Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A049401.6ON31631613910.0
SAKL0C00484g1.6ON33931712751e-177
NCAS0B091001.6ON32731612711e-177
NDAI0A001501.6ON31731312591e-175
CAGL0B00352g1.6ON33731312581e-175
Kpol_2002.91.6ON33831612571e-175
Ecym_10091.6ON33631412511e-174
Smik_3.151.6ON31631212481e-174
YCL059C (KRR1)1.6ON31631212471e-173
KNAG0C002301.6ON34931312481e-173
Kwal_33.130111.6ON33431712391e-172
Suva_3.1531.6ON31631212351e-171
Skud_3.41.6ON31631412311e-171
TPHA0E040001.6ON31631612251e-170
KLTH0F00506g1.6ON33231712191e-169
KLLA0C00506g1.6ON33031012181e-169
KAFR0D001501.6ON34427112181e-168
TDEL0C069601.6ON35031512171e-168
AFR744W1.6ON34331012121e-168
ZYRO0F18458g1.6ON31431311951e-166
SAKL0G03740g5.482ON2661461066e-05
Kpol_543.135.482ON2681461051e-04
Ecym_45525.482ON2711461051e-04
KLTH0G02574g5.482ON2711461041e-04
Kwal_47.188645.482ON2711461041e-04
NCAS0A119605.482ON2701681022e-04
TPHA0J028205.482ON2681461013e-04
Suva_8.1975.482ON274148995e-04
TDEL0A034605.482ON272146986e-04
ZYRO0D11440g5.482ON269146987e-04
KNAG0C046105.482ON277168979e-04
NDAI0A043105.482ON274146970.001
CAGL0K09460g5.482ON261146960.001
KLLA0C06446g5.482ON274146950.002
Skud_15.3105.482ON276148940.002
YOR145C (PNO1)5.482ON274148940.002
KAFR0E036005.482ON276146940.003
Smik_15.3265.482ON274148930.003
TBLA0D018905.482ON271146920.004
TBLA0H018305.375ON40664820.10
AAR002W1.420ON178145780.15
KAFR0B030308.309ON46754731.1
AGL183C8.309ON50724702.9
ZYRO0D06974g5.14ON183663703.2
KNAG0G023508.309ON49724685.2
ZYRO0E04356g1.420ON186104665.6
KLTH0E14014g8.798ON48699675.9
Smik_4.5915.375ON41178676.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A04940
         (316 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   540   0.0  
SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   495   e-177
NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   494   e-177
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   489   e-175
CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   489   e-175
Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   488   e-175
Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   486   e-174
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   485   e-174
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   484   e-173
KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   485   e-173
Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   481   e-172
Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   480   e-171
Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   478   e-171
TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   476   e-170
KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   474   e-169
KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   473   e-169
KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   473   e-168
TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   473   e-168
AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   471   e-168
ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   464   e-166
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    45   6e-05
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    45   1e-04
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    45   1e-04
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    45   1e-04
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    45   1e-04
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    44   2e-04
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    44   3e-04
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    43   5e-04
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    42   6e-04
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    42   7e-04
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    42   9e-04
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    42   0.001
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    42   0.001
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    41   0.002
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    41   0.002
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    41   0.002
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    41   0.003
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    40   0.003
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    40   0.004
TBLA0H01830 Chr8 complement(433992..435212) [1221 bp, 406 aa] {O...    36   0.10 
AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic hom...    35   0.15 
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    33   1.1  
AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON} S...    32   2.9  
ZYRO0D06974g Chr4 complement(598154..603664) [5511 bp, 1836 aa] ...    32   3.2  
KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.3...    31   5.2  
ZYRO0E04356g Chr5 complement(332059..332619) [561 bp, 186 aa] {O...    30   5.6  
KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} simi...    30   5.9  
Smik_4.591 Chr4 (1056001..1057236) [1236 bp, 411 aa] {ON} YDR331...    30   6.8  

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  540 bits (1391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/316 (85%), Positives = 269/316 (85%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPAQLPRKVDLEIESGEYFLS                             
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEIKKLKERREKQEEKQVEKEKERRK 300

Query: 301 DFIAPSEKEYKSSLQK 316
           DFIAPSEKEYKSSLQK
Sbjct: 301 DFIAPSEKEYKSSLQK 316

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  495 bits (1275), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 237/317 (74%), Positives = 260/317 (82%), Gaps = 1/317 (0%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           M STHN+DKPWDTP+I+KW+I+EFKPEDNASGLPF EESSFMTLFPKYRE YL+ VW DV
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           T++LDK+H+ACTLDL+EGSM+VKTTRKTYDPAIILKARDLIKLLARSVP+PQA++IL+DD
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXX-XXXXXXXX 239
           KEVRRVVEDCMKNVHPIYHIKELMIKREL+KRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXX 299
                 VYTPFPPAQLPRKVDLEIESGEYFLS                            
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA 300

