YYAA  + + +  Q + 
Sbjct: 480 TLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQ 539

Query: 581 ALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEE 640
           A  P         +FF +Y+++ +L  ++ G +L+ +  R   + ++ID+ + R   + E
Sbjct: 540 AFCP-----FKVSDFFTSYISLILLAVVFTGCQLYYKC-RFIWKLEDIDIDTDR--REIE 591

Query: 641 LLRQEDEEYK 650
            +  ED+E K
Sbjct: 592 AIIWEDDEPK 601

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  222 bits (566), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 154/550 (28%), Positives = 254/550 (46%), Gaps = 19/550 (3%)

Query: 108 MQEFDNDLENKKSNLHIRDD----ELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMS 163
           MQ F+   +  K+ + + ++     L    +   SQ      +   +++ +KPRHV M++
Sbjct: 3   MQSFEKQPQLHKNEIKVMEEGESSSLADGVLEQQSQIDTASSQERGIQRALKPRHVSMIA 62

Query: 164 XXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTF 223
                          PL  AGP   +I Y  MG+  + + Q+ GE+A  +  V  SF  F
Sbjct: 63  LGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMA-TFIPVASSFTVF 121

Query: 224 PSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXX 283
               + P    A  ++YC  W     LEL      I+YWT  V                 
Sbjct: 122 TRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLGVPNAAWIIIFWVPISLSN 181

Query: 284 XXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPG----AFRG 339
               K Y E +F+    KV+ ++GF I  +C+  GA G  G +G +YW +PG        
Sbjct: 182 LVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGA-GKTGPVGFRYWRNPGPWGDGIIS 240

Query: 340 QTKIE-RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXX 398
           ++K E RF G +                 ++A E +NPRK +P A +KV  R        
Sbjct: 241 KSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRILLFYVGS 300

Query: 399 XXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAF 458
                  VP+N D  + S++  +++SP+++A    G   +    NAVIL +++S ANS  
Sbjct: 301 LFFIGLLVPFN-DPKLDSTANYSASSPFIIAIQNSGTRALPDIFNAVILTTIISAANSNV 359

Query: 459 YSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLA 518
           Y  SR+L GLA+ G APK    ++R+G P   +          + + S      F WLL 
Sbjct: 360 YVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGSAKAFDWLLN 419

Query: 519 ISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQF 578
           I+ ++  F W  I + HIRF + ++ QG S  +L F+A+    G+YYAA  + L ++ Q 
Sbjct: 420 ITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFILLIIIIQG 479

Query: 579 WVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFD 638
           + A  P      +  NFF  Y+++ + +A++V F++  +  RL  + +++D+ S R   +
Sbjct: 480 FTAFAP----KFNVSNFFAAYVSVFLFIAVWVIFQVIFKS-RLIHKVEDVDIDSDRREIE 534

Query: 639 EELLRQEDEE 648
            E+   ED+E
Sbjct: 535 AEV--WEDDE 542

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  221 bits (564), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 146/530 (27%), Positives = 235/530 (44%), Gaps = 21/530 (3%)

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
           + Q++   +K+ +K RH+ M++               PL  AGP   +I Y  MGT ++ 
Sbjct: 27  DDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFS 86

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
           + Q+ GE+   +  V  SF  F    + P F  A  ++Y   W     LEL      I++
Sbjct: 87  VTQSLGEMC-TFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQF 145

Query: 262 WTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAG 321
           WT  V                     + Y E EF+    KV+ ++GF I+        AG
Sbjct: 146 WTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGF-IIYGICIICGAG 204

Query: 322 TDGYIGAKYWNDPGAF-----RGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNP 376
             G +G +YW +PG +            RF G +                 +TA E   P
Sbjct: 205 VTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEP 264

Query: 377 RKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVH 436
           RK +P A KKV +R               VPYN  +L  + S   S+SP+++     G  
Sbjct: 265 RKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSY-VSSSPFIITIQNAGTK 323

Query: 437 VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXX 496
           ++ H  NAVIL++++S  NS  Y  SR+L GLA+   APK+F    + G P  ++L    
Sbjct: 324 ILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSM 383

Query: 497 XXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRA 556
                +  T+      FTWLL I G++  F W  I  SHIRF + ++ +G S  +L ++A
Sbjct: 384 FGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKA 443

Query: 557 QTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWR 616
                 +YYA   + + +V Q + +  P         NFF  Y+++ + +  +V F++W 
Sbjct: 444 MLMPWLAYYAVFFMVIIIVIQGFTSFAP----KFKVANFFAAYISVFLFIIFWVAFQIWF 499

Query: 617 RDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDFW 666
           +  RL  + +++DL + R   +EE+   + E+     +N   W R   FW
Sbjct: 500 KC-RLVWKLQDVDLDTDRRDIEEEVWSDDVED-----KNKNWWDR---FW 540

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  221 bits (563), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 150/546 (27%), Positives = 246/546 (45%), Gaps = 23/546 (4%)

Query: 104 ENYSMQEFD-----NDLENKKSN---LHIRDDELDYATVNVDSQPVEQQD--ENAQLKQT 153
           E   +Q+ D     ND ++  SN   L  R  +   ++   +    E+ +  E+  +K++
Sbjct: 10  EKSVIQDIDTIIDGNDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRS 69

Query: 154 IKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAY 213
           +K RH+ M++               PLA AGP   ++ Y  MGT ++ + Q+ GE+A  +
Sbjct: 70  LKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLGEMA-TF 128

Query: 214 SKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXX 273
             V  SF+ F    + P    A  ++Y + W     LEL      I++WT KV       
Sbjct: 129 IPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKVPLAAWIS 188

Query: 274 XXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWND 333
                         K Y E EF+    KV+ ++GF I ++CI  GA G  G IG +YW +
Sbjct: 189 IFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGA-GKTGPIGFRYWRN 247

Query: 334 PGA-----FRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVA 388
           PGA         T   RF G +                 +TA E +NPRKA+P A +KV 
Sbjct: 248 PGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVL 307

Query: 389 YRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILL 448
            R               VPYN  +L  + S   S+SP+++     G  V+ H  NAVIL 
Sbjct: 308 IRILLFYIGSLFFIGLTVPYNDPKLTSTDSY-VSSSPFIITIQNAGTRVLPHIFNAVILT 366

Query: 449 SVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPK 508
           +++S  NS  Y  SR+L  +A+ G APK+       G P  S+L         +   S  
Sbjct: 367 TIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTG 426

Query: 509 ETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAI 568
               F WLL I+G++  F W  I  SH+RF + ++ +G S  +L ++A      +YYA  
Sbjct: 427 GAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIF 486

Query: 569 MLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNI 628
            + + ++ Q + +  P         +F   Y+++ + L  +  F+++ R  R+  + +++
Sbjct: 487 FMVVIILIQGFTSFAPH----FSGRDFVAAYISVGLFLVFWGFFQIYFRC-RIIWKLEDV 541

Query: 629 DLISHR 634
           D+ + R
Sbjct: 542 DIDTDR 547

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  220 bits (561), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 146/529 (27%), Positives = 236/529 (44%), Gaps = 23/529 (4%)

Query: 143 QQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCI 202
           ++DE  ++K+ +  RH+ M++               PL  +GP   +I Y  +GT +Y +
Sbjct: 53  EKDEYHEVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSV 112

Query: 203 IQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYW 262
            Q+ GE+A  +  V  SF  F    + P    A  ++Y   W     LEL      I++W
Sbjct: 113 TQSLGEMA-TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFW 171

Query: 263 TTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGT 322
           T  V                     + Y E EF+    KV  ++GF I   CI  GA G 
Sbjct: 172 TFAVPLPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGA-GK 230

Query: 323 DGYIGAKYWNDPGAFRGQTKIE------RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNP 376
            G +G +YW +PG + G   I       RF G                   +TA E +NP
Sbjct: 231 TGPVGFRYWRNPGPW-GTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANP 289

Query: 377 RKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVH 436
           R+ +P A +KV +R               VPY+ D  + S +   S+SP+++A    G  
Sbjct: 290 RQTVPKAIRKVVFRILVFYILSLFFIGLLVPYD-DVKLKSENSYVSSSPFIIAIENSGTK 348

Query: 437 VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXX 496
           ++ H  N VIL++++S  NS  Y  SRLL GLA+ G  PK F    ++G P+ +++    
Sbjct: 349 ILPHIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSL 408

Query: 497 XXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRA 556
                F  TS    + F WLL + G++  F+W  I  +HIRF + +Q +G S  +L F+A
Sbjct: 409 FGALAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKA 468

Query: 557 QTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWR 616
           +     +YYA I++ + +  Q + A  P      D  NFF +Y+++ +    +  F+LW 
Sbjct: 469 KFMPYLAYYATIVMIIIIFFQGFTAFAP----KFDVLNFFASYISVFLFFIFWGSFQLWF 524

Query: 617 RDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVDF 665
           +  R   +  +ID+   R        R+ ++   +       W +  DF
Sbjct: 525 KC-RYVWKLVDIDIDKDR--------REIEDRVWQDTTPANLWGKFWDF 564

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  221 bits (562), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 152/569 (26%), Positives = 254/569 (44%), Gaps = 23/569 (4%)

Query: 107 SMQEFDNDLENKKSNLHIRDDELDYATVNVD--SQPVEQQDENAQLKQTIKPRHVIMMSX 164
           S     ++++NKK    I  ++    +V +D  ++  + +  + +LK+ +K RHV M++ 
Sbjct: 17  SFSNHSDNIDNKKEPFQIDIEKESTESVALDDTNEQFDGKCSDQRLKKDLKARHVSMIAI 76

Query: 165 XXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFP 224
                          LA AGP  ++I Y  +G  ++ ++   GE+A AY  ++G F ++ 
Sbjct: 77  GGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCIGEMA-AYIPLDG-FTSYA 134

Query: 225 SFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWT--TKVDPDXXXXXXXXXXXXX 282
           S   DP   FAV + Y +++  + P +L  +++ I+YW    KV+P              
Sbjct: 135 SRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIVLVVIVVI 194

Query: 283 XXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTK 342
              G K + E EF+ +  KV++M+G  I+   I  G   T   +G +YW  PGAF+  +K
Sbjct: 195 NTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDRLGFRYWKHPGAFKEYSK 254

Query: 343 -----IERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXX 397
                I RF   +                 + AAE  NPRK IP A K   +R       
Sbjct: 255 SIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNIPKAIKLTMWRIIIFYII 314

Query: 398 XXXXXXXXVPYNSDQLMGSSSGGNSA--SPYVLAASLHGVHVVQHFINAVILLSVLSVAN 455
                   V  N   L+ + +   SA  SP+V+A    G+  + H  NA +L+ V S  N
Sbjct: 315 TIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEALPHIFNACVLMFVFSACN 374

Query: 456 SAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTW 515
           S  Y +SR L  LA    APK F   +R G P  S+          + + S     +F +
Sbjct: 375 SDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFCLLAYMSVSSGSAKIFNY 434

Query: 516 LLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIM-LFLAL 574
            + +  ++ + TW +I +++I F R ++ QG       + A     G+Y++      LAL
Sbjct: 435 FVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPLQPYGAYFSLFFCCLLAL 494

Query: 575 VAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHR 634
           +  F V L     H  D  NF   Y+ +P+    Y G+K  ++      + + +DL S +
Sbjct: 495 IKNFTVFL----NHKFDYRNFITGYIGLPLFFICYFGYKFVKKT--KIRKPEEVDLFSFK 548

Query: 635 IIFD--EELLRQEDEEYKEKL-RNGPKWK 660
              D  EE  R +D    E++ +NG  W+
Sbjct: 549 AAIDQEEEDGRIKDAATAERIKKNGKNWE 577

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  219 bits (559), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 139/510 (27%), Positives = 239/510 (46%), Gaps = 17/510 (3%)

Query: 117 NKKSNLHIRDDELDYATVNVDSQPVEQQD---ENAQLKQTIKPRHVIMMSXXXXXXXXXX 173
           +KK   ++  + L   + + D+ P E+ +      ++K+ +KPRH+ M++          
Sbjct: 20  SKKLEDYVSSETLPIYSHSGDNAPCEKGEGDCRETEVKRALKPRHISMIALGGTIGTGLF 79

Query: 174 XXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFN 233
                PL+++GP   +I Y  +G+ +Y + Q+ GE+A  +  V  S   F    + P F 
Sbjct: 80  VGIASPLSESGPVGALIAYIFIGSIVYFVTQSLGEMA-TFIPVTSSITVFSKRFLSPAFG 138

Query: 234 FAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEA 293
            A  ++Y   W     +E+      I+YWT  V                     K Y E 
Sbjct: 139 VANGYMYWFNWAITYAVEIAVVGQVIQYWTDAVPLAAWIAIFWVLVTLANFFPVKFYGEV 198

Query: 294 EFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIE------RFK 347
           EF+    KV+ ++G+ I A+ I  G +   G IG +YW +PG + G   I       RF 
Sbjct: 199 EFWVASVKVIAIVGYLIYALVIVCGGS-HQGPIGFRYWRNPGPW-GPGIISKDVNEGRFL 256

Query: 348 GVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVP 407
           G +                 +TA E +NPRK +P A  KV +R               VP
Sbjct: 257 GWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLFFIGLLVP 316

