Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A049701.10ON1811817191e-97
ZYRO0F18370g1.10ON2201771876e-17
KAFR0D001901.10ON1851641788e-16
SAKL0C00572g1.10ON3381671821e-15
KNAG0C002701.10ON174581752e-15
NDAI0A001901.10ON171541682e-14
TDEL0C069301.10ON184541682e-14
TPHA0E039601.10ON1771131672e-14
NCAS0B090601.10ON1671691654e-14
KLLA0C00594g1.10ON1941811463e-11
Kwal_33.130231.10ON193501402e-10
KLTH0F00572g1.10ON195531342e-09
Kpol_2002.131.10ON164361103e-06
NCAS0C005108.822ON44551672.2
Ecym_10121.10ON17749635.7
NOTE: 4 genes in the same pillar as TBLA0A04970 were not hit in these BLAST results
LIST: Skud_3.8 Smik_3.19 YCL056C Suva_3.157

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A04970
         (181 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {...   281   1e-97
ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...    77   6e-17
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...    73   8e-16
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...    75   1e-15
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...    72   2e-15
NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON} ...    69   2e-14
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....    69   2e-14
TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10...    69   2e-14
NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1....    68   4e-14
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...    61   3e-11
Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}...    59   2e-10
KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}...    56   2e-09
Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON...    47   3e-06
NCAS0C00510 Chr3 (83308..84645) [1338 bp, 445 aa] {ON} Anc_8.822...    30   2.2  
Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON} si...    29   5.7  

>TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {ON}
           Anc_1.10 YCL056C
          Length = 181

 Score =  281 bits (719), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 151/181 (83%)

Query: 1   MDIVNNSIWKFDILYGLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITL 60
           MDIVNNSIWKFDILYGLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITL
Sbjct: 1   MDIVNNSIWKFDILYGLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITL 60

Query: 61  VLNIRXXXXXXXXXXXXXXXISDELEFQLTKLKMEKIGNYSKDVTLIIKDKLQNSLKIIN 120
           VLNIR               ISDELEFQLTKLKMEKIGNYSKDVTLIIKDKLQNSLKIIN
Sbjct: 61  VLNIRKDTLELLKLLKLKTKISDELEFQLTKLKMEKIGNYSKDVTLIIKDKLQNSLKIIN 120

Query: 121 NSIKDRIFDXXXXXXXXXXXXXXXGGHYYKSLQRFKHILEIISNMLIVSRVFSTNFNLAN 180
           NSIKDRIFD               GGHYYKSLQRFKHILEIISNMLIVSRVFSTNFNLAN
Sbjct: 121 NSIKDRIFDLIQNLIYLLILLINIGGHYYKSLQRFKHILEIISNMLIVSRVFSTNFNLAN 180

Query: 181 F 181
           F
Sbjct: 181 F 181

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
           conserved hypothetical protein
          Length = 220

 Score = 76.6 bits (187), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 53/177 (29%), Positives = 91/177 (51%), Gaps = 15/177 (8%)

Query: 5   NNSIWKFD--ILYGLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVL 62
           N  I  F+  ++ GLESIC +FDN+Y L+++G+IS+ NL YR LN+ E GSK+W +TL+L
Sbjct: 51  NGHIPTFEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRLNKGEWGSKLWFVTLLL 110

Query: 63  NIRXXXXXXXXXXXXXXXISDELEFQLTKLKMEKIGNYSKDVTLIIKDKLQNSLKIINNS 122
           + R               + +E++    +L+ E   +  K V   +++K  ++LK  +  
Sbjct: 111 SARKSFSRLLKIMKAKSKLKEEMK----ELRTEGDEDLVKQV---LRNKFTDALKKCSII 163

Query: 123 IKDRIFDXXXXXXXXXXXXXXXGGHYYK--SLQRFKHILEIISNMLIVSRVFSTNFN 177
           IKD + +                   +K    Q+   ILE +S+ + V R+F+T + 
Sbjct: 164 IKDVVLELLQTLAYLAIVVI----EVFKINVSQKVIKILEPLSHFIAVIRIFTTGYT 216

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
           Anc_1.10 YCL056C
          Length = 185

 Score = 73.2 bits (178), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 86/164 (52%), Gaps = 14/164 (8%)

