Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A049601.8ON96963749e-48
Kpol_2002.111.8ON86723113e-38
SAKL0C00528g1.8ON110693072e-37
AFR743W1.8ON82713034e-37
CAGL0B00396g1.8ON88713027e-37
KLTH0F00550g1.8ON82712992e-36
NCAS0B090801.8ON93722974e-36
ZYRO0F18414g1.8ON87692975e-36
Ecym_10101.8ON82712941e-35
TPHA0E039801.8ON86712932e-35
Kwal_33.130161.8ON82712904e-35
YCL057C-A (MOS1)1.8ON97702914e-35
Skud_3.61.8ON97702906e-35
Smik_3.171.8ON97702908e-35
Suva_3.1551.8ON97702845e-34
KLLA0C00550g1.8ON82672644e-31
KAFR0D001701.8ON90722584e-30
TDEL0C069401.8ON86722576e-30
KNAG0C002501.8ON94722508e-29
NDAI0A001701.8ON96962491e-28
SAKL0G15444g5.101ON50449589.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A04960
         (96 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   148   9e-48
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   124   3e-38
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   122   2e-37
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   121   4e-37
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   120   7e-37
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   119   2e-36
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   119   4e-36
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   119   5e-36
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   117   1e-35
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   117   2e-35
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...   116   4e-35
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...   116   4e-35
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...   116   6e-35
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...   116   8e-35
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...   114   5e-34
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...   106   4e-31
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...   103   4e-30
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...   103   6e-30
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...   100   8e-29
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...   100   1e-28
SAKL0G15444g Chr7 (1329020..1330534) [1515 bp, 504 aa] {ON} simi...    27   9.4  

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  148 bits (374), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 75/96 (78%)

Query: 1  MSEXXXXXXXXXXXXXXXXXXXXXNRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFK 60
          MSE                     NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFK
Sbjct: 1  MSEQIAQQTTTPTTTESASTAVTSNRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFK 60

Query: 61 RRAFPVWLGVGFGLGRGYSEGDAIFRSTAGLRSFQV 96
          RRAFPVWLGVGFGLGRGYSEGDAIFRSTAGLRSFQV
Sbjct: 61 RRAFPVWLGVGFGLGRGYSEGDAIFRSTAGLRSFQV 96

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  124 bits (311), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 59/72 (81%), Positives = 64/72 (88%)

Query: 25 NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAI 84
           RSILNDKWD+V+SN LVKT+ GFGAGVLASVI FKRRAFPVWLG+GFG+GRGYSEGDAI
Sbjct: 15 TRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFGIGRGYSEGDAI 74

Query: 85 FRSTAGLRSFQV 96
          FRS AGLR   V
Sbjct: 75 FRSAAGLRKSTV 86

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  122 bits (307), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 55/69 (79%), Positives = 66/69 (95%)

Query: 25  NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAI 84
           N+SILNDKWD+V+SN++VKT  GFGAG++ASV+ FKRRAFPVWLGVGFGLGRGY+EGDAI
Sbjct: 39  NKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGLGRGYAEGDAI 98

Query: 85  FRSTAGLRS 93
           FRS+AGLR+
Sbjct: 99  FRSSAGLRT 107

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  121 bits (303), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 66/71 (92%)

Query: 25 NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAI 84
          +RSILNDKWD+V+SN++VKT  GFGAGV ASV+FFKRRAFPVWLGVGFGLGRGY+EGDAI
Sbjct: 11 SRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLGRGYAEGDAI 70

Query: 85 FRSTAGLRSFQ 95
          FRS AGLR+ +
Sbjct: 71 FRSHAGLRAVR 81

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score =  120 bits (302), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 64/71 (90%)

Query: 26 RSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAIF 85
          RSILNDKWD+V+SNM+VK   GFG GV+ SV+FFKRR+FPVWLGVGFG GRGYSEGDAIF
Sbjct: 18 RSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGAGRGYSEGDAIF 77

Query: 86 RSTAGLRSFQV 96
          RSTAGLRS +V
Sbjct: 78 RSTAGLRSVKV 88

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  119 bits (299), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 67/71 (94%)