Query: 408 YNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLG 467
           Y+ D  + +++   ++SP+V++    G  V+ H  NA+++++++S ANS  Y  SR+L  
Sbjct: 317 YD-DLRLSNTTAVIASSPFVISIQNAGTKVLPHIFNAIVMITIISAANSNVYVGSRVLYS 375

Query: 468 LAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFT 527
           LA  G APK F YV + G P   ++         F   +    + F WL+ IS L+ +  
Sbjct: 376 LALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLAFLVVNNNANEAFNWLVNISTLAGLCA 435

Query: 528 WFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNT 587
           W  I +SH+RF + ++ +G S  +L F+A+    G+YYAA  + + ++ Q + A  P   
Sbjct: 436 WLFISLSHVRFMQCLKHRGISREDLPFKAKLMPWGAYYAAFFIGVIIIIQGFKAFTP--- 492

Query: 588 HTLDAENFFQNYLAMPILLALYVGFKLWRR 617
                 +FF +Y+++ +L  L++G +L+ R
Sbjct: 493 -KFRVSDFFTSYISLILLAVLFLGCQLFYR 521

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  217 bits (553), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 148/492 (30%), Positives = 230/492 (46%), Gaps = 22/492 (4%)

Query: 179 PLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAW 238
           PLA AGP   +I Y  MGT +Y + Q+ GE+A  +  V  SF+ F    + P       +
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMA-TFIPVTSSFSVFAQRFLSPALGATNGY 77

Query: 239 VYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFN 298
           +Y + W     LEL      I+YWT  V                     K Y E EF   
Sbjct: 78  MYWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIA 137

Query: 299 CCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIE------RFKGVMDX 352
             KV+ ++GF I + C+  GA   DG IG +YW +PGA+ G   I       RF G +  
Sbjct: 138 SIKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAW-GPGIISSDKNEGRFLGWVSS 196

Query: 353 XXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQ 412
                          +TA E +NPRKA+P A KKV  R               VPYN D 
Sbjct: 197 LINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYN-DP 255

Query: 413 LMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVG 472
            + S     SASP++++    G  V+    NAV+L++++S  NS  Y  SR+L  L++  
Sbjct: 256 KLDSDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKND 315

Query: 473 YAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAIC 532
            AP++   V + G P  ++L         F  TS      F WLL I+G++  F W  I 
Sbjct: 316 LAPRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLIS 375

Query: 533 VSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDA 592
            SHIRF + +  +G S  +L ++A+     +YYA+  + L ++ Q + A  P    +   
Sbjct: 376 FSHIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAP----SFQP 431

Query: 593 ENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEK 652
            +F   Y+++ + +A++  F+LW +   + ++ +++D+ S R     E+   E++ + E 
Sbjct: 432 VDFVAAYISVFLFVAIWFSFQLWFKC-PIILKLQDVDIDSDR----REI---EEQVWIEP 483

Query: 653 LRNGPKWKRVVD 664
           LR   KW+ V D
Sbjct: 484 LRK-TKWQCVWD 494

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  219 bits (559), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 151/559 (27%), Positives = 259/559 (46%), Gaps = 29/559 (5%)

Query: 117 NKKSNLHIRDDELDYATVNVDSQPVEQQD--------ENAQLKQTIKPRHVIMMSXXXXX 168
           +KK  L I D + + +TV+   +  E+QD        E+ +L++ +K RH+ M++     
Sbjct: 46  DKKDGLDINDMD-NLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSI 104

Query: 169 XXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLV 228
                      L  AGP  + I Y  +G  ++  + A GE+A +Y  ++G F ++ S   
Sbjct: 105 GTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMA-SYIPLDG-FTSYASRYC 162

Query: 229 DPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK--VDPDXXXXXXXXXXXXXXXXG 286
           DP   FAV + Y  ++L + P +L  +++ I+YW  +  V+P                 G
Sbjct: 163 DPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIG 222

Query: 287 AKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKI--- 343
            K + E EF+ +  KV++MIG  I+   I  G   T   +G ++++ PGAF+  +K    
Sbjct: 223 VKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDG 282

Query: 344 --ERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXX 401
              +F   +                 + AAE +NPRK+IP A K   YR           
Sbjct: 283 SKGKFVAFVAVLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFL 342

Query: 402 XXXXVPYNSDQL--MGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFY 459
               V Y+   L    +S  G +ASPYV+A    G+  + H  NA +L+ V S  NS  Y
Sbjct: 343 LGMCVAYDDPLLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLY 402

Query: 460 SSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAI 519
            +SR L GLA    APK F   +R G P  S+L         + + S     +F + + +
Sbjct: 403 VASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNV 462

Query: 520 SGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYA-AIMLFLALVAQF 578
             +  + +W +I ++++ F R ++ Q        +RA     GSY+  A  + +A +  F
Sbjct: 463 VSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNF 522

Query: 579 WVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFD 638
            V L     H  D +NF   Y+ +P+ +  Y G+K  ++  +++ + + +DL + +   D
Sbjct: 523 TVFL----NHHFDYKNFITGYIGIPVFVISYFGYKFVKKT-KIW-KPEEVDLYTFKAAID 576

Query: 639 EELLRQE--DEEYKEKLRN 655
           EE  + +  D E +E+L+N
Sbjct: 577 EEEEQGKIADAERRERLKN 595

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  219 bits (557), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 149/527 (28%), Positives = 236/527 (44%), Gaps = 16/527 (3%)

Query: 83  DSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIR-DDELDYATVNVDSQPV 141
           D+ ++ +  ++S S +    + N S    ++DLE   ++   R  D  +    + D    
Sbjct: 30  DAKEKVDVISSSGSLSKRKRI-NRSRANSNSDLEGSAADGTARARDIDNADVDDDDYYMD 88

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
           E   + A++K+ +K RH+ M++               PL  AGP   +I Y  M T ++ 
Sbjct: 89  EGVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFS 148

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
           + Q+ GE+A  +  V  SF  F S  + P    A  ++Y   W     LEL      I++
Sbjct: 149 VTQSLGEMA-TFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQF 207

Query: 262 WTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAG 321
           WT  V                     K Y E EF+    KV+ +IGF I  +C+  GA G
Sbjct: 208 WTHAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGA-G 266

Query: 322 TDGYIGAKYWNDPGAFRGQTKIE------RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSN 375
             G +G +YW +PG + G   I       RF G +                 +TA E +N
Sbjct: 267 VTGPVGFRYWRNPGPW-GPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 325

Query: 376 PRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGV 435
           PRK +P A KKV +R               VPY+ ++L  + S   SASP+++A    G 
Sbjct: 326 PRKTVPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSY-ISASPFIIAIENSGT 384

Query: 436 HVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXX 495
            ++ H  NAVIL +++S  NS  Y  SR+L GLA+   APKWF Y  R G P  S+    
Sbjct: 385 KILPHIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTS 444

Query: 496 XXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFR 555
                 F   S      F WLL I  ++  F W  I ++H+RF + ++ +G S  +L F+
Sbjct: 445 SFGALAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFK 504

Query: 556 AQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAM 602
           A+     +YY+   + + ++ Q + A  P    T +  +F   Y+++
Sbjct: 505 ARFMPHLAYYSIFFMTIIIIIQGFTAFAP----TFNGSDFVAAYISI 547

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  218 bits (556), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 148/511 (28%), Positives = 239/511 (46%), Gaps = 18/511 (3%)

Query: 146 ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQA 205
           E+  +++ +K RH+ M++               PL+ AGP   +I Y  MGT +Y + Q+
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 206 CGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK 265
            GE+A  +  V  S   F    + P F  +  ++Y   W     +E+      I+YWTTK
Sbjct: 162 LGEMA-TFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTK 220

Query: 266 VDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGY 325
           V                     K Y E EF+    KV+ ++G+ I A+ I  G +   G 
Sbjct: 221 VPLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-KQGP 279

Query: 326 IGAKYWNDPGAFRGQTKIE------RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKA 379
           IG +YW +PGA+ G   I       RF G +                 +TA E +NPRK 
Sbjct: 280 IGFRYWRNPGAW-GPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 338

Query: 380 IPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQ 439
           +P A  KV +R               VPY +D  + +SS   ++SP+V++    G + + 
Sbjct: 339 VPRAINKVVFRIVLFYIMSLFFIGLLVPY-TDPRLSASSAVIASSPFVISIQNAGTYALP 397

Query: 440 HFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXX 499
              NA++L++V+S ANS  Y  SR+L  LAQ G APK F YV + G P   +L       
Sbjct: 398 DIFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGL 457

Query: 500 XXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTG 559
             F   +      F WL+ IS L+ +  W  I +SHIRF + +  +G S  +L F+A+  
Sbjct: 458 LAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFM 517

Query: 560 VLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDF 619
             G+YYA+  + + +  Q + +  P         +FF +Y+++ +L  ++ G +L+ +  
Sbjct: 518 PYGAYYASFFVTVIIFIQGFQSFCPFRV-----ADFFTSYISLILLAVVFTGCQLYYK-C 571

Query: 620 RLFIRAKNIDLISHRIIFDEELLRQEDEEYK 650
           R   + ++ID+ S R   + E +  ED+E K
Sbjct: 572 RFIWKLEDIDIDSDR--REIEAIIWEDDEPK 600

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  216 bits (551), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 157/574 (27%), Positives = 259/574 (45%), Gaps = 27/574 (4%)

Query: 89  ETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQD-EN 147
           E+ + S     ++ V+ +S    D+D+  KK N+     + D ++   D + +      +
Sbjct: 5   ESSSQSVPRQRKSGVQTFSTMSQDDDM--KKINII---QQTDASSTTEDEEMLNSGSVHD 59

Query: 148 AQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACG 207
           A++K+ +K RH+ M++               PL  +GP   +I Y  +GT  Y + Q+ G
Sbjct: 60  AEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLG 119

Query: 208 ELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVD 267
           E+A  +  V  SF  F S  + P    AV ++Y   W     LEL      + YWT  V 
Sbjct: 120 EMA-TFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAVP 178

Query: 268 PDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIG 327
                               K Y E EF+    KV+ ++GF I  +C+  GA G  G +G
Sbjct: 179 IAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGA-GVTGPVG 237

Query: 328 AKYWNDPGAF-RGQTK----------IERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNP 376
            +YW +PG +  G T             RF G  +                +TA E +NP
Sbjct: 238 FRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANP 297

Query: 377 RKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVH 436
           RK +P A KKV +R               VP++  +L    S   S+SP+++A    G  
Sbjct: 298 RKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDDSY-VSSSPFIIAIENSGTK 356

Query: 437 VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXX 496
           ++    NA+IL++++S  NS  Y  SR+L  LA+ G APK      + G P  S+L    
Sbjct: 357 ILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAV 416

Query: 497 XXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRA 556
                +  T+     VF WL+ I+ ++  + W  I +SHIRF + ++ +G S  +L F+A
Sbjct: 417 FGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKA 476

Query: 557 QTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWR 616
                 +YYA   + + ++ Q + A  P    T D  +FF  Y+++ +   ++  F+LW 
Sbjct: 477 NLMPGLAYYAVFCMVIIIIFQGFTAFTP----TFDVSDFFAAYISVILFFLIWGAFQLWF 532

Query: 617 RDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYK 650
           +  R   + +++D+ S+R   D E +  ED E K
Sbjct: 533 KC-RWIWKLEDVDIDSNRR--DVEKIIWEDPEPK 563

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  218 bits (554), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 139/517 (26%), Positives = 239/517 (46%), Gaps = 20/517 (3%)

Query: 150 LKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGEL 209
           LK+ ++ RHV M++                L+ AGPA + I Y  +G  ++  + A GE+
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 210 AVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK--VD 267
           A +Y  ++G F ++ S  VDP   FAV + Y  ++L +CP +L  +S+ I+YW  +  V+
Sbjct: 159 A-SYIPMDG-FTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVN 216

Query: 268 PDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIG 327
           P                 G K + E EF+ +  KV++M+G  ++   +  G       +G
Sbjct: 217 PGVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLG 276

Query: 328 AKYWNDPGAFRGQT-----KIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPS 382
            +YW  PGAF+  +      + +F   +                 + AAE  NPRK++P 
Sbjct: 277 FRYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPR 336

Query: 383 AAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSA--SPYVLAASLHGVHVVQH 440
           A K   +R               V YN  +L+ +   G SA  SP+V+A    G+ V+ H
Sbjct: 337 AVKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPH 396

Query: 441 FINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXX 500
             NA +L+ V S  NS  Y  SR L  LA  G AP  F      G P  S+         
Sbjct: 397 IFNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALL 456

Query: 501 XFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGV 560
            +   S     VF + + +  +  + +W  I +++I F R ++VQG    +  + A    
Sbjct: 457 AYMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQP 516

Query: 561 LGSYYA-AIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDF 619
            G+Y++ A  +F+A +  F V L     H+ D +NF   Y+ +P+ +  Y G+K  ++  
Sbjct: 517 YGTYFSLAWCVFIAFIKNFTVFL----GHSFDYKNFITGYIGLPVFVIFYFGYKFIKK-- 570