Query: 17  LESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIRXXXXXXXXXXX 76
           LE IC+VFDNIYFL+++G+I + N  Y+ LN+  LGSKIWL++L+L+IR           
Sbjct: 27  LEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSLILSIRRCFKNLTHMYR 86

Query: 77  XXXXISDELEFQLTKLKMEKIGNYSKD---VTLIIKDKLQNSLKIINNSIKDRIFDXXXX 133
                  EL        + K  N S +   V  I+KDKL  SL+  N+ I+D + +    
Sbjct: 87  TRRKYVTELSI------VSKKRNQSSENGLVNGILKDKLLQSLQKCNSIIRDLLLEFLQV 140

Query: 134 XXXXXXXXXXXGGHYYKSLQRF-KHI--LEIISNMLIVSRVFST 174
                           KSL+R+ K I  LEI+SN++ V+R+ + 
Sbjct: 141 LLYLIIVIIEV--FKVKSLERYVKGIRNLEILSNLITVTRIITA 182

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score = 74.7 bits (182), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 79/167 (47%), Gaps = 11/167 (6%)

Query: 12  DILYG-LESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIRXXXXX 70
           DIL G LES+ +VFD++Y L++ G+I +TN  YR LN+  LGSK+WL TLVL++R     
Sbjct: 178 DILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVLSLRKSLGQ 237

Query: 71  XXXXXXXXXXISDELEFQLTKLKMEKIGNYSKDVTLIIKDKLQNSLKIINNSIKDRIFDX 130
                     +  E        +       SK    II DK    +  ++  IKD + D 
Sbjct: 238 LFRLARARHMLQKE--------RRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDV 289

Query: 131 XXXXXXXXXXXXXXGGHYYKSLQRFKHILEIISNMLIVSRVFSTNFN 177
                              K   R++ +LE +S+++ VSR F T F+
Sbjct: 290 LQNLAYLLVVAVDV--FKLKLPHRWRRLLEWVSSLVTVSRFFFTGFS 334

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
          Anc_1.10 YCL056C
          Length = 174

 Score = 72.0 bits (175), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 34/58 (58%), Positives = 46/58 (79%), Gaps = 2/58 (3%)

Query: 9  WKFDILYG-LESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIR 65
          W+ D+L G LESICS+FDNIY L+S+G+IS  N  YR LN+  +GSK+W +TL+L+IR
Sbjct: 9  WE-DVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLILSIR 65

>NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON}
          Anc_1.10 YCL056C
          Length = 171

 Score = 69.3 bits (168), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 41/54 (75%)

Query: 12 DILYGLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIR 65
           I+ GLE IC++FDN+Y L+S+G+IS+ NL YR LN+   GSKIW +TL+L  R
Sbjct: 8  SIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFGSKIWFVTLILTTR 61

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON}
          Anc_1.10 YCL056C
          Length = 184

 Score = 69.3 bits (168), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 42/54 (77%)

Query: 12 DILYGLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIR 65
          +++ GLES+CS FDN+YF +S+G+I + N  YR LN+   GSK+W +TL+L++R
Sbjct: 25 NLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVR 78

>TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10
           YCL056C
          Length = 177

 Score = 68.9 bits (167), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 64/113 (56%), Gaps = 9/113 (7%)

Query: 17  LESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIRXXXXXXXXXXX 76
           LESI ++FD ++FLRS GLI + N FYR LNRS +GSKIW +TL+L+IR           
Sbjct: 25  LESITNIFDLVFFLRSTGLIKENNFFYRNLNRSNIGSKIWFVTLILSIRKLYKNILKSTK 84

Query: 77  XXXXISDELEFQLTKLKMEKIGNYSKDVTLIIKDKLQNSLKIINNSIKDRIFD 129
               +  EL       K+EK  + + D+ L    K+QN+  I+   IK+ I +
Sbjct: 85  LLSLLKTELT------KIEKNNDLTSDIIL---QKIQNNNTILKKKIKNFIIE 128

>NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1.10
           YCL056C
          Length = 167

 Score = 68.2 bits (165), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 89/169 (52%), Gaps = 13/169 (7%)

Query: 12  DILYGLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIRXXXXXX 71
           ++L  LESIC++FDN+YF +SIG++S+ N+ YR LN+ + GSK+W +TL+L+ +      
Sbjct: 7   NVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGSKLWFLTLLLSSKKLITRL 66

