Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A049501.7ON1131135453e-73
SAKL0C00506g1.7ON1051131738e-17
YCL058W-A (ADF1)1.7ON113871652e-15
Skud_3.51.7ON113911555e-14
Smik_3.161.7ON113871548e-14
TPHA0E039901.7ON116901487e-13
Kpol_2002.101.7ON1111171479e-13
Suva_3.1541.7ON113871425e-12
NCAS0B090901.7ON119921419e-12
TDEL0C069501.7ON1111111331e-10
NDAI0A001601.7ON123961322e-10
KAFR0D001601.7ON111951303e-10
KNAG0C002401.7ON126951289e-10
ZYRO0F18436g1.7ON1121101155e-08
KLTH0F00528g1.7ON1041031138e-08
Kwal_YGOB_YCL058W-A1.7ON1051031112e-07
Kwal_33.13015singletonOFF1051031112e-07
CAGL0B00374g1.7ON121961043e-06
AFR743CA1.7ON101113999e-06
SAKL0D07546g1.347ON41668700.35
CAGL0L07216g2.362ON85877661.2
KLLA0C00528g1.7ON11676641.2
TPHA0C006408.350ON79159651.8
KLLA0E17557g3.196ON68687642.2
KAFR0K006407.74ON130855607.6
ACR018C6.8ON47843598.9
Kpol_359.123.438ON107542599.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A04950
         (113 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....   214   3e-73
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    71   8e-17
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...    68   2e-15
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)    64   5e-14
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...    64   8e-14
TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON...    62   7e-13
Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....    61   9e-13
Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...    59   5e-12
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    59   9e-12
TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {...    56   1e-10
NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...    55   2e-10
KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...    55   3e-10
KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...    54   9e-10
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    49   5e-08
KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...    48   8e-08
Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...    47   2e-07
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...    47   2e-07
CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...    45   3e-06
AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}...    43   9e-06
SAKL0D07546g Chr4 (619015..620265) [1251 bp, 416 aa] {ON} simila...    32   0.35 
CAGL0L07216g Chr12 complement(801526..804102) [2577 bp, 858 aa] ...    30   1.2  
KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no simila...    29   1.2  
TPHA0C00640 Chr3 complement(120261..122636) [2376 bp, 791 aa] {O...    30   1.8  
KLLA0E17557g Chr5 complement(1559577..1561637) [2061 bp, 686 aa]...    29   2.2  
KAFR0K00640 Chr11 complement(139815..143741) [3927 bp, 1308 aa] ...    28   7.6  
ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON} S...    27   8.9  
Kpol_359.12 s359 complement(18165..21392) [3228 bp, 1075 aa] {ON...    27   9.7  

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score =  214 bits (545), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 113/113 (100%), Positives = 113/113 (100%)

Query: 1   MAKTTVRSKLKKSGKTPSRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGK 60
           MAKTTVRSKLKKSGKTPSRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGK
Sbjct: 1   MAKTTVRSKLKKSGKTPSRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGK 60

Query: 61  SKELAKNVNTLSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113
           SKELAKNVNTLSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL
Sbjct: 61  SKELAKNVNTLSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 71.2 bits (173), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 72/113 (63%), Gaps = 8/113 (7%)

Query: 1   MAKTTVRSKLKKSGKTPSRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGK 60
           MAK   ++K     K PS   G +K ++     KKR ++QVE++NKQ+ LLSD+   N  
Sbjct: 1   MAKPLSKTKKDNGSKKPS---GGIKKSQ-----KKRTRIQVEQLNKQEFLLSDLNMTNAG 52

Query: 61  SKELAKNVNTLSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113
           S +  +   TL +K L +DQ+KD+    +++ ++K TND+++AQ+EMISGFSL
Sbjct: 53  STKTKEKPKTLQAKALAQDQKKDKETRDKLEKQRKDTNDNMLAQLEMISGFSL 105

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score = 68.2 bits (165), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/87 (44%), Positives = 56/87 (64%), Gaps = 2/87 (2%)

Query: 29  ISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKELAK--NVNTLSSKQLKKDQEKDRLL 86
           IS  ++KR KLQVEK+NK    +   +     ++E AK     TL +++L KDQEKD  +
Sbjct: 27  ISTAERKRTKLQVEKLNKSSETMIPTLLREASTQEPAKLKAETTLKAEELIKDQEKDSKV 86