Query: 620 RLFIRAKNIDLISHRIIFDEELLRQE--DEEYKEKLR 654
              +++  +DL + + +FD++ +  +  D+E + +LR
Sbjct: 571 TKIVKSHEVDLFTGKEVFDQQEIEGKILDQEKQIRLR 607

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  216 bits (551), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 152/588 (25%), Positives = 262/588 (44%), Gaps = 38/588 (6%)

Query: 83  DSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVE 142
           DS+++      S+S      VEN  +   D D+ +++S+L+I                 +
Sbjct: 6   DSYRKDLEKIVSNSNTTSKDVENLDLSNQD-DISSQESHLNI-----------------D 47

Query: 143 QQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCI 202
            + +  +LK+ ++ RHV M++                L+ AGP  ++I Y  +G  +Y +
Sbjct: 48  GKHDGIRLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIV 107

Query: 203 IQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYW 262
           +   GE+A  Y  ++G F ++ S   DP   FAV + Y  ++L + P +L  +++ ++YW
Sbjct: 108 MTCLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYW 165

Query: 263 TT--KVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAA 320
            +  KV+P                 G K + E EF+ +  KV++M+   ++   I  G  
Sbjct: 166 VSREKVNPGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGG 225

Query: 321 GTDGYIGAKYWNDPGAFRGQTKI-----ERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSN 375
            +   +G +++ DPGAFR  ++       +F   +                 + AAE  N
Sbjct: 226 PSHDRLGFRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKN 285

Query: 376 PRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSA--SPYVLAASLH 433
           PR+ +P A K   YR               V YN   L+ +     SA  SP+V+A    
Sbjct: 286 PRRNVPRAIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNA 345

Query: 434 GVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLC 493
           G+ V+ H  NA +L+ V S  NS  Y +SR L GLA    APK F   ++ G P  S++ 
Sbjct: 346 GIPVLPHIFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLIL 405

Query: 494 XXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELG 553
                   +   S     VF + + +  +  + +W AI +++I F R ++ QG     L 
Sbjct: 406 CILFCLLAYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLA 465

Query: 554 FRAQTGVLGSYYAAIM-LFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGF 612
           + A     G+Y+A      +AL+  F V L     H  D +NF   Y+ +P+ +  + G+
Sbjct: 466 YAAPLASKGAYFALFFCCLIALIKNFTVFL----GHKFDYKNFITGYIGIPVFIICFFGY 521

Query: 613 KLWRRDFRLFIRAKNIDLISHRIIFD--EELLRQEDEEYKEKLRNGPK 658
           K  R     F++ +  DL + + + D  EE  +  D   KEK+ + PK
Sbjct: 522 KYIRGT--KFVKPEEADLYTFKELIDLEEEEGKLWDAAQKEKMESSPK 567

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  216 bits (550), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 141/505 (27%), Positives = 229/505 (45%), Gaps = 14/505 (2%)

Query: 120 SNLHIRDDELDYATVNVDSQPVEQQD--ENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXX 177
           S+ H+      ++    + +P   Q   ++A++K+ +K RH+ M++              
Sbjct: 57  SSRHLHGSHGSHSVSGDEDEPYVDQGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGIS 116

Query: 178 XPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVA 237
            PL  AGP   +I Y  M T ++ + Q+ GE+A  +  V  SF  F S  + P    A  
Sbjct: 117 TPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMA-TFIPVTSSFTVFSSRFISPSIGAANG 175

Query: 238 WVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFF 297
           ++Y   W     LEL      I++WT  V                     K Y E EF+ 
Sbjct: 176 YMYWFSWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWV 235

Query: 298 NCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAF-----RGQTKIERFKGVMDX 352
              KV+ ++GF I  +C+  GA G  G +G +YW +PG +       Q    RF G +  
Sbjct: 236 ASIKVIAIMGFLIYCLCMVCGA-GVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSS 294

Query: 353 XXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQ 412
                          +TA E +NPRK +P A KKV++R               VP++  +
Sbjct: 295 LINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPK 354

Query: 413 LMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVG 472
           L    S   S+SP+++A    G  V+ H  NAVIL +++S  NS  Y  SR++ GLA+  
Sbjct: 355 LSSDDSY-VSSSPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTK 413

Query: 473 YAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAIC 532
            AP+WF    ++G P  ++L         F   S      F WLL I G++  F W  I 
Sbjct: 414 LAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLIS 473

Query: 533 VSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDA 592
           ++H+RF + ++ +G S  +L F+A      +YYA   + + ++ Q + A  P    T + 
Sbjct: 474 IAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTAFAP----TFNG 529

Query: 593 ENFFQNYLAMPILLALYVGFKLWRR 617
            +F   Y+++ +   L+V F+L+ R
Sbjct: 530 SDFVAAYISVFLFFFLWVSFQLYFR 554

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  214 bits (545), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 154/583 (26%), Positives = 262/583 (44%), Gaps = 26/583 (4%)

Query: 98  ADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPR 157
            D+N V   S Q F +   + K +        D   V   +   + + +  +LK+ ++ R
Sbjct: 27  GDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGIRLKKALEAR 86

Query: 158 HVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVN 217
           HV M++                LA AGPA ++I Y  +G  ++ ++   GE+A AY  ++
Sbjct: 87  HVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFVMSCLGEMA-AYIPLD 145

Query: 218 GSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTT--KVDPDXXXXXX 275
           G F ++ +   DP   FAV + Y  ++  + P +L   ++ I+YW    KV+P       
Sbjct: 146 G-FTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITIL 204

Query: 276 XXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPG 335
                     G + + E E++ +  K+ +M+G  I+ + +  G       +G KYW +PG
Sbjct: 205 LVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGPNHEVLGFKYWKNPG 264

Query: 336 AFRG-QTKIE----RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYR 390
           AF+   T I     RF                     +  +E  NPRKA+P A K   YR
Sbjct: 265 AFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYR 324

Query: 391 XXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSAS--PYVLAASLHGVHVVQHFINAVILL 448
                          VP+N   L+ + S   SAS  P+V+A    G+ V+ H +NA IL+
Sbjct: 325 IIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAGIPVLPHIMNACILI 384

Query: 449 SVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPK 508
            V S ANS  Y +SR L GLA    AP+ F   ++ G P  S+L         +   S  
Sbjct: 385 FVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSG 444

Query: 509 ETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAI 568
            ++VFT+ +    +  + +W +I +++IRF +  +VQG     L +++     G++++  
Sbjct: 445 SSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLF 504

Query: 569 M-LFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKN 627
             + + L+  F   L      T D ++F   Y+ +P  +  Y+G+KLW +     I ++ 
Sbjct: 505 FCILIGLIKNFPAFL----GDTFDYKSFITGYIGIPTYIISYIGYKLWYK--TKIIPSEE 558

Query: 628 IDLISHR--IIFDEELLRQEDEEYKEKL-RNGPKWKRVVDFWC 667
           +DL+S +  +  +EE  +  DEE    L  +G   K     WC
Sbjct: 559 VDLVSFKEAVDLEEEEGKMLDEERAAHLAAHGKDLK-----WC 596

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  210 bits (535), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 158/599 (26%), Positives = 270/599 (45%), Gaps = 38/599 (6%)

Query: 85  FKRAETPNASSSTADENAVENYSMQEFDN---------DLENKKSNLHIRDDELDYATVN 135
           F      N+SS  +D +A   YS Q  DN         +++ +++N+  R       +  
Sbjct: 9   FTSTSPRNSSSLDSDHDAY--YSKQNPDNFPVKEQEIYNIDLEENNVSSRSSTSTSPSAR 66

Query: 136 VDSQPV-EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGI 194
            DS  V + +DEN +L++ +K RH+ M++                L   GP  ++I Y  
Sbjct: 67  DDSFAVPDGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAF 126

Query: 195 MGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 254
           +G  ++  +   GE+A +Y  ++G F ++ S  VDP   FA+ + Y  ++  + P +L  
Sbjct: 127 VGLLVFYTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTA 184

Query: 255 SSMTIKYWTTK--VDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMA 312
           +++ I+YW ++  V+P                 G K + E EF+ +  KVM+M+G  ++ 
Sbjct: 185 AALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLL 244

Query: 313 ICINTGAAGTDGYIGAKYWNDPGAFR--------GQTKIERFKGVMDXXXXXXXXXXXXX 364
             I  G       +G +YW DPGAF+        G+ K   F  V               
Sbjct: 245 FIIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVF---VYSLFSYTGIE 301

Query: 365 XXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSS--SGGNS 422
              +  +E  NPRK++P A K   YR               V YN  +L+ +   S   +
Sbjct: 302 LTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAA 361

Query: 423 ASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVD 482
           ASP+V+A    G+ V+ H  NA +L+ V S  NS  Y SSR L  LA  G APK F    
Sbjct: 362 ASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTS 421

Query: 483 RNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGM 542
           R G P  +++         +   S     +F + + +  +  I +W  I + +I F +  
Sbjct: 422 RWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKAC 481

Query: 543 QVQGRSLGELGFRAQTGVLGSYYAAIM-LFLALVAQFWVALVPMNTHTLDAENFFQNYLA 601
           + QG    +  + A     G+Y+A    + +AL+  F V L     H  D + F   Y+ 
Sbjct: 482 RAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFL----GHKFDYKTFITGYIG 537

Query: 602 MPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFD--EELLRQEDEEYKEKLRNGPK 658
           +P+ +  + G+KL  +     I++ ++DL + + I+D  EE  R +D+E +E+L++  K
Sbjct: 538 LPVYIISWAGYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGK 594

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  209 bits (531), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 139/498 (27%), Positives = 226/498 (45%), Gaps = 17/498 (3%)

Query: 124 IRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQA 183
           I+ + L++ T  V+S  + ++   + +K+ +KPRHV M+S               P+  A
Sbjct: 25  IKAEVLNHNTSEVES--LCEKPNQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNA 82

Query: 184 GPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQ 243
           GP   ++ Y  + T  YC+ Q+ GE+A  +  V  SF  F S  V P    A  ++Y + 
Sbjct: 83  GPVGSLLAYIFVATMAYCVTQSLGEMA-TFIPVTSSFTVFASRFVSPALGAANGYLYWLS 141

Query: 244 WLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVM 303
           W     LE+      I YW+  V                     K Y E EF+    KV+
Sbjct: 142 WCITFALEISVIGRLILYWSDAVPITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVI 201

Query: 304 MMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAF-----RGQTKIERFKGVMDXXXXXXX 358
            ++ F    + +  G +   G IG +YW DPG +       +    +F G +        
Sbjct: 202 AILCFLFYGLVVVCGGSKL-GRIGFRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAF 260

Query: 359 XXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM--GS 416
                    +TA E  NPR+ +P A   V +R               V Y+  QL+  GS
Sbjct: 261 TFQGTELVGVTAGETKNPRRTVPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGS 320

Query: 417 SSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPK 476
           ++  N ASP+V+A +  G  V+   +N VI+++++S  NS  Y  SR+L GL + G AP 
Sbjct: 321 TTNAN-ASPFVVAINAAGTKVLPDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPA 379

Query: 477 WFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHI 536
           +       G P  ++L         +   S K   VF WLL+I+ +S  FTW  I VSHI
Sbjct: 380 FISRTTSRGVPYVAVLATSMFGALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHI 439

Query: 537 RFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFF 596
           RF + ++ +G S  +L F+A+    G+YYAA  + + ++ Q + A  P +     A +F 
Sbjct: 440 RFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFVIVIILVQGFTAFTPFS-----AVDFV 494

Query: 597 QNYLAMPILLALYVGFKL 614
             Y++  I + +++ F+ 
Sbjct: 495 AYYISAFIFVVIWLLFQF 512

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  208 bits (530), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 158/603 (26%), Positives = 272/603 (45%), Gaps = 39/603 (6%)

Query: 84  SFKRAETPNAS---SSTADENAVENYSMQEFDN---------DLENKKSNLHIRDDELDY 131
           S K   T  AS   SS+ D +    YS Q  D+         +++ +++N+  R      
Sbjct: 2   SLKNVLTSAASPRNSSSLDSDRDAYYSKQNPDSFPVKEQEIYNIDLEENNVSSRSSTFTS 61

Query: 132 ATVNVDSQPV-EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVI 190
            +   DS  V + +DE  +L++ +K RH+ M++                L   GP  ++I
Sbjct: 62  PSARDDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLI 121

Query: 191 GYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPL 250
            Y  +G  ++  +   GE+A +Y  ++G F ++ S  VDP   FA+ + Y  ++  + P 
Sbjct: 122 AYAFVGLLVFFTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPN 179

Query: 251 ELVTSSMTIKYWTTK--VDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGF 308
           +L  +++ I+YW ++  V+P                 G K + E EF+ +  KV++M+G 
Sbjct: 180 QLTAAALVIQYWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGL 239

Query: 309 FIMAICINTGAAGTDGYIGAKYWNDPGAFR--------GQTKIERFKGVMDXXXXXXXXX 360
            ++   I  G       +G +YW DPGAF+        G+ K   F  V           
Sbjct: 240 ILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVF---VYSLFSY 296

Query: 361 XXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGG 420
                  +  +E  NPRK++P A K   YR               V YN  +L+ +    
Sbjct: 297 TGIELTGIVCSEAQNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKA 356