Query: 72  XXXXXXXXXISDELEFQLTKLKMEKIGNYSKDVTLI---IKDKLQNSLKIINNSIKDRIF 128
                    I  E++        E      +D +L+   +++KL+ SL    + I++ + 
Sbjct: 67  TKSLKIRAKIKKEID--------ESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVL 118

Query: 129 DXXXXXXXXXXXXXXXGGHYYKSLQRFKHILEIISNMLIVSRVFSTNFN 177
           +                    K  Q++KH+LE +SN++ + RVF + ++
Sbjct: 119 ELLQTMMYLSIAFINV--FKVKVPQKWKHLLEQLSNIITIIRVFISGYS 165

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score = 60.8 bits (146), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 87/181 (48%), Gaps = 17/181 (9%)

Query: 2   DIVNNSIWKFDILYGLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLV 61
           D  +NS+    ++  L S+ S FD++Y LRS G+ISDTN  Y+ LN+ ++GSK+WL++L+
Sbjct: 27  DAPSNSLEDL-LIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWLVSLL 85

Query: 62  LNIRXXXXXXXXXXXXXXXISDELEFQLTKLKMEKIGNYSKDVTLIIKDKLQNSLKIINN 121
           L+IR                   L+ +L K  M     YS     ++K+K+       +N
Sbjct: 86  LSIRRSLTRLYTLI--------RLKLKLRKECMNIASTYSPGFKKLVKEKILAE----SN 133

Query: 122 SIKDRIFDXXXXXXXXXXXXXXXGGHYYK---SLQRFKHILEIISNMLIVSRVFSTNFNL 178
            +  +I                     +K   SL +FK  LE+IS+   V +  S+++ +
Sbjct: 134 QLSLKIRSLCMDLLQDLLYMIIVSIDIFKINLSL-KFKRALELISSAATVLKFVSSSYQI 192

Query: 179 A 179
           +
Sbjct: 193 S 193

>Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}
          [contig 123] FULL
          Length = 193

 Score = 58.5 bits (140), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 39/50 (78%)

Query: 16 GLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIR 65
          G+ES+  +FD+I+ L+S G+IS++N  YR LN+S   SK+WL++LVL+ R
Sbjct: 40 GMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLVLSTR 89

>KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}
          conserved hypothetical protein
          Length = 195

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 38/53 (71%)

Query: 13 ILYGLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIR 65
          ++ GLE+I  +FD++  LRS G+I + N+FY+ LN+S   SK WL++L L+ R
Sbjct: 37 LVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTLSSR 89

>Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON}
          complement(23954..24448) [495 nt, 165 aa]
          Length = 164

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 29/36 (80%)

Query: 9  WKFDILYGLESICSVFDNIYFLRSIGLISDTNLFYR 44
          W+  +L GLE ICS+FD+IYF++++G+I+D +  YR
Sbjct: 6  WEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYR 41

>NCAS0C00510 Chr3 (83308..84645) [1338 bp, 445 aa] {ON} Anc_8.822
           YMR268C
          Length = 445

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 29/51 (56%)

Query: 8   IWKFDILYGLESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLI 58
           + KF++   +E  C ++DNI  ++ I L+ D N    +L+ + + +K  +I
Sbjct: 319 VSKFELRSFIEEKCHMYDNIEHIKDIHLVPDHNGALLVLSNNNIAAKYSMI 369

>Ecym_1012 Chr1 complement(22226..22759) [534 bp, 177 aa] {ON}
          similar to XP_452220 - K. lactis - KLLA0C00594g
          Length = 177

 Score = 28.9 bits (63), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 17 LESICSVFDNIYFLRSIGLISDTNLFYRLLNRSELGSKIWLITLVLNIR 65
          L S  + +D IY  +SIG+I   N+ Y+ L   ++ S   L+ L+L  R
Sbjct: 41 LRSAVTFYDLIYLFQSIGIIKKDNVIYKALAVGKINSGSRLLFLLLVAR 89

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.143    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,140,174
Number of extensions: 545219
Number of successful extensions: 2197
Number of sequences better than 10.0: 20
Number of HSP's gapped: 2226
Number of HSP's successfully gapped: 20
Length of query: 181
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 78
Effective length of database: 41,670,801
Effective search space: 3250322478
Effective search space used: 3250322478
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 62 (28.5 bits)