Query: 25 NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAI 84
          +RS+LNDKWD+V+SN++VKT  GFGAGV+ASV+ FKRRAFPVW+GVGFGLGRGY+EGDAI
Sbjct: 11 SRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFGLGRGYAEGDAI 70

Query: 85 FRSTAGLRSFQ 95
          FRS+AGLR+ +
Sbjct: 71 FRSSAGLRTVK 81

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  119 bits (297), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 64/72 (88%)

Query: 25 NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAI 84
          +RSILNDKWD+V+SNMLVK   GF  GV+ASVIFFKRR FPVWLG+GFG+GRGY+EGDAI
Sbjct: 22 DRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIGFGVGRGYAEGDAI 81

Query: 85 FRSTAGLRSFQV 96
          FRS AGLR+ +V
Sbjct: 82 FRSPAGLRTAKV 93

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  119 bits (297), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 64/69 (92%)

Query: 25 NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAI 84
          N+SILNDKWD+V+SN+LVK+  GFG GV+ASV+ FKRRAFPVWLG+GFGLGRGY+EGDAI
Sbjct: 16 NKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGDAI 75

Query: 85 FRSTAGLRS 93
          FRS AGLR+
Sbjct: 76 FRSAAGLRT 84

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  117 bits (294), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 64/71 (90%)

Query: 25 NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAI 84
          +RSILNDKWD+V+SN++VK   GF  GVLASV+FFKRRAFPVWLG+GFGLGRGY+EGDAI
Sbjct: 11 SRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRGYAEGDAI 70

Query: 85 FRSTAGLRSFQ 95
          FRS AGLR+ +
Sbjct: 71 FRSHAGLRTMK 81

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  117 bits (293), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 53/71 (74%), Positives = 64/71 (90%)

Query: 26 RSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAIF 85
          +SILNDKWD+V+SNMLVKT  GFG GV+ S++ FKRRAFPVWLG+GFG+GRGYS+GDAIF
Sbjct: 16 KSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGIGFGVGRGYSDGDAIF 75

Query: 86 RSTAGLRSFQV 96
          RS AGLRS ++
Sbjct: 76 RSAAGLRSTRI 86

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score =  116 bits (290), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 53/71 (74%), Positives = 65/71 (91%)

Query: 25 NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAI 84
          +RS+LNDKWD+V+SN++VK   GFGAGV+ASV+ FKRRA PVW+GVGFGLGRGYSEGDAI
Sbjct: 11 SRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGRGYSEGDAI 70

Query: 85 FRSTAGLRSFQ 95
          FRS+AGLR+ +
Sbjct: 71 FRSSAGLRTVK 81

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score =  116 bits (291), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%)

Query: 27 SILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAIFR 86
          +IL+ KWDIV+SNMLVKT  GFG GV  SV+FFKRRAFPVWLG+GFG+GRGY+EGDAIFR
Sbjct: 28 TILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87

Query: 87 STAGLRSFQV 96
          S+AGLRS +V
Sbjct: 88 SSAGLRSSKV 97

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  116 bits (290), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 63/70 (90%)

Query: 27 SILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAIFR 86
          +IL+ KWDIV+SNMLVKT  GFG GV  SV+FFKRRAFPVWLG+GFG+GRGY+EGDAIFR
Sbjct: 28 TILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87

Query: 87 STAGLRSFQV 96
          S+AGLRS +V
Sbjct: 88 SSAGLRSSKV 97

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  116 bits (290), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 53/70 (75%), Positives = 63/70 (90%)

Query: 27 SILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAIFR 86
          ++L+ KWDIV+SNMLVKT  GFG GV  SV+FFKRRAFPVWLG+GFG+GRGY+EGDAIFR
Sbjct: 28 TVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87

Query: 87 STAGLRSFQV 96
          S+AGLRS +V
Sbjct: 88 SSAGLRSSKV 97

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  114 bits (284), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (88%)