Query: 421 NSA--SPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWF 478
            SA  SP+V+A    G+ V+ H  NA +L+ V S  NS  Y SSR L  LA  G APK F
Sbjct: 357 LSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIF 416

Query: 479 DYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRF 538
              ++ G P  +++         +   S     +F + + +  +  I +W  I + +I F
Sbjct: 417 SKTNKWGVPYNALIFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYF 476

Query: 539 RRGMQVQGRSLGELGFRAQTGVLGSYYAAIM-LFLALVAQFWVALVPMNTHTLDAENFFQ 597
            +  + QG    +  + A     G+Y+A +  +F+AL+  F V L     H  D + F  
Sbjct: 477 DKACRAQGIDKSKFAYVAPGQRYGAYFALVFCIFIALIKNFTVFL----GHKFDYKTFIT 532

Query: 598 NYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFD--EELLRQEDEEYKEKLRN 655
            Y+ +P+ +  +VG+KL  +     I++ ++DL + + I+D  EE  + ED+E +E+L+ 
Sbjct: 533 GYIGLPVYVFSWVGYKLIYKT--KVIKSTDVDLYTFKEIYDREEEQGKIEDQEKEERLKK 590

Query: 656 GPK 658
             K
Sbjct: 591 NGK 593

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  208 bits (529), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 145/532 (27%), Positives = 235/532 (44%), Gaps = 23/532 (4%)

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
           + + E  +LK+ +K RHV M++                LA AGP  L I Y  +G  ++ 
Sbjct: 56  DGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFF 115

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
            +   GE+A A+  ++G F ++ S  VDP   FAV + Y  ++L +   +L   +M ++Y
Sbjct: 116 TMSCLGEMA-AFIPLDG-FTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQY 173

Query: 262 WTTK--VDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGA 319
           W  +  ++P                 G K + E EF+ +  KV++M+G  ++   I  G 
Sbjct: 174 WVDRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGG 233

Query: 320 AGTDGYIGAKYWNDPGAFR--------GQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAA 371
                 +G +YW DPG+F+              +F                     + AA
Sbjct: 234 GPNHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAA 293

Query: 372 EQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSA--SPYVLA 429
           E  NPRK IP A K   YR               V YN   L+ ++    SA  SP+V+A
Sbjct: 294 EAQNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVA 353

Query: 430 ASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLR 489
               G++++ H  N  +L  VLS ANS  Y +SR L  LA    APK+F   ++ G P  
Sbjct: 354 IENSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYW 413

Query: 490 SMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSL 549
           S+          +   S   ++VF + +    +  + +W  I V++I F +  + QG   
Sbjct: 414 SLAFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDK 473

Query: 550 GELGFRAQTGVLGSYYAAIM-LFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLAL 608
               + A     G+Y+A      LALV  F V L        D +NF   Y+ +P+    
Sbjct: 474 SNFTYVAPWQPYGAYFALFFCCVLALVKNFTVFL----GGQFDYKNFITGYIGIPVFFIC 529

Query: 609 YVGFKLWRRDFRLFIRAKNIDLISHRIIFD--EELLRQEDEEYKEKLRNGPK 658
           +VG+K+  +      R + +DL++ + + D  EE  + ED E +E+L+NG K
Sbjct: 530 FVGYKIVYKTKTH--RPEEVDLVTLKALIDQEEEDGKIEDAEREERLKNGNK 579

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  206 bits (525), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 150/564 (26%), Positives = 249/564 (44%), Gaps = 22/564 (3%)

Query: 92  NASSSTADENAVENYSMQEFDNDL-----ENKKSNLHIRDDELDYATVNVDSQPVEQQDE 146
           ++S    D+ ++    ++E+D  +     EN      + D+E D    +VD +  E +  
Sbjct: 15  DSSKENTDKPSLNETYVKEYDRSISSPPKENDGYGYRV-DNEYDVDD-SVDGEKGEVR-- 70

Query: 147 NAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQAC 206
           + ++K+ +KPRH+ M++               PL  AGP  ++I Y  M T  + ++Q+ 
Sbjct: 71  STEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQSL 130

Query: 207 GELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKV 266
           GE+A  Y  V  +F+ F    + P F  A  ++Y   W     LEL      ++YWT KV
Sbjct: 131 GEMA-TYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWTFKV 189

Query: 267 DPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYI 326
                                K Y E EF+    KV+ ++GF I    +  GA G  G +
Sbjct: 190 PVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCGA-GKTGPV 248

Query: 327 GAKYWNDPGAFR----GQTKIE-RFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIP 381
           G +YW    AF      + K E RF G +                 +TA E +NPRK +P
Sbjct: 249 GFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 308

Query: 382 SAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHF 441
            + K+  +R               VP+N   L  S S   S SP++LA    G   +   
Sbjct: 309 KSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAAS-SPFILAIKNSGTKALPDI 367

Query: 442 INAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXX 501
            NAVIL +V+S ANS  Y  SR++  +A+   AP       + G P  ++L         
Sbjct: 368 FNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAIGALA 427

Query: 502 FCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVL 561
           +  TS    +VF WL+ I+G++  F+W+ I  SH+RF + ++ +G S  +L F+A     
Sbjct: 428 YLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKASFMPW 487

Query: 562 GSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRL 621
            + Y+   + L ++ Q +    P       A +F  +Y+++ +   ++  F++W R   L
Sbjct: 488 IAIYSFFFMTLIILVQGFTCFTPH----FQASDFVASYISVGLFFVIWAVFQIWFRC-PL 542

Query: 622 FIRAKNIDLISHRIIFDEELLRQE 645
            +    ID+ + R   D E+   E
Sbjct: 543 LVPIAEIDIDTDRRDVDAEVWEDE 566

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  205 bits (521), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 147/547 (26%), Positives = 248/547 (45%), Gaps = 34/547 (6%)

Query: 125 RDDELDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAG 184
           RDD    A         + +DEN +LK+ +K RH+ M++                L   G
Sbjct: 64  RDDSFAIA---------DGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGG 114

Query: 185 PAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQW 244
           P  ++I Y  +G  ++  +   GE+A +Y  ++G F ++ S  VDP   FA+ + Y  ++
Sbjct: 115 PVAMLIAYAFVGLLVFFTMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKY 172

Query: 245 LCVCPLELVTSSMTIKYWTTK--VDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKV 302
             + P +L  +++ I+YW ++  V+P                 G K + E EF+ +  KV
Sbjct: 173 FILPPNQLTAAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKV 232

Query: 303 MMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFR-------GQTKIERFKGVMDXXXX 355
           M+M+G  ++   I  G       +G +YW DPGAF+       G T   +F   +     
Sbjct: 233 MVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSTG--KFTSFVAVFVY 290

Query: 356 XXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMG 415
                       +  +E  NPRK++P A K   YR               V YN  +L+ 
Sbjct: 291 SLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLS 350

Query: 416 SS--SGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGY 473
           +   S   +ASP+V+A    G+ V+ H  NA +L+ V S  NS  Y SSR L  LA  G 
Sbjct: 351 TKGKSMSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGK 410

Query: 474 APKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICV 533
           APK F    + G P  +++         +   S     +F + + +  +  I +W  I +
Sbjct: 411 APKIFAKTSKWGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILI 470

Query: 534 SHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYA-AIMLFLALVAQFWVALVPMNTHTLDA 592
            +I F +  + QG    +  + A     G+Y+A +  + +AL+  F V L     H  D 
Sbjct: 471 VYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFL----GHKFDY 526

Query: 593 ENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFD--EELLRQEDEEYK 650
           + F   Y+ +P+ +  + G+KL  +     I++ ++DL + + I+D  EE  R +D+E +
Sbjct: 527 KTFITGYIGLPVYILSWAGYKLIYKT--KVIKSTDVDLYTFKEIYDREEEEGRIKDQERE 584

Query: 651 EKL-RNG 656
           E+L RNG
Sbjct: 585 ERLQRNG 591

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  204 bits (518), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 144/533 (27%), Positives = 241/533 (45%), Gaps = 23/533 (4%)

Query: 141 VEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLY 200
           ++ +D+  +LK+ +K RH+ M++                L  AGPA ++I Y  +GT ++
Sbjct: 73  MDGKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVF 132

Query: 201 CIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIK 260
             + A GE+A AY  ++G F ++ S   DP   FAV + Y  ++  + P +L  +++ I+
Sbjct: 133 FTMAALGEMA-AYIPLDG-FTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQ 190

Query: 261 YWTTK--VDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTG 318
           YW  +  V+P                 G K + E EF+ +  K+M+MIG  I    I  G
Sbjct: 191 YWVDRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLG 250

Query: 319 AAGTDGYIGAKYWNDPGAFR----GQTKIE----RFKGVMDXXXXXXXXXXXXXXXXLTA 370
                  +G +YW  PGAF+        IE    +F   ++                + A
Sbjct: 251 GGPNHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVA 310

Query: 371 AEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSA--SPYVL 428
           AE  NPR+ IP A K   +R               V Y+   L+ +++   SA  SP+V+
Sbjct: 311 AEAENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVV 370

Query: 429 AASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPL 488
           A    GV V+ H  N  +L+ V S  NS  Y  +R L  LA  G APK F   +R G P 
Sbjct: 371 AIQNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPY 430

Query: 489 RSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRS 548
            +M          +   S    ++F + + +  +  + +W +I ++ I F R ++ QG  
Sbjct: 431 NAMGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGID 490

Query: 549 LGELGFRAQTGVLGSYYAAIM-LFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLA 607
                + A     GSY+A    + LAL+  F V L     +  D + F   Y+ +P+   
Sbjct: 491 RSTFAYVAPFQPYGSYFALFFCVLLALIKNFSVFL----GNEFDYKTFITGYIGLPVYAF 546

Query: 608 LYVGFKLWRRDFRLFIRAKNIDLISHRIIFD--EELLRQEDEEYKEKLRNGPK 658
            ++G+KL+ +     ++    DL S++   D  EE  + ++ E KE+L++G K
Sbjct: 547 SFIGYKLYYKTKT--VKPHEADLNSYKAAVDREEEEGKIKEAERKERLKHGKK 597

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  201 bits (512), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 143/539 (26%), Positives = 232/539 (43%), Gaps = 16/539 (2%)

Query: 118 KKSNLHIRDDELDYATVNVDSQPVEQQDEN----AQLKQTIKPRHVIMMSXXXXXXXXXX 173
           KK      D EL   T      P +  +E      ++K+ +K RH+ M++          
Sbjct: 19  KKGKTLENDIELQSVTPATGEFPEDHTEEGDYQETEVKRALKARHISMIALGGTIGTGLF 78

Query: 174 XXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFN 233
                PL  AGP   ++ Y  +GT +Y I Q+ GE+A  +  V  S   F    + P F 
Sbjct: 79  IVIASPLRTAGPVGSLLAYIFIGTVVYSITQSLGEMA-TFIPVTSSVTVFSKRFLSPAFG 137

Query: 234 FAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEA 293
            A  ++Y   W     +EL      I+YWT +V                     + Y E 
Sbjct: 138 VANGYMYWFNWAITFAVELSVVGQIIQYWTDRVPIAAWIVIFWVLVTLVNFFPVRFYGEI 197

Query: 294 EFFFNCCKVMMMIGFFIMAICINTGAA-----GTDGYIGAKYWNDPGAFRGQTKIERFKG 348
           EF+    KV+ ++G+ I A  I  G +     G     G        + R   K   F G
Sbjct: 198 EFWIASVKVLTIVGYLIYAFIIVCGGSKQGPIGLPATGGIPARGARASSRTTRKRHGFLG 257

Query: 349 VMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPY 408
            +                 +TA E +NPRK +P A  KV +R               VPY
Sbjct: 258 WVSSLIKAAFTYQGTELVGITAGESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPY 317

Query: 409 NSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGL 468
           +  +L   SS   +ASP+V++    G  ++    NAV+L++V+S ANS  Y  SR+   L
Sbjct: 318 DDPRLNSESSTDVNASPFVISIKNAGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSL 377

Query: 469 AQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTW 528
           A  G APK   +V + G P   +L         F   +   +  F WL+ IS L+ +  W
Sbjct: 378 ALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAW 437

Query: 529 FAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTH 588
             I ++HIRF + ++ +G S  +L F+A+     +YYA   + + +  Q + A  P    
Sbjct: 438 LFISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGYTAFTP---- 493

Query: 589 TLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDE 647
             D   FF +Y+++ ++L +++G +++ +  R     ++ID+ S R   D  ++ +EDE
Sbjct: 494 KFDVTTFFTSYISLFLMLLVFIGCQIYYKC-RFLWAVEDIDIDSDRREID-AIVWEEDE 550

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  201 bits (512), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 142/528 (26%), Positives = 240/528 (45%), Gaps = 21/528 (3%)

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
           + +DE  +L++ +K RH+ M++                L   GP  ++I YG +G  ++ 
Sbjct: 72  DGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFF 131

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
            +   GE+A +Y  ++G F ++ S  VDP   FA+ + Y  ++  + P +L  +++ I+Y
Sbjct: 132 TMACLGEMA-SYIPLDG-FTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQY 189