Query: 87  NVEIKNKKKQTNDDLIAQIEMISGFSL 113
             +I+ +K +TND ++ QIEMISGFSL
Sbjct: 87  REQIRTEKSKTNDSMLKQIEMISGFSL 113

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score = 64.3 bits (155), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 57/91 (62%), Gaps = 2/91 (2%)

Query: 25  KANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKELAKNV--NTLSSKQLKKDQEK 82
           K   IS  ++KR KLQVEK+NK   ++   +     ++E  K    +TL +++L KDQ K
Sbjct: 23  KKRPISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQEPTKKRAKSTLKAEELVKDQAK 82

Query: 83  DRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113
           D  +  +I+ +K +TND ++ QIEMISGFSL
Sbjct: 83  DCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 63.9 bits (154), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 40/87 (45%), Positives = 55/87 (63%), Gaps = 2/87 (2%)

Query: 29  ISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKELAK--NVNTLSSKQLKKDQEKDRLL 86
           IS   KKR KLQVEK+NK   ++   +     ++E AK    +TL +  L KDQEKD  +
Sbjct: 27  ISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQEPAKRKTESTLKAGDLIKDQEKDSKV 86

Query: 87  NVEIKNKKKQTNDDLIAQIEMISGFSL 113
              I+ +K +TND+++ QIEMISGFSL
Sbjct: 87  REHIQMEKSKTNDNMLKQIEMISGFSL 113

>TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 116

 Score = 61.6 bits (148), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 44/90 (48%), Positives = 59/90 (65%), Gaps = 6/90 (6%)

Query: 28  KISVGDKKRAKLQVEKMNKQDSLLSDIIN----LNGKSKELAKNVNTLSSKQLKKDQEKD 83
           K+S   +K  K +VEK+NK + + SD IN    LNGK +E  K  + L +K L KD  KD
Sbjct: 29  KLSSQVRKSTKHKVEKLNKLEVISSDDINALNALNGKKRE--KQTSVLEAKTLAKDNLKD 86

Query: 84  RLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113
           R L  +I++KKK+TN  L+ QIEM+SGFSL
Sbjct: 87  RQLIEKIESKKKETNASLLQQIEMMSGFSL 116

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score = 61.2 bits (147), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 73/117 (62%), Gaps = 10/117 (8%)

Query: 1   MAKTTVRSKLKKS-GKTPSRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNG 59
           MAK++V  + K + GK   RK      N IS  +KKR K+++EK+NK+  L SDI+ LN 
Sbjct: 1   MAKSSVSMRKKGNVGKKSKRK------NVISQSEKKRNKIKMEKINKEGILPSDILQLNN 54

Query: 60  KSKELAKNVN---TLSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113
           +++      N    L S++L++D  KDR    +I+  KK+T+D ++ QIE+++GFSL
Sbjct: 55  ETRNGQSEGNKERALESQKLQQDNVKDRETIAKIEASKKETDDSMLKQIELMTGFSL 111

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 59.3 bits (142), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (60%), Gaps = 2/87 (2%)

Query: 29  ISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKEL--AKNVNTLSSKQLKKDQEKDRLL 86
           IS  + KR KLQVE++NK    +   +      ++L   K  +TL +++L KDQ +D  +
Sbjct: 27  ISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQDLDKKKTRSTLEAEELVKDQARDSKV 86

Query: 87  NVEIKNKKKQTNDDLIAQIEMISGFSL 113
              I+ +K +TND ++ QIEMISGFSL
Sbjct: 87  REHIETEKSKTNDSMLKQIEMISGFSL 113

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score = 58.9 bits (141), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 62/92 (67%), Gaps = 6/92 (6%)

Query: 27  NKISVGDKKRAKLQVEKMNKQDSLLS-DIINLNGKSKELAKNVNTLSS----KQLKKDQE 81
           N IS  D+K+AK QVEK+NK+++LL  ++++L  K K L+K    L S    + L +DQ+
Sbjct: 29  NSISFSDRKKAKHQVEKLNKKENLLPMNVLDLQ-KKKNLSKKPEPLKSILHARSLLQDQK 87

Query: 82  KDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113
           KD+ +  +I+ ++K T+D +  QIEMISGF+ 
Sbjct: 88  KDKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119

>TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 111

 Score = 55.8 bits (133), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 66/111 (59%), Gaps = 3/111 (2%)

Query: 5   TVRSKLKKSGKTPSRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKS--K 62
            V++  KK+GK   +     K   IS  D K+ K +VE +N+  + LS+II LN  +  K
Sbjct: 2   AVKNNFKKTGKGVQKNQKNCKK-AISRRDVKKTKFRVENLNRDTASLSEIIKLNASTAVK 60

Query: 63  ELAKNVNTLSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113
             A+  NTL ++ L+KD +KD+ +  + K +K++  ++L  QIE ISGFSL
Sbjct: 61  GSARKANTLENRTLQKDWQKDQKIREKSKAEKEEMANNLEKQIEDISGFSL 111

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score = 55.5 bits (132), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 56/96 (58%), Gaps = 7/96 (7%)

Query: 25  KANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKS-------KELAKNVNTLSSKQLK 77
           K N I   D+K+ K++V   NK+ SL  ++  LN +S       ++  +  ++LS+  L 
Sbjct: 28  KNNVIKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDSLRKGSSLSAHDLL 87

Query: 78  KDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113
            DQ+KD   N  I+ +KKQ NDD++ QIEMISGF  
Sbjct: 88  NDQKKDIEANNRIQTEKKQVNDDMLRQIEMISGFKF 123

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score = 54.7 bits (130), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 58/95 (61%), Gaps = 6/95 (6%)

Query: 23  KVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKE----LAKNVNTLSSKQLKK 78
           K + N IS  ++K+ KL VEK N+Q   ++++  LN   K+    L+K  N L +K+L  
Sbjct: 19  KSRKNVISQSERKKNKLIVEKFNQQ--TITNVQELNKDLKKDKRRLSKTKNALETKKLLH 76

Query: 79  DQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113
           DQ +D  +   I+ K K+T D ++ QIEMISGFSL
Sbjct: 77  DQARDHEVKQNIETKLKETEDSMLKQIEMISGFSL 111

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score = 53.9 bits (128), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 58/95 (61%), Gaps = 10/95 (10%)

Query: 29  ISVGDKKRAKLQVEKMNKQDSLL-----SDIINLNGKSKELAKNVN-----TLSSKQLKK 78
           I + ++KR KLQVEK+N+  + +      DI N   K  +  +  N     +L  ++L +
Sbjct: 32  IPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNRTVHRSLDVEKLAQ 91

Query: 79  DQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113
           D+ KDR++  ++  K+K+T+  ++AQIEMISGFSL
Sbjct: 92  DKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 48.9 bits (115), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 64/110 (58%), Gaps = 9/110 (8%)

Query: 5   TVRSKLKKSGKTPSRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLN-GKSKE 63
            VRSK     K P +         IS  DKKR K +VEK++ +  L S+I  LN   S +
Sbjct: 11  AVRSKHNNGFKKPKKS--------ISHSDKKRTKSKVEKLDAKGLLPSEIFKLNRSASSK 62

Query: 64  LAKNVNTLSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113
            +   ++L ++ L++D++ D+    +   KKK+T+++++ QIEMISGFSL
Sbjct: 63  TSNGSSSLLARNLEQDRKMDQDTRDKANAKKKETDNNILQQIEMISGFSL 112

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score = 48.1 bits (113), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 61/103 (59%), Gaps = 2/103 (1%)

Query: 11  KKSGKTPSRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKELAKNVNT 70
           K SGK P R    V    I    K R KL+VE+ NK+  L+S++ N    + +    + +
Sbjct: 4   KGSGKKP-RSTRDVSKGVIRKHQKIRTKLKVEQANKESFLISEL-NEREHNTKRTPALES 61

Query: 71  LSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113
           L    L +D+EKD+ +  +++ +K+ T++++I Q+E+ISGFSL
Sbjct: 62  LKVSDLIEDREKDKSMQKKMEEQKQSTDNNIIEQLELISGFSL 104

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score = 47.4 bits (111), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 63/103 (61%), Gaps = 5/103 (4%)

Query: 15  KTPSRKLGKVKA----NKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKELAKNVNT 70
           K PS+KL   K     N I    K R KL+VE+ NK+  L+S++ N    +K  +  + +
Sbjct: 4   KGPSKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANKEVFLISEL-NKREDTKRQSSPLES 62