Query: 27 SILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAIFR 86
          ++L+ KWDIV+SNMLVKT  GFG GV  SV+FFKRRAFP WLG+GFG+GRGY+EGDAIFR
Sbjct: 28 TVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRAFPAWLGIGFGVGRGYAEGDAIFR 87

Query: 87 STAGLRSFQV 96
          S+AGLRS +V
Sbjct: 88 SSAGLRSSKV 97

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  106 bits (264), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 59/67 (88%)

Query: 27 SILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAIFR 86
          SIL+ +WD+V+SN++ KT  G G G++ASV+FFKRRAFPVW+GVGFGLGRGY+EGDAIFR
Sbjct: 13 SILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGVGFGLGRGYAEGDAIFR 72

Query: 87 STAGLRS 93
          + AGLR 
Sbjct: 73 TNAGLRK 79

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score =  103 bits (258), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 56/72 (77%), Positives = 63/72 (87%)

Query: 25 NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAI 84
          +RSILNDKWD+V+SNMLVK   GFG GV+ SVIFFKRRAFPVWLG+G+G GR YSEGDAI
Sbjct: 19 DRSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFFKRRAFPVWLGIGYGFGRAYSEGDAI 78

Query: 85 FRSTAGLRSFQV 96
          FRS AGLRS Q+
Sbjct: 79 FRSNAGLRSVQI 90

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  103 bits (257), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 57/72 (79%), Positives = 65/72 (90%)

Query: 25 NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAI 84
          +RSILNDKWD+V+SNMLVKT  GFG GV+ SV+FFKRRAFPVWLG+GFGLGRGY+EGDAI
Sbjct: 15 SRSILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFFKRRAFPVWLGIGFGLGRGYAEGDAI 74

Query: 85 FRSTAGLRSFQV 96
          FRS AGLRS + 
Sbjct: 75 FRSAAGLRSVKA 86

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score =  100 bits (250), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 52/72 (72%), Positives = 65/72 (90%)

Query: 25 NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFGLGRGYSEGDAI 84
          +RS+LNDKWD+V+SNMLVK   GFG GV+ SV+ F+RRAFPVWLG+GFG+GRGYSEGDAI
Sbjct: 23 DRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRAFPVWLGIGFGVGRGYSEGDAI 82

Query: 85 FRSTAGLRSFQV 96
          FRST+G+R+ +V
Sbjct: 83 FRSTSGIRTVKV 94

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score =  100 bits (249), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 65/96 (67%)

Query: 1  MSEXXXXXXXXXXXXXXXXXXXXXNRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFK 60
          MSE                     ++SILNDKWDIV+SN LVK   GFG GV+ SVIFFK
Sbjct: 1  MSEQVNKTEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFFK 60

Query: 61 RRAFPVWLGVGFGLGRGYSEGDAIFRSTAGLRSFQV 96
          RR FPVWLG+GFG GRGY+EGDAIFRS+AG+RS  V
Sbjct: 61 RRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96

>SAKL0G15444g Chr7 (1329020..1330534) [1515 bp, 504 aa] {ON} similar
           to uniprot|P50076 Saccharomyces cerevisiae YGR227W DIE2
           Dolichyl-phosphoglucose-dependent glucosyltransferase of
           the ER functions in the dolichol pathway that
           synthesizes the dolichol-linked oligosaccharide
           precursor for N-linked protein glycosylation has a role
           in regulation of ITR1 and INO1
          Length = 504

 Score = 26.9 bits (58), Expect = 9.4,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 9/49 (18%)

Query: 25  NRSI-LNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGF 72
           NRSI L DK + V    LV+  +GF     A ++ F   +FP+W+  GF
Sbjct: 268 NRSITLGDKENHVAGLHLVQIFYGF-----AFIVMF---SFPIWISKGF 308

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.143    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,872,113
Number of extensions: 213767
Number of successful extensions: 529
Number of sequences better than 10.0: 21
Number of HSP's gapped: 529
Number of HSP's successfully gapped: 21
Length of query: 96
Length of database: 53,481,399
Length adjustment: 67
Effective length of query: 29
Effective length of database: 45,798,777
Effective search space: 1328164533
Effective search space used: 1328164533
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)