Query: 262 WTTK--VDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGA 319
           W ++  V+P                 G + + E EF+ +  KVM+M+G  ++   I  G 
Sbjct: 190 WVSRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGG 249

Query: 320 AGTDGYIGAKYWNDPGAFRG-QTKIE----RFKGVMDXXXXXXXXXXXXXXXXLTAAEQS 374
                 +G +YW DPGAF+   T I     +F                     +  +E  
Sbjct: 250 GPDHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAK 309

Query: 375 NPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSA--SPYVLAASL 432
           NPRK++P A K   YR               V YN  +L+ +     SA  SP+V+A   
Sbjct: 310 NPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQN 369

Query: 433 HGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSML 492
            G+ V+ H  N  +L+ V S  NS  Y SSR L  LA  G APK F    + G P  +++
Sbjct: 370 SGIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALM 429

Query: 493 CXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGEL 552
                    +   S     +F + + +  +  I +W  I + +I F R  + QG    + 
Sbjct: 430 VSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKF 489

Query: 553 GFRAQTGVLGSYYAAIM-LFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVG 611
            + A     G+Y+A    + +AL+  F V L     HT D + F   Y+ +PI +  +VG
Sbjct: 490 AYVAPGQRYGAYFALFFCILIALIKNFTVFL----GHTFDYKTFITGYIGLPIYVFSWVG 545

Query: 612 FKLWRRDFRLFIRAKNIDLISHRIIFD--EELLRQEDEEYKEKL-RNG 656
           +KL  +     ++  + DL + + I+D  EE  + +D+E +E+L RNG
Sbjct: 546 YKLIYKT--KVVKPADADLYTLKEIYDREEEQGKLQDQEKEERLQRNG 591

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  198 bits (503), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 148/543 (27%), Positives = 249/543 (45%), Gaps = 31/543 (5%)

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
           + + +  +LK+ ++ RHV M++                L+QAGP  ++I Y IMG  ++ 
Sbjct: 50  DGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFT 109

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
           ++   GE+A AY  ++G F ++ +   DP   FAV + Y  ++L + P +L  +++ ++Y
Sbjct: 110 VMSCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQY 167

Query: 262 WTT--KVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGA 319
           W    KV+P                 G K + E EF+ +  KV++M+    + + +  G 
Sbjct: 168 WVGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGG 227

Query: 320 AGTDGYIGAKYWNDPGAFR----------GQTKIERFKGVMDXXXXXXXXXXXXXXXXLT 369
             +   +G +YW DPG F+          G+ K   F  V                  + 
Sbjct: 228 GPSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVF---VYALFAYLGTELCGIV 284

Query: 370 AAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSA--SPYV 427
           AAE  NPR+ +P A K   YR               V YN   L+ +     SA  SPYV
Sbjct: 285 AAECKNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYV 344

Query: 428 LAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRP 487
           +A    G+ V+ H  NA +L  V S  NS  Y  SR L GLA    APK F   +  G P
Sbjct: 345 VAIKNAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVP 404

Query: 488 LRSM-LCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQG 546
             S+ LC           +S  ET +F++ + ++ +  + +W +I +++I F R  +VQG
Sbjct: 405 YNSLALCTLFCCLAYMNVSSSAET-MFSYFVNVTSIFGLLSWISILITYISFDRAFRVQG 463

Query: 547 RSLGELGFRAQTGVLGSYYA-AIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPIL 605
                L ++A    + ++ A    L +ALV  F V L      T D + F   Y+ +P+ 
Sbjct: 464 IDKNTLSYQAPFQPVTAWIALGFCLMVALVKNFTVFL----GDTFDYKTFITGYIGIPVY 519

Query: 606 LALYVGFKLWRRDFRLFIRAKNIDLISHRIIFD--EELLRQEDEEYKEKLR-NGPKWKRV 662
           +  +V +K+  +    +I++ N+DL +++   D  EE  + E    KE+ + +G  WK+ 
Sbjct: 520 ILCFVCYKIVHKT--KWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQF 577

Query: 663 VDF 665
            D+
Sbjct: 578 YDY 580

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  197 bits (500), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 143/543 (26%), Positives = 241/543 (44%), Gaps = 29/543 (5%)

Query: 127 DELDYATVNVDSQPVEQQ-----DENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLA 181
           D+L+     V+ Q +E       D ++ +K+ +K RH+ +++                L 
Sbjct: 14  DKLEPKIAEVELQRLETDSLNEFDPHSGVKRALKNRHISLLALGGIIGPGCLIGAGNALN 73

Query: 182 QAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYC 241
           + GP  L++G+GI+G   + I+++ GEL   Y    G F T        G +    + Y 
Sbjct: 74  KGGPLALLLGFGIIGLVCFSIMESIGELVTLYPS-GGGFITLARRFHSEGLSAVSGYAYI 132

Query: 242 IQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCK 301
           + +  V   E  T S  +++W  +V                   G   + E E++    K
Sbjct: 133 VVFFAVLANEYNTISSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFK 192

Query: 302 VMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXX 361
           ++ ++ F+I +I   +G       IG +YW +PGA         F+G+            
Sbjct: 193 ILGLVAFYIFSIVYMSGGIPGKPPIGFQYWKNPGALS-----HGFRGIAVVFVFCSTFYS 247

Query: 362 XXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGN 421
                 L A E  NPRKA+P A ++  +R               VPYN D  +G+ +  +
Sbjct: 248 GTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYN-DPTLGAQTK-S 305

Query: 422 SASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYV 481
             SP  +A S  G     H +NA IL++ +S  NS+ Y  SR L  LA  G AP+   + 
Sbjct: 306 LKSPISIALSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWT 365

Query: 482 DRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRG 541
           D+ G P+ +++             S   ++ + +++ +SG+     W AI ++H+RFR+ 
Sbjct: 366 DKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKA 425

Query: 542 MQVQGRSLGELGFRAQTGVLGSYYA-AIMLFLALVAQFWVALVPMNTHTLDAENFFQNYL 600
              QGRSL EL +RA      + ++ A  +FLAL+ Q W +LVP       A++F   Y+
Sbjct: 426 WVAQGRSLSELPYRALFYPWTTIFSLAANIFLALI-QGWTSLVP-----FVAKDFVDAYI 479

Query: 601 AMPILLALYVGFKLWR-RDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKW 659
            +P    LYVG   W+ R+F      K +++  H I  +E   R  DE+  ++    PK 
Sbjct: 480 LLPAAGLLYVGINFWKNRNF------KTVNI--HGINLEEGQRRDLDEDSDDETGTAPKS 531

Query: 660 KRV 662
            R+
Sbjct: 532 TRM 534

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  195 bits (496), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 141/539 (26%), Positives = 244/539 (45%), Gaps = 24/539 (4%)

Query: 142 EQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYC 201
           + + E  +LK+ ++ RHV M++                L +AGP  ++I Y IMG  ++ 
Sbjct: 51  DGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFT 110

Query: 202 IIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKY 261
           ++   GE+A AY  ++G F ++ +   DP   FAV W Y  ++L + P +L   ++ I++
Sbjct: 111 VMSCLGEMA-AYIPLDG-FTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQF 168

Query: 262 W--TTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGA 319
           W    +V P                 G + + E EF+ +  KV++M+   I+ + +  G 
Sbjct: 169 WIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGG 228

Query: 320 AGTDGYIGAKYWNDPGAFRGQTK--------IERFKGVMDXXXXXXXXXXXXXXXXLTAA 371
             T   +G +YW+DPGAF+  +K        + +F   +                 + AA
Sbjct: 229 GPTHDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAA 288

Query: 372 EQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLM--GSSSGGNSASPYVLA 429
           E  +PR+ +P A K   YR               V YN   LM   S+    +ASPYV+A
Sbjct: 289 ECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVA 348

Query: 430 ASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLR 489
                + V+ +  NA +L  V S  NS  Y  SR L GLA  G APK F   ++ G P  
Sbjct: 349 IENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYN 408

Query: 490 SMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSL 549
           ++ C        + + S      F + + ++ +  + +W +I +++I F R  + QG   
Sbjct: 409 ALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPK 468

Query: 550 GELGFRAQTGVLGSYYAAIM-LFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLAL 608
             L + A       + A I  +F+AL+  F   +       +D   F   Y+ +PI +  
Sbjct: 469 STLSYVAPCQPYAGWVALIFCIFVALIKNFDAFI----GKEVDVPTFITGYIGLPIYIFC 524

Query: 609 YVGFKLWRRDFRLFIRAKNIDLISHR--IIFDEELLRQEDEEYKEKL-RNGPKWKRVVD 664
           ++G+K+  +    +I +K +DL + +  I  +EE   +E    KE+L + G  WK++ D
Sbjct: 525 FIGYKIVHKT--KWIPSKEVDLFTFKEAIDLEEEECIRERALMKEQLAKGGLSWKKIYD 581

>NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON} 
          Length = 170

 Score =  182 bits (463), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 80/134 (59%), Positives = 107/134 (79%)

Query: 529 FAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTH 588
           F ICVSH+RFRR + VQ +  GELGF++Q GV GS YAAIM    L+AQFWV + P+   
Sbjct: 37  FVICVSHVRFRRAVHVQSKPTGELGFKSQVGVWGSSYAAIMTICILIAQFWVVIAPIGDG 96

Query: 589 TLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEE 648
            L+ +N F+NYLAMPILLALY G+K++ +++ +FI+AK+IDLISHR IFDEE+++QE++E
Sbjct: 97  KLETKNLFENYLAMPILLALYFGYKIYTKNWTIFIKAKDIDLISHRNIFDEEIIKQEEDE 156

Query: 649 YKEKLRNGPKWKRV 662
           Y+ KLRNGP W+RV
Sbjct: 157 YRGKLRNGPIWRRV 170

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  194 bits (492), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 140/534 (26%), Positives = 232/534 (43%), Gaps = 19/534 (3%)

Query: 107 SMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQ-QDENAQLKQTIKPRHVIMMSXX 165
           S QEF N ++  KSN    ++    +  N++SQ  +   D    LK+ +  RH+ +++  
Sbjct: 12  SKQEF-NGMKEVKSN----EETYRTSHSNLESQNSDVVSDYEHNLKKGLSNRHIQLIALG 66

Query: 166 XXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPS 225
                         L Q GPAPL + + I+ T +YCI+    E+ V Y    GS     +
Sbjct: 67  GCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEM-VCYLPQQGSVPELVT 125

Query: 226 FLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXX 285
             VDP   FA  W Y   +  +   EL  ++  ++YWT +V                   
Sbjct: 126 RYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQVPQGVWITIFLIVVVVLNFS 185

Query: 286 GAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIER 345
             + Y E+EF+F   K++ ++   +++I I  G A     +G +YW +PGAF        
Sbjct: 186 AVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFGYHITGGN 245

Query: 346 FKGVMDXXXXXXXXXXXXXX----XXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXX 401
               +D                    L   E  + R+ I  A+++  YR           
Sbjct: 246 LGRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRIIFFYLSSSLM 305

Query: 402 XXXXVPYNSDQLMGS---SSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAF 458
               V  N   L+ +   +  G ++SP+V   +  G+ V+ H IN  IL S  S  NS F
Sbjct: 306 IGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILTSAWSAGNSFF 365

Query: 459 YSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLA 518
           Y+SSR +L L++ G APK F  ++R G P  ++          +   S   + VF WL  
Sbjct: 366 YASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSSTSSKVFQWLSN 425

Query: 519 ISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQF 578
           I  +S    WF I V++IRFR+ +    R L  + +R+      +Y+  I++ +  +   
Sbjct: 426 ICTISGFIGWFLIGVAYIRFRKAILFN-RLLDRIPYRSPLQPFSAYFFTIVVAIITLTNG 484

Query: 579 WVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLIS 632
           +V  +       D ++F  +Y+++PI LA Y+G K   +  R  I    ID+I+
Sbjct: 485 YVVFIK---GRWDYKDFLTSYISLPIFLAFYLGHKTIYKT-RFCIPVDQIDVIT 534

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  194 bits (494), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 141/559 (25%), Positives = 252/559 (45%), Gaps = 26/559 (4%)

Query: 121 NLHIRDDE-----LDYATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXX 175
           N+ ++ D+      D A+  + S+  + + E  +LK+ +K RH+ M++            
Sbjct: 31  NIEVQSDQSSKSLCDSASDVLASEIGDGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIA 90

Query: 176 XXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFA 235
               L  AGP   +I Y  +G  ++  +   GE+A  +  ++G F ++ S   DP   FA
Sbjct: 91  TGESLKVAGPVSTLIAYTFVGIMVFFTMACLGEMA-TFIPLDG-FTSYASRYCDPALGFA 148

Query: 236 VAWVYCIQWLCVCPLELVTSSMTIKYWTTK--VDPDXXXXXXXXXXXXXXXXGAKGYAEA 293
           V + Y I++  + P +L  ++M ++YW  +  V+P                 G + + E 
Sbjct: 149 VGYAYLIKYFILPPNQLTAAAMVMQYWVPRDTVNPGIWVTLVFAVITVINIFGVRFFGEF 208