Query: 71  LSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113
           L   +L KD +KD+    ++++++K T+++++ Q+E+ISGFSL
Sbjct: 63  LKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score = 47.4 bits (111), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 63/103 (61%), Gaps = 5/103 (4%)

Query: 15  KTPSRKLGKVKA----NKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKELAKNVNT 70
           K PS+KL   K     N I    K R KL+VE+ NK+  L+S++ N    +K  +  + +
Sbjct: 4   KGPSKKLPTSKPRGSKNVIKKHQKIRTKLKVEQANKEVFLISEL-NKREDTKRQSSPLES 62

Query: 71  LSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113
           L   +L KD +KD+    ++++++K T+++++ Q+E+ISGFSL
Sbjct: 63  LKPSRLVKDIKKDQNAQKQLESQRKATDENVLRQLELISGFSL 105

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score = 44.7 bits (104), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 57/96 (59%), Gaps = 6/96 (6%)

Query: 23  KVKANKISVGDKKRAKLQVEKMNKQDSLLSDI-----INLNGKSKELAKNVNTLSSKQLK 77
           K   NKIS  ++K++K+   ++NK D+ ++++     +N N  ++E  K    L    L 
Sbjct: 27  KTGVNKISASERKKSKILTARLNK-DADVAELKIIQELNDNKIAEEPKKRQTALDMNCLV 85

Query: 78  KDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113
           KDQ++D+ +   I+    +TN D++ Q+E++SGFSL
Sbjct: 86  KDQKRDKKVREHIEKINSETNSDMLKQLELMSGFSL 121

>AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL058W-A
          Length = 101

 Score = 42.7 bits (99), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 54/113 (47%), Gaps = 12/113 (10%)

Query: 1   MAKTTVRSKLKKSGKTPSRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGK 60
           MA    R+K  K+G +        K  KIS  DKKRAKLQVEK++K+      ++     
Sbjct: 1   MAAFQHRAKRSKNGASA-------KQGKISKADKKRAKLQVEKLDKR-----GVLLAELT 48

Query: 61  SKELAKNVNTLSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIAQIEMISGFSL 113
           +   A     L +  L +DQ  D     +   ++   +  ++ Q+E I+GFSL
Sbjct: 49  AAAPAAKTGVLQAASLAQDQRSDAQAQQQRAQERSNVDKKVVQQLEAIAGFSL 101

>SAKL0D07546g Chr4 (619015..620265) [1251 bp, 416 aa] {ON} similar
           to uniprot|P47051 Saccharomyces cerevisiae YJL046W
           Hypothetical ORF
          Length = 416

 Score = 31.6 bits (70), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 36/68 (52%), Gaps = 2/68 (2%)

Query: 44  MNKQDSLLSDIINLNGKSKELAKNVNTLSSKQLKKDQEKDRLLNVEIKNKKKQTNDDLIA 103
            N  +S+ SD+ NL GK  +  +   ++ S+  + +   D  + V   +++K  ND+L+ 
Sbjct: 291 CNSVESVRSDVDNLQGKLLDTTEEFTSIVSEGFRHEFGDD--IPVYYCDERKSVNDELLQ 348

Query: 104 QIEMISGF 111
            IE++  F
Sbjct: 349 TIELLKSF 356

>CAGL0L07216g Chr12 complement(801526..804102) [2577 bp, 858 aa]
           {ON} similar to uniprot|P33775 Saccharomyces cerevisiae
           YDL095w PMT1 mannosyltransferase or uniprot|P52867
           Saccharomyces cerevisiae YDL093w
          Length = 858

 Score = 30.0 bits (66), Expect = 1.2,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 41/77 (53%), Gaps = 5/77 (6%)

Query: 17  PSRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKELAKNVNTLSSKQL 76
           P ++  K   + ++       + +VEK N+ + +L D+ N     K L  N N LS +Q+
Sbjct: 778 PEQQEKKAVVSDVNGAASPHKREKVEK-NEAERMLDDLSN----KKFLDGNGNELSPEQV 832

Query: 77  KKDQEKDRLLNVEIKNK 93
           KK  EK+ + N++I+ +
Sbjct: 833 KKLLEKEGIENLKIEKE 849

>KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no
           similarity
          Length = 116