Query: 294 EFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQT-----KIERFKG 348
           EF+ +  KV++MIG  I+   I  G AG+   +G +YW  PGAF   +      + +F  
Sbjct: 209 EFWLSSLKVLIMIGLIILLFVIMLGGAGSHDRLGFRYWKHPGAFNDYSDDISGSLGKFVS 268

Query: 349 VMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPY 408
            +                 + AAE SNPR+++P A K   YR               VPY
Sbjct: 269 FVAVLVLGVFAYLGIELTGIVAAEASNPRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPY 328

Query: 409 NSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGL 468
           N ++L+ ++    +ASP+ +A    G+ V+    N  +L+ V S ANS  Y +SR L  L
Sbjct: 329 NDEKLVTTNENSLTASPFSIAILNAGITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSL 388

Query: 469 AQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTW 528
           A    APK F + +R G P  S+          +   S     VF + + +  ++ + TW
Sbjct: 389 AVDNKAPKIFAHTNRWGIPYNSLFVSCLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTW 448

Query: 529 FAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIM-LFLALVAQFWVALVPMNT 587
            +I +++I F R ++ Q        + A     G+Y +      +A++  F V L     
Sbjct: 449 ISILITYICFDRAVRAQHVDKSTFAYVAPFQPYGAYVSLFFCCLIAIIKNFTVFL----- 503

Query: 588 HTLDAENFFQNYLAMPILLALYVGFKL-WRRDFRLFIRAKNIDLISHRIIFDEELLRQE- 645
              D + F   Y+ +PI +  Y G+K+  + + R    A+ +DL+S + + D E +  E 
Sbjct: 504 GHFDYKTFITGYIGLPIFVLCYFGYKITCKSEIR---SARYVDLVSQKSLVDREQVEYEL 560

Query: 646 -DEEYKEKLRNGPKWKRVV 663
            ++  +E++    K+  V+
Sbjct: 561 IEQLKREEMIANTKYSIVI 579

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  194 bits (492), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 151/592 (25%), Positives = 254/592 (42%), Gaps = 38/592 (6%)

Query: 89  ETPNASSSTADENAVENYSMQEF----------DNDLENKKSNLHIRDDELDYATVNVDS 138
           + P+ S+S   E   E    +EF          ++DLE   S+   +D+         DS
Sbjct: 5   QIPSNSTSDQYEEYFEQLPKKEFKLPIQEEELINDDLERNISSASSQDEN--------DS 56

Query: 139 QPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTC 198
             ++ + E  +LK+ +K RHV M++                LA AGP   +I Y  +G  
Sbjct: 57  YNIDGKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLL 116

Query: 199 LYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMT 258
           ++  +   GE+A  Y  ++G F ++ S   DP   FAV + Y  ++  + P +L  +++ 
Sbjct: 117 VFFTMACLGEMA-TYIPLDG-FTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALV 174

Query: 259 IKYWT--TKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICIN 316
           I+YW    KV+P                 G + + E EF+ +  KV++M+G  ++   + 
Sbjct: 175 IQYWVDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILM 234

Query: 317 TGAAGTDGYIGAKYWNDPGAFRGQTKI-----ERFKGVMDXXXXXXXXXXXXXXXXLTAA 371
            G       +G +YW  PG+F+  ++       RF   +                 + AA
Sbjct: 235 LGGGPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAA 294

Query: 372 EQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGS--SSGGNSASPYVLA 429
           E  NPRK+IP A K   YR               V Y+   L+ +  SS   +ASP+V+A
Sbjct: 295 EAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVA 354

Query: 430 ASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLR 489
               G++ + H INA +L+ V S  NS  Y SSR L  LA    APK F   +R G P  
Sbjct: 355 IINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYY 414

Query: 490 SMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSL 549
           ++          +   S     +F + + +  +  I +W +I +++I F R ++ QG   
Sbjct: 415 ALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDK 474

Query: 550 GELGFRAQTGVLGSYYAAIM-LFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLAL 608
               + A     G++++      +AL+  F V L     H  D +NF   Y+ +P+    
Sbjct: 475 STFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFL----NHQFDYKNFITGYIGLPVFFFC 530

Query: 609 YVGFKLWRRDFRLFIRAKNIDLISHRIIFD--EELLRQEDEEYKEKLRNGPK 658
           Y G+K   +     I    +DL + +   D  EE  +  D E  E+++   K
Sbjct: 531 YFGYKFTYK--TKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKAERIKQNGK 580

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  193 bits (490), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 154/591 (26%), Positives = 246/591 (41%), Gaps = 27/591 (4%)

Query: 88  AETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDEN 147
           A T +   S     A + Y+      D+E+++S       E      + D+ P   +   
Sbjct: 19  AATTHTIGSAGALPAKDKYNKTIEFVDVESQQSTSSATISE-KLGDGDGDADPFANE--- 74

Query: 148 AQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACG 207
             L+Q +K RH+ M++                LA  GPA L I Y I+ + +Y I+   G
Sbjct: 75  GSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCGFG 134

Query: 208 ELAVAY-----SKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYW 262
           E+ V Y     +  +GS     +  VD    FA AW Y   ++ +   E   +S  ++YW
Sbjct: 135 EM-VCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEYW 193

Query: 263 TTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGT 322
           T  V                     K Y EAEF+F   K++ ++G  I++  +  G    
Sbjct: 194 TVAVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGPN 253

Query: 323 DGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXX----XXLTAAEQSNPRK 378
              +G +YW  PGAF        F   +D                    LT+AE  + R+
Sbjct: 254 HDRLGFRYWQRPGAFTEHIMKGGFGRFLDIYSGVIKGGFAFILGPELVCLTSAECEDQRR 313

Query: 379 AIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQL---MGSSSGGNSASPYVLAASLHGV 435
            I  AA++  +R               V YN   L   + S   G  +SP+V+     G+
Sbjct: 314 NIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNAGI 373

Query: 436 HVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXX 495
            V+ H INA IL S  S  N+  ++S+R LL +A+ G AP+ F  ++R G P  ++    
Sbjct: 374 RVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISLSG 433

Query: 496 XXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFR 555
                 F   S    DVF W   IS +S    W   CV++IRFR+ +   G     L F+
Sbjct: 434 GLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRLPFK 492

Query: 556 AQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLW 615
                   YY+  ++ L  +   +   +P N       +F   Y+ +PI + L+VG KLW
Sbjct: 493 TWGQPYAVYYSLFVISLITLTNGYATFIPKN---WKGSDFVAAYITLPIFVVLWVGHKLW 549

Query: 616 RRDF--RLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVD 664
            R F  R + R   ID ++  ++  EE  +  DE    ++    +W++ +D
Sbjct: 550 TRTFTKRWWRRVDQID-VTTGLVDIEERTKILDE---TRVEPSTRWQKFMD 596

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  191 bits (486), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 138/522 (26%), Positives = 222/522 (42%), Gaps = 21/522 (4%)

Query: 143 QQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCI 202
           + +    LK+ + PRH+ M+S                L   GPA L + Y I G  +Y  
Sbjct: 61  ESNIREDLKRDLSPRHINMISIAGVIGTGLYLSTSKSLHVGGPASLFMNYSIFGGVVYLT 120

Query: 203 IQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYW 262
           +   GE++  Y  ++GSF ++        F  A+ W Y          +L    + + YW
Sbjct: 121 MMCLGEMS-TYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYW 179

Query: 263 TTK---VDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGA 319
            TK                         + Y EAE++    KV+ +I FFI++I +N G 
Sbjct: 180 KTKDHHFPYWAASLLFWVFVLLLNVISVRLYGEAEYWLALLKVIAIIIFFILSIVVNVGH 239

Query: 320 AGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKA 379
                YIG   WN   A      +  FKG                   LT  E +NP + 
Sbjct: 240 NPEHKYIGFHNWNHGDA----PFVNGFKGFASLFVSASFAYGGTESITLTNGEATNPVRN 295

Query: 380 IPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQ 439
            P   K V +R               VPY+   L   S      SP+ +   + G     
Sbjct: 296 TPKVIKTVFWRILIFYVFSAFFIAMNVPYDYPGLATKSV---MTSPFTIVFQMAGSKGAG 352

Query: 440 HFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXX 499
            F+NAVI+ SV+S  N A ++ SR++  ++  GY PKW    +R   P  ++        
Sbjct: 353 SFMNAVIMTSVISACNHALFAGSRVMYNMSLDGYLPKWVTKTNRYKAPYVAVAITWAVGG 412

Query: 500 XXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTG 559
             F A+      V+ WL  I G+S    W  I ++ IRFRRG+++QG++  EL F+  T 
Sbjct: 413 LCFGASFIGAGTVWIWLQNIVGVSNQIAWLCIAITSIRFRRGLELQGKT-HELKFKNWTY 471

Query: 560 VLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDF 619
             G Y+  + +   ++ Q W A  P +T      NFF  YL + +  A Y+ + L++RD 
Sbjct: 472 PWGPYFLVVFVSFVILIQGWSAFDPWST-----SNFFSVYLELFVFPACYLIWWLYKRD- 525

Query: 620 RLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKR 661
             FI+ +++D ++ + I  +++   E  E  + L+  PKW++
Sbjct: 526 -KFIKYEDMDFVTDKYIPSKKV--NELNERLDNLKGWPKWRQ 564

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  192 bits (487), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 144/584 (24%), Positives = 246/584 (42%), Gaps = 25/584 (4%)

Query: 83  DSFKRAETPNASSST---ADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQ 139
           D  +  E+P++ S     +D    +   M++   + ++  SN  IR+D +    V+++  
Sbjct: 38  DVVQVTESPSSGSRNNHRSDNEKDDAIRMEKISKN-QSASSNGTIREDLI--MDVDLEKS 94

Query: 140 P-VEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTC 198
           P V+   E  +LKQ ++ RHV +++                L   GPA L I Y I+   
Sbjct: 95  PSVDGDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAV 154

Query: 199 LYCIIQACGELAVAY----SKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 254
           +Y I+ A GE+        S   GS     +  VDP   FA  W Y   ++ +   E   
Sbjct: 155 IYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTA 214

Query: 255 SSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAIC 314
           +S  ++YWTT V                     K Y E+EF+F   K++ ++G  I++  
Sbjct: 215 ASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFI 274

Query: 315 INTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXX----XXXLTA 370
           +  G       +G +YW  PGAF             D                    +T+
Sbjct: 275 LFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTS 334

Query: 371 AEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQL---MGSSSGGNSASPYV 427
           AE ++ R+ I  A+++  +R               VPYN   L   +     G  +SP+V
Sbjct: 335 AECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFV 394

Query: 428 LAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRP 487
           +     G+ V+ H IN  IL S  S AN+  ++S+R LL +AQ G APK    +++ G P
Sbjct: 395 IGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVP 454

Query: 488 LRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGR 547
             ++          +   S    DVF W   IS +S    W   C++++RFR+ +   G 
Sbjct: 455 YVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL 514

Query: 548 SLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLA 607
               L F+        +++ I++ +  +   +   +P      D   F   Y+ +PI L 
Sbjct: 515 -YDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVAD---FIAAYITLPIFLV 570

Query: 608 LYVGFKLWRRDFR-LFIRAKNIDLISHRIIFDEELLRQEDEEYK 650
           L+ G KL+ R +R  ++    ID+ +  +  +E+   +E EE +
Sbjct: 571 LWFGHKLYTRTWRQWWLPVSEIDVTTGLVEIEEK--SREIEEMR 612

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  190 bits (482), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 151/575 (26%), Positives = 241/575 (41%), Gaps = 41/575 (7%)

Query: 94  SSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQT 153
           SSS +D  AV+          +++ K  ++     LD   +  D  P  +Q+    L + 
Sbjct: 2   SSSISDREAVK----------VDSGKQEIYEVSSSLDIDELRSDFDP--EQNIREDLTRA 49

Query: 154 IKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAY 213
           + PRH+ M+S                L   GPA L + Y I+G  +Y  +   GE++  +
Sbjct: 50  LSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGEMS-TF 108

Query: 214 SKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTT---KVDPDX 270
             ++GSF ++        F  A+ W Y          +L    + + YW T         
Sbjct: 109 MPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHHFPYWG 168

Query: 271 XXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKY 330
                            + Y EAE++    KV+ ++ FFIM+I +N G      YIG K 
Sbjct: 169 ASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHEYIGFKN 228

Query: 331 WNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYR 390
           W    A      +  FKG                   LT  E SNP +  P   K V +R
Sbjct: 229 WTHGEA----PFVNGFKGFASLFVSACFAYGGTESITLTGGEASNPVRNTPKIVKTVFWR 284

Query: 391 XXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSV 450
                          +PY+     G S+     SP+ L   + G      F+NAVIL SV
Sbjct: 285 ILIFYVLSTFFIGMNIPYDYP---GLSTKSVMTSPFTLVFQMAGTRGAGSFMNAVILTSV 341

Query: 451 LSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGR---PLRSMLCXXXXXXXXFCATSP 507
           +S  N A ++ SR++  +A  GY PK    V R  R   P  ++L           A+  
Sbjct: 342 ISACNHALFAGSRIMYNMALDGYLPK--KIVGRTNRYKAPYVAVLITWAVGGLCLGASFI 399

Query: 508 KETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAA 567
               ++TWL  I G+S    W  I ++ IRFR+G++VQG++   L F+  T   G Y+  
Sbjct: 400 GAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQGKT-DLLQFKNWTYPFGPYFLV 458

Query: 568 IMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKN 627
           I     ++ Q W A  P +       +FF  YL + +   +Y+ + LW+RD+  F++ ++
Sbjct: 459 IFTVFIILIQGWQAFDPWS-----VTDFFSVYLELFVFPFVYIIWWLWKRDW--FVKYED 511

Query: 628 IDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRV 662
           +D ++ R I  +E++     E  E+L N   WK+V
Sbjct: 512 MDFVTDRYIPTKEIV-----ELNERLDNLKGWKKV 541

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  190 bits (482), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 143/567 (25%), Positives = 249/567 (43%), Gaps = 28/567 (4%)

Query: 112 DNDLENKKSNLHIRDDELDYATVNVDSQP--------VEQQDENAQLKQTIKPRHVIMMS 163
           D  +E K + +   ++ L+   V ++S+         V+ + E  +LK+ ++ RHV M++
Sbjct: 4   DTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIA 63

Query: 164 XXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTF 223
                           LA AGP  ++I Y  +G  +Y ++   GE+A A+  ++G F ++
Sbjct: 64  IGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMA-AFIPLDG-FTSY 121

Query: 224 PSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK--VDPDXXXXXXXXXXXX 281
            S  VDP   FAV + Y  ++  V P +L   +M +++W ++  V+P             
Sbjct: 122 ASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVL 181

Query: 282 XXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQT 341
               G + + E EF+ +  KV++M+G  ++   I  G        G ++W DPGAF+  +
Sbjct: 182 INTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYS 241

Query: 342 KI-----ERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXX 396
           +       +F                     + AAE  NPR+++P A K   YR      
Sbjct: 242 EAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYV 301

Query: 397 XXXXXXXXXVPYNSDQLMGSSSGGNSA--SPYVLAASLHGVHVVQHFINAVILLSVLSVA 454
                    V YN  +L+ +     SA  SP+V+A     + V+ H  N  +L+ V S  
Sbjct: 302 ITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSAC 361

Query: 455 NSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFT 514
           NS  Y +SR L GLA  G AP+ F   ++ G P  S+          +   S     VF 
Sbjct: 362 NSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFN 421

Query: 515 WLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIM-LFLA 573
           + + +  +  + +W  I +++IRF + ++VQ      L + A      +Y A      + 
Sbjct: 422 YFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIG 481

Query: 574 LVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISH 633
           L+  + V L     H  D + F   Y+ +P+ L  YVG+K+  R     I+ +++DL + 
Sbjct: 482 LIKNYTVFL----GHKFDYKTFISGYIGIPVYLICYVGYKVVYRT--KLIKPEDVDLYTF 535

Query: 634 RIIFDEELLRQEDEEYK--EKLRNGPK 658
           +   D E    +  E +  E + N PK
Sbjct: 536 KDAIDAEEEEYKLLEKERLENMENSPK 562

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  189 bits (481), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 142/569 (24%), Positives = 241/569 (42%), Gaps = 38/569 (6%)

Query: 116 ENKKSNLHIRDDELDYATVNVDS-QPVEQQDEN----------AQLKQTIKPRHVIMMSX 164
           E  K +  IR+D +D       S    EQ+D++           +LK+ +K RH+ M++ 
Sbjct: 5   EVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAI 64

Query: 165 XXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFP 224
                          L   GPA ++I Y  +G  ++ ++   GE+A  Y  ++G F ++ 
Sbjct: 65  GGSLGTGLLIGTGTALRTGGPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYA 122

Query: 225 SFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK--VDPDXXXXXXXXXXXXX 282
           +   DP   FAV + Y  ++  + P +L   ++ I+YW  +  V+P              
Sbjct: 123 TRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVII 182

Query: 283 XXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTK 342
              G + + E EF+ +  K+M+M G  +    I  G       +G +YW +PGAF+  ++
Sbjct: 183 NTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSE 242

Query: 343 I-----ERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXX 397
                  +F   +                 + AAE  NPR+ IP A K   YR       
Sbjct: 243 SITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIV 302

Query: 398 XXXXXXXXVPYNSDQLMGSSSGGNSAS--PYVLAASLHGVHVVQHFINAVILLSVLSVAN 455
                   V YN  +L+ ++    SA+  P+V+A    GV  + H  N  +L+ V S  N
Sbjct: 303 TIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQNSGVRALPHIFNVCVLIFVFSACN 362

Query: 456 SAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTW 515
           S  Y  +R L  LA  G APK F   +R G P  ++          +   S     +F +
Sbjct: 363 SDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGCFLFCLLAYMNVSSGSAQIFNY 422

Query: 516 LLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALV 575
            + +  +  I +W +I +++I F R    Q        +RA     G+Y   I LF  ++
Sbjct: 423 FVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY---ITLFFCVL 479

Query: 576 AQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRI 635
             F +    +     D ++F   Y+ +P+ +  Y G+K+  +     ++A+  DL S   
Sbjct: 480 IAF-IKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADLYS--- 533

Query: 636 IFDEELLRQEDE------EYKEKLRNGPK 658
            F E + R+E E      E KE+L+N  K
Sbjct: 534 -FKEAIDREEAEGKIKEAEAKERLKNSKK 561

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  189 bits (480), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 153/583 (26%), Positives = 254/583 (43%), Gaps = 39/583 (6%)

Query: 94  SSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQT 153
           S S   +NA   YS +  + D+   K        E   +  +     V+ + E  +LK+ 
Sbjct: 2   SESLEKKNAGILYSNETLEEDVAFDKL-------ERGASGASAAGASVDGKHEGIRLKKA 54

Query: 154 IKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAY 213
           ++ RHV M++                LA AGPA ++I Y  +G  +Y ++   GE+A A+
Sbjct: 55  LEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVMACLGEMA-AF 113

Query: 214 SKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTT--KVDPDXX 271
             ++G F ++ S  VDP   FAV + Y  ++  V P +L   +M ++YW +  KV+P   
Sbjct: 114 IPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVW 172

Query: 272 XXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYW 331
                         G + + E EF+ +  KV++M+G  ++   I  G        G +YW
Sbjct: 173 ITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRYW 232

Query: 332 NDPGAFRGQTKI-----ERFKGVMDXXXXXXXXXXXXXXXXLTAAEQSNPRKAIPSAAKK 386
            DPGAF+  ++       +F                     + AAE  NPR+++P A K 
Sbjct: 233 RDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKL 292

Query: 387 VAYRXXXXXXXXXXXXXXXVPYNSDQLMGSS--SGGNSASPYVLAASLHGVHVVQHFINA 444
             YR               V YN   L+ +   S   +ASP+V+A    G+ V+ H  NA
Sbjct: 293 TLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAGIPVLPHIFNA 352

Query: 445 VILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCA 504
            +LL V S  NS  Y +SR L GLA    APK F   +  G P  S+          +  
Sbjct: 353 CVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMN 412

Query: 505 TSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSY 564
            S     +F + + +  +  + +W +I ++++RF + +  Q        F  ++G   SY
Sbjct: 413 VSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQ--------FGDKSGF--SY 462

Query: 565 YAAIMLFLALVAQFWVALVPMNT-------HTLDAENFFQNYLAMPILLALYVGFKLWRR 617
            A    +   V+ F+  L+ +         HT D + F   Y+ +P+    YVG+KL  R
Sbjct: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522

Query: 618 DFRLFIRAKNIDLISHRIIFDEELLRQEDEEY--KEKLRNGPK 658
                I+ +++DL + +   D E    +  E   KE+L++ PK
Sbjct: 523 S--KLIKPEDVDLYTFKAAIDAEEEEGKLLELERKEQLKSSPK 563

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  188 bits (478), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 142/542 (26%), Positives = 229/542 (42%), Gaps = 35/542 (6%)

Query: 132 ATVNVDSQPVEQQDENAQ------LKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGP 185
             V +D     ++D + +      L++ +KPRH+ M+S                L Q GP
Sbjct: 30  VVVELDPSLTTEEDYDPEANIREDLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGP 89

Query: 186 APLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWL 245
           A L + Y IMG  +Y  +   GE++  Y  ++GSF ++        F  A+ W Y     
Sbjct: 90  ASLFMNYTIMGGVVYLTLLCLGEMS-TYMPISGSFCSYAKKFGSESFACALMWNYWFNDA 148

Query: 246 CVCPLELVTSSMTIKYWTTKVDPD---XXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKV 302
                ++    + + YW T+                         + Y EAE++    KV
Sbjct: 149 VSVASDMTALQLVMDYWDTEASGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKV 208

Query: 303 MMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXX 362
           + +I FFI++I +N G      YIG K WN   A      ++ FKG              
Sbjct: 209 IAIIIFFILSIVVNVGHNPQHEYIGFKNWNHGEA----PFVDGFKGFASLFVSASFAYGG 264

Query: 363 XXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNS 422
                LT  E +NP +  P   K V +R               +PY+     G  +    
Sbjct: 265 TESITLTNGEAANPLRNTPKIVKTVFWRILVFYVGSTFFIAMNIPYDYP---GLDTKSVV 321

Query: 423 ASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVD 482
            SP+ L   + G      F+NAVI+ SV+S  N A ++ SR++  +   G+ PK    V 
Sbjct: 322 TSPFTLVFQMAGTKAAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPK--KIVS 379

Query: 483 RNGR---PLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFR 539
           R  R   P  S+L         F A+      V+TWL  I G+S    W  I ++ IRFR
Sbjct: 380 RTNRYKVPYVSVLITSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFR 439

Query: 540 RGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNY 599
           +G++ QG++  EL ++  T   G Y+  I +   ++ Q W A  P      D  NFF  Y
Sbjct: 440 KGLEKQGKT-HELRYKNWTYPYGPYFLVIFVTFIILVQGWSAFDPW-----DVTNFFSYY 493

Query: 600 LAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKW 659
           L + +    ++ + L++RD   F++ +++D ++ R I  +E++     E  E L +   W
Sbjct: 494 LDLFVFPFCFIIWWLYKRD--RFVKLEDMDFVTDRYIPTKEII-----ELNENLDHLKGW 546

Query: 660 KR 661
           KR
Sbjct: 547 KR 548

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  188 bits (477), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 143/572 (25%), Positives = 246/572 (43%), Gaps = 28/572 (4%)

Query: 96  STADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIK 155
           S + + A  N S+ +  ND  N K  +   +  + Y+ V+++S   E    N  LK  ++
Sbjct: 6   SESSDMATTNISVYD-KNDKNNIKDGVSF-EKPIIYSEVDIESGAKESSSRN--LKHGLQ 61

Query: 156 PRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSK 215
            RH+ +++                LA  GPA LVI Y ++ T +Y I+   GE+ V Y  
Sbjct: 62  SRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGEM-VCYLP 120

Query: 216 VN-------GSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDP 268
            N       G      S  VD    FA +W Y   ++ +   E   +S  ++YWT+K+  
Sbjct: 121 GNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYWTSKIPK 180

Query: 269 DXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTD---GY 325
                              K Y EAEF+F   K+  + G  I+A  I  G A  +    +
Sbjct: 181 AVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPNNEDNSF 240

Query: 326 IGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXXX----XXLTAAEQSNPRKAIP 381
           +G  YW +P +FR           +D                    LT++E  + R+ I 
Sbjct: 241 VGFHYWKNPSSFRDYVTNGSLGNFLDVYNALIKGAFAFILGPELVSLTSSECVDQRRNIA 300

Query: 382 SAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGS---SSGGNSASPYVLAASLHGVHVV 438
            A+++  YR               VPYN   L+ +   +  G  +SP+V+     G+ ++
Sbjct: 301 KASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGIQNAGITIL 360

Query: 439 QHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXX 498
            H IN  IL S +S  N+  ++S+R LL + + G AP+ F  ++R+G P  ++       
Sbjct: 361 PHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVALSLSIMIA 420

Query: 499 XXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQT 558
              F   S     VF W   IS +S    WF  C++++RFRR +   G     L F+ + 
Sbjct: 421 CLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YDRLPFKTKG 479

Query: 559 GVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRD 618
            V  ++Y+ + + + ++   ++ ++P      + ++F   Y+ +P+ L LY G  ++   
Sbjct: 480 QVYLTWYSFVFVGILILTNGYMYIIP---KFWNYQDFIAAYITLPVFLVLYFGHIIYSGR 536

Query: 619 FRLFIRAKNIDLISHRIIFDEELLRQE--DEE 648
           +R     K +D I      +E  L+ +  DEE
Sbjct: 537 WRQRKWWKPVDEIDVVTGLEEIELKTKIADEE 568

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  187 bits (474), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 135/528 (25%), Positives = 228/528 (43%), Gaps = 18/528 (3%)

Query: 149 QLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGE 208
           +LKQ +K RHV +++                L   GPA L I Y I+ + +Y I+Q  GE
Sbjct: 74  ELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGE 133

Query: 209 LAVAYSKVNGSF-NTFPSFLV----DPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWT 263
           + V Y   +GS    F ++LV    D    FA AW Y   ++ +   E   +S  ++YWT
Sbjct: 134 M-VCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWT 192