 Score = 29.3 bits (64), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 48/76 (63%), Gaps = 2/76 (2%)

Query: 38  KLQVEKMNKQDSLLSDIINLNGKSKELAKNVNTLSSKQLKKDQEKDRLLNVEIKNKKKQT 97
           ++QV +++K D  ++DI+    K+++  ++  +L  +++++  ++D+ +  +   +KK T
Sbjct: 43  QMQVRQLDKLDLSIADIVP--NKAQKKPRSSASLEGQKVREHYKEDKEVVKKHDKEKKAT 100

Query: 98  NDDLIAQIEMISGFSL 113
              +  Q+E+ISGFSL
Sbjct: 101 EKKIEDQLELISGFSL 116

>TPHA0C00640 Chr3 complement(120261..122636) [2376 bp, 791 aa] {ON} 
          Length = 791

 Score = 29.6 bits (65), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 36/59 (61%), Gaps = 3/59 (5%)

Query: 19  RKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKELAKNVNTLSSKQLK 77
           ++L  +  NK+++ D+ RA+ + +K+ K + +   I N N  SK+   N+ + SSKQ++
Sbjct: 694 QQLMNIADNKLNLSDETRAQGKADKIEKNNGINFPIYNFNNYSKQ---NLESQSSKQME 749

>KLLA0E17557g Chr5 complement(1559577..1561637) [2061 bp, 686 aa]
           {ON} weakly similar to YBR007C, uniprot|P38213
           Saccharomyces cerevisiae YBR007C (DSF2)
          Length = 686

 Score = 29.3 bits (64), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 43/87 (49%), Gaps = 7/87 (8%)

Query: 9   KLKKSGKTP------SRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSK 62
           ++  +G TP       R+  K  A + +V D + + + VE+ +  D + S +  L+G S 
Sbjct: 107 RISSTGSTPMISEDTKRETSKAIAVENNVADLRYSYITVEEHD-DDEVQSQVTELSGASN 165

Query: 63  ELAKNVNTLSSKQLKKDQEKDRLLNVE 89
            + K   T +S  +K +   D+ +N+E
Sbjct: 166 GVEKGTVTSASNGVKPNTSSDQPINIE 192

>KAFR0K00640 Chr11 complement(139815..143741) [3927 bp, 1308 aa] {ON}
            Anc_7.74 YAL024C
          Length = 1308

 Score = 27.7 bits (60), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 61   SKELAKNVNTLSSKQLKKDQEKDRLLNVEIKNKKKQTND--DLIAQIEMISGFSL 113
            SK +A+ + TL  ++L  + +   LLN+EIKN+  Q +    L+AQ E +SG  L
Sbjct: 1068 SKTIAEQM-TLVERELLTEIDWKDLLNLEIKNETLQADSWLQLLAQNETLSGIDL 1121

>ACR018C Chr3 complement(388482..389918) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL272C
          Length = 478

 Score = 27.3 bits (59), Expect = 8.9,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 23/43 (53%)

Query: 11  KKSGKTPSRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLSD 53
           +K  K   RK   ++ N + +G    A+ Q++ MN  DSL S+
Sbjct: 394 RKYSKCQLRKKKIIEINVVDMGTSPSARFQIKNMNFTDSLGSE 436

>Kpol_359.12 s359 complement(18165..21392) [3228 bp, 1075 aa] {ON}
           complement(18165..21392) [3228 nt, 1076 aa]
          Length = 1075

 Score = 27.3 bits (59), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 11  KKSGKTPSRKLGKVKANKISVGDKKRAKLQVEKMNKQDSLLS 52
           +  G T S+K+G +    IS+ D +R KL   K+N QD +L+
Sbjct: 888 RSPGSTLSQKIGDIS---ISLEDIERMKLPQMKLNNQDFMLT 926

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.123    0.304 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,504,110
Number of extensions: 480482
Number of successful extensions: 3694
Number of sequences better than 10.0: 448
Number of HSP's gapped: 3649
Number of HSP's successfully gapped: 480
Length of query: 113
Length of database: 53,481,399
Length adjustment: 83
Effective length of query: 30
Effective length of database: 43,964,121
Effective search space: 1318923630
Effective search space used: 1318923630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 59 (27.3 bits)