Query: 264 TKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTD 323
           T V                     K Y E+EF+F   K++ ++G  I++  +  G     
Sbjct: 193 TSVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPNH 252

Query: 324 GYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXXXXXXXXX----XXXLTAAEQSNPRKA 379
             +G +YW +PG F    +   F   +D                    +T++E  + R+ 
Sbjct: 253 DRLGFRYWQNPGGFAHHIRGGSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQRRN 312

Query: 380 IPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQL---MGSSSGGNSASPYVLAASLHGVH 436
           I  AA++  +R               V YN   L   +  +  G  +SP+V+     G+ 
Sbjct: 313 IAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNAGIK 372

Query: 437 VVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXX 496
           V+ H INA IL S  S  N+  ++SSR LL +AQ G AP+ F  V+R G P  ++     
Sbjct: 373 VLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLSSA 432

Query: 497 XXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRA 556
                +   S    DVF W   IS +S    W  +C+++IRF + +   G     L + A
Sbjct: 433 ISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGMQ-SRLPYTA 491

Query: 557 QTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWR 616
           +      Y+  +++ +  +   +   +P      DA+NF   Y+ +P+   L++G +++R
Sbjct: 492 RGMPYLIYWPLLVISIITLTNGYEVFIP---RFWDAKNFVAAYITLPVFWVLWIGHRVYR 548

Query: 617 RDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLRNGPKWKRVVD 664
           R        K+I+ I   +   EE+  +  E    ++     W++ +D
Sbjct: 549 RKIFTLKWWKSIEEID-VVTGVEEIEEKTRECDASRVLPTKWWEKALD 595

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  187 bits (474), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 146/606 (24%), Positives = 252/606 (41%), Gaps = 38/606 (6%)

Query: 72  QVKNERFRNWLDSFKRAETPNASSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDY 131
           +  ++R+  + D  K+           D         +   +DLEN  S     +D+   
Sbjct: 10  ETTSDRYEEYFDPQKKV----------DSKTFPTQERELLHDDLENNISLSTSAEDQ--- 56

Query: 132 ATVNVDSQPVEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPLVIG 191
                DS  V+ + E  +LK+ ++ R V M++                LA AGP  ++I 
Sbjct: 57  ----NDSYNVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIA 112

Query: 192 YGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLE 251
           Y  +G  ++  + + GE+A +Y  ++G F ++ +   DP   FAV + Y  ++  + P +
Sbjct: 113 YAFVGLLVFFTMASLGEMA-SYIPLDG-FTSYATRYADPALGFAVGYCYLFKYFILPPNQ 170

Query: 252 LVTSSMTIKYWT--TKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVMMMIGFF 309
           L  +++ I+YW    KV+P                 G + + E EF+ +  KV++M    
Sbjct: 171 LTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALI 230

Query: 310 IMAICINTGAAGTDGYIGAKYWNDPGAFRGQT-----KIERFKGVMDXXXXXXXXXXXXX 364
           I+   +  G       +G ++W  PGAF   +        +F   +              
Sbjct: 231 ILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGTE 290

Query: 365 XXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSSSGGNSA- 423
              +   E  NPRK++P A K   YR               V Y+   L+ + +   SA 
Sbjct: 291 LVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAA 350

Query: 424 -SPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVD 482
            SP+V+A    G+ V+ H  NA +L+ V S  NS  Y +SR L  LA    APK F   +
Sbjct: 351 ASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTN 410

Query: 483 RNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGM 542
           R G P  S+          + + S     +F + + +  +  + +W  I V+++ F R +
Sbjct: 411 RWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAV 470

Query: 543 QVQGRSLGELGFRAQTGVLGSYYAAIML-FLALVAQFWVALVPMNTHTLDAENFFQNYLA 601
           + QG       + A     G+Y+A      +AL+  F V L     H  D + F   Y+ 
Sbjct: 471 RAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFL----GHQFDYKTFITGYIG 526

Query: 602 MPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFD--EELLRQEDEEYKEKLR-NGPK 658
           +P+    Y G+KL  +     I    +DL + +   D  EE  + ED   KE+++ NG  
Sbjct: 527 IPVFFISYFGYKLIYKT--KIIDPLEVDLYTFKAAIDQEEEDGKLEDIARKERIKANGRN 584

Query: 659 WKRVVD 664
           ++   D
Sbjct: 585 FEWFYD 590

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  185 bits (470), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 141/558 (25%), Positives = 233/558 (41%), Gaps = 24/558 (4%)

Query: 116 ENKKSNLHIRDDELDYATVNVDSQP-VEQQDENAQLKQTIKPRHVIMMSXXXXXXXXXXX 174
            +  SN  IR+D +    V+V+  P VE  +E  +LKQ ++ RHV +++           
Sbjct: 77  HSASSNGTIREDLI--MDVDVEKSPSVEGDNEPHKLKQGLQSRHVQLIALGGAIGTGLLV 134

Query: 175 XXXXPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAY----SKVNGSFNTFPSFLVDP 230
                L   GPA L I Y I+   +Y I+ A GE+        S   GS     +  VD 
Sbjct: 135 GTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDA 194

Query: 231 GFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGY 290
              FA  W Y   ++ +   E   +S  ++YWTT V                     K Y
Sbjct: 195 SLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVVLLNLSAVKVY 254

Query: 291 AEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVM 350
            E+EF+F   K++ ++G  I++  +  G       +G +YW  PGAF             
Sbjct: 255 GESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSLGNFT 314

Query: 351 DXXXXXXXXXXXXX----XXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXV 406
           D                    +T+AE ++ R+ I  A+++  +R               V
Sbjct: 315 DIYTGIIKGAFAFILGPELVCMTSAECADQRRNISKASRRFVWRLIFFYVLGTLAISVIV 374

Query: 407 PYNSDQLMGSSSGGN---SASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSR 463
           PYN   L+ + + G     +SP+V+     G+ V+ H IN  IL S  S AN+  ++S+R
Sbjct: 375 PYNDPSLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILSSAWSAANAFMFASTR 434

Query: 464 LLLGLAQVGYAPKWFDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLS 523
            LL +AQ G APK    ++R G P  ++          +   S    DVF W   IS +S
Sbjct: 435 SLLTMAQTGQAPKCLGRINRWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTIS 494

Query: 524 QIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALV 583
               W   C++++RFR+ +   G     L F+        + + I++ +  +   +   +
Sbjct: 495 GFLGWMCGCIAYLRFRKAIFYNGL-FDRLPFKTWGQPYTVWASLIVVGIITLTNGYAIFI 553

Query: 584 PMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDF-RLFIRAKNIDLISHRIIFDE--- 639
           P      D   F   Y+ +PI L L+ G KL+ R + + ++    ID+ +  I  +E   
Sbjct: 554 PKYWKIAD---FIAAYITLPIFLVLWFGHKLYTRTWSQWWLPVSEIDVTTGLIEIEEKSR 610

Query: 640 --ELLRQEDEEYKEKLRN 655
             E +R     +K+K  +
Sbjct: 611 EIEEMRLPPSSFKDKFMD 628

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  185 bits (470), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 142/541 (26%), Positives = 225/541 (41%), Gaps = 42/541 (7%)

Query: 130 DYATVNVDSQPVEQQDENAQL-KQTIKPRHVIMMSXXXXXXXXXXXXXXXPLAQAGPAPL 188
           D+   N DS   +      ++ ++ + PR V M+                 + Q GP  L
Sbjct: 96  DFVLQNRDSPKSQSLSLEERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSL 155

Query: 189 VIGYGIMGTCLYCII----QACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCI-Q 243
           +I +     CL+ ++      C  + V Y  V GSF  F    VD    FAV W Y + Q
Sbjct: 156 LIAF-----CLWSVVFIGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQ 210

Query: 244 WLCVCPLELVTSSMTIKYWTTKVDPDXXXXXXXXXXXXXXXXGAKGYAEAEFFFNCCKVM 303
              VC  E+    + ++YWT K+                       + E EF+ +  KV+
Sbjct: 211 AANVC-FEITAVCLVVEYWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVV 269

Query: 304 MMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFR---GQTKIERFKGVMDXXXXXXXXX 360
           + IG  I  + +  G       +G K W++PGAF        + RF G M          
Sbjct: 270 LAIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGAFAEYISDGSVGRFHGFMSCLVFALYVF 329

Query: 361 XXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGS---S 417
                    A+E  NPRK IPS+ +KV  R               +PYN   ++ +    
Sbjct: 330 WGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEG 389

Query: 418 SGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKW 477
           + G  ASPYV A    G+ V+ H +N +IL S++S  NS+ YS+SR+L  LA    AP+ 
Sbjct: 390 AVGAGASPYVSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRI 449

Query: 478 FDYVDRNGRPLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIR 537
           F    + G P+   +         + + S    +V TW L +   +    +  ICVS+++
Sbjct: 450 FKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQ 509

Query: 538 FRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPM-NTHTL------ 590
           FR+G   Q   L  L           YY++ + +LA  + FW+ L+ + N +T+      
Sbjct: 510 FRKGCLAQNVDLKSL----------PYYSSSLPYLAWHSLFWLVLMLLVNGYTVFLKGSW 559

Query: 591 DAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYK 650
           D ++F  +Y  +P  L    G KL++      +R   +DL +       E L  ED  + 
Sbjct: 560 DTQSFVFSYFMIPFFLVFLFGHKLYKGTKS--VRPLEMDLFT-----GIEELADEDRYWA 612

Query: 651 E 651
           E
Sbjct: 613 E 613

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  182 bits (461), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 149/551 (27%), Positives = 231/551 (41%), Gaps = 33/551 (5%)

Query: 125 RDDELDYATVNVDSQPVEQQDENAQLKQ----TIKPRHVIMMSXXXXXXXXXXXXXXXPL 180
           + D L Y T +     V   D  A +++     +KPRH+ M+S                L
Sbjct: 21  QQDHLIYETTSYGVNEVYTIDPEANIREDLTRALKPRHINMISIAGIIGTGLYLSTSTSL 80

Query: 181 AQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVY 240
            + GPA L I Y ++G  +Y  +    E++  Y  ++GSF T+        F  A+ W Y
Sbjct: 81  HKGGPASLFINYSLIGGIVYLTLLCLAEMS-TYMPISGSFCTYAKKFGSDSFAMALMWNY 139

Query: 241 CIQWLCVCPLELVTSSMTIKYWTTKVDPD---XXXXXXXXXXXXXXXXGAKGYAEAEFFF 297
                     +L    + + YW T  +                       + Y EAE++ 
Sbjct: 140 WFNDAVSVASDLTALQLVMDYWNTDSNHFPYWAASLIFWFFVLSLNVIHVRFYGEAEYWL 199

Query: 298 NCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFRGQTKIERFKGVMDXXXXXX 357
              KV+ +I FFIM+I +N G      YIG K W    A      ++ FKG         
Sbjct: 200 AMLKVIAIIIFFIMSIIVNVGHNPQHEYIGFKNWTVGEA----PFVDGFKGFASLFVSAS 255

Query: 358 XXXXXXXXXXLTAAEQSNPRKAIPSAAKKVAYRXXXXXXXXXXXXXXXVPYNSDQLMGSS 417
                     LT+ E  NP +  P   K V +R               VPYN     G S
Sbjct: 256 FAYGGTESITLTSGESDNPLRNTPKIVKTVFWRILFFYIGTTFFIAMNVPYNYP---GLS 312

Query: 418 SGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKW 477
           SG    SP+ +   + G      F+NAVI+ SV+S  N A ++ SR++  +   GY PK 
Sbjct: 313 SGSVVTSPFTIVFKMAGTAGAGSFMNAVIMTSVISACNHALFAGSRIMYNMGLEGYLPK- 371

Query: 478 FDYVDRNGR---PLRSMLCXXXXXXXXFCATSPKETDVFTWLLAISGLSQIFTWFAICVS 534
              V R  R   P  ++L         F A+      ++TWL  I G+S    W  I ++
Sbjct: 372 -SIVSRTNRYKVPYVAVLITWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQLAWLCIAIT 430

Query: 535 HIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAEN 594
            IRFR+G++ Q ++  EL F+  T   G Y+  + +   ++ Q W +  P N       N
Sbjct: 431 SIRFRQGLEAQNKT-HELKFKNWTYPFGPYFLVVAVTFIILVQGWSSFAPWN-----VSN 484

Query: 595 FFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISHRIIFDEELLRQEDEEYKEKLR 654
           FF  Y+ + +    ++ + L++RD   F++ K++D ++     D+ +  QE  E  EKL 
Sbjct: 485 FFSVYIELFVFPFCFIIWWLYKRD--PFVKCKDMDFVT-----DKYVPSQEIIELNEKLD 537

Query: 655 NGPKWKRVVDF 665
           N   WKRV  F
Sbjct: 538 NLKGWKRVRQF 548

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,789,679
Number of extensions: 2264550
Number of successful extensions: 10471
Number of sequences better than 10.0: 363
Number of HSP's gapped: 9205
Number of HSP's successfully gapped: 395
Length of query: 667
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 551
Effective length of database: 40,180,143
Effective search space: 22139258793
Effective search space used: 22139258793
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 69 (31.2 bits)