Query: 300 XDFIAPSEKEYKSSLQK 316
            D++AP E EYKS+L+K
Sbjct: 301 KDYVAPEEAEYKSTLKK 317

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  494 bits (1271), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 234/316 (74%), Positives = 258/316 (81%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVSTHNRDKPWDTPD++KW I+EFKPEDNASGLPF EESSFMTLFPKYRETYL+ VW DV
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           T++L+K+++ C LDL+EGSMTVKTTRKT+DPAIILKARDLIKLLARSVP+PQA++ILQDD
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPF+GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKREL+K+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                +YTPFPPAQLPRKVDLEIESGEYFLS                             
Sbjct: 241 RKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHERREQQAEKQAEKEVERNK 300

Query: 301 DFIAPSEKEYKSSLQK 316
           ++IAP E+ YKSSL+K
Sbjct: 301 NYIAPEEETYKSSLKK 316

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  489 bits (1259), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 233/313 (74%), Positives = 255/313 (81%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVSTHNRDKPWDT +INKW+I+EFKPEDNASGLPF EESSFMTLFPKYRETYL+ VW DV
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           T++L+ +++AC LDL+EGSMTVKTTRKTYDPAIILKARDLIKLLARSVP+PQA++IL+DD
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKN+HPIYHIKELMIKREL+K+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                +YTPFPPAQLPRKVDLEIESGEYFLS                             
Sbjct: 241 KKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLNERREQQAEKQVEKETERNK 300

Query: 301 DFIAPSEKEYKSS 313
           D++APSE  YKSS
Sbjct: 301 DYVAPSEPTYKSS 313

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  489 bits (1258), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 231/313 (73%), Positives = 253/313 (80%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVST+N+DKPWDT DI+KW+I+EFKPEDN SG PF EESSFMTLFPKYRE YL+ +W DV
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           T++LDK+H+ CTLDL+EGSMTVKTTRKT+DPAIILKARDLIKLLARSVP+PQA++ILQDD
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           IACDVIKIGN V NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVV DCMKNVHPIYHIKELMIKREL+KRPELANEDWSRFLPMF             
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPSKV 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPAQLPRKVDL+IESGEYFLS                             
Sbjct: 241 KAEKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300

Query: 301 DFIAPSEKEYKSS 313
           D+IAP E EYKSS
Sbjct: 301 DYIAPKEDEYKSS 313

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  488 bits (1257), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 233/316 (73%), Positives = 255/316 (80%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVSTHN+DKPWDT DI+KW+++EFKPEDNASGLPF EESSFMTLFPKYRE YL+ VW DV
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           TK+LDK H+ACTLDL+EGSMTVKTTRKT+DP  ILKARDLIKLLARSVP+PQAI+IL+DD
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCMKNVHPIYHIKELMIKREL+KRPELA+EDWSRFLPMF             
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFKKRNVARKKAAKP 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPAQ PRKVDLEIESGEYFLS                             
Sbjct: 241 KKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERSK 300

Query: 301 DFIAPSEKEYKSSLQK 316
           D++AP E+EYKS++ K
Sbjct: 301 DYVAPMEEEYKSTITK 316

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  486 bits (1251), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 231/314 (73%), Positives = 258/314 (82%), Gaps = 1/314 (0%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVSTHN+DKPWDTPDI+KW+I+EFKPEDNASGLPF EESSFMTLFPKYRE YL+  W DV
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           T++LDK+H+AC L+L+EGSMTVKTTRKTYDPAIILKARDLIKLLARSVP+PQA++IL+DD
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN  +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKREL+K+PELA++DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMF-KKRNIARKKPKK 239

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPAQLPRKVDLEIE+GEYFLS                             
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299

Query: 301 DFIAPSEKEYKSSL 314
           D+IAP EKEYK++L
Sbjct: 300 DYIAPDEKEYKNAL 313

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  485 bits (1248), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 235/312 (75%), Positives = 253/312 (81%), Gaps = 1/312 (0%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVSTHNRDKPWDT DI+KW+I+EFK EDNASG PF EESSFMTLFPKYRE+YL+ +W DV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           T++LDK+++AC LDL+EGSMTVKTTRKTYDPAIILKARDLIKLLARSVP+PQA++ILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCMKNVHPIYHIKELMIKREL+KRPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXX 299
                 VYTPFPPAQLPRKVDLEIESGEYFLS                            
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA 300

Query: 300 XDFIAPSEKEYK 311
            DFIAP E+ YK
Sbjct: 301 KDFIAPEEETYK 312

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  484 bits (1247), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 234/312 (75%), Positives = 253/312 (81%), Gaps = 1/312 (0%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVSTHNRDKPWDT DI+KW+I+EFK EDNASG PF EESSFMTLFPKYRE+YL+ +W DV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           T++LDK+++AC LDL+EGSMTVKTTRKTYDPAIILKARDLIKLLARSVP+PQA++ILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCMKN+HPIYHIKELMIKREL+KRPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXX 299
                 VYTPFPPAQLPRKVDLEIESGEYFLS                            
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA 300

Query: 300 XDFIAPSEKEYK 311
            DFIAP E+ YK
Sbjct: 301 KDFIAPEEEAYK 312

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  485 bits (1248), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 230/313 (73%), Positives = 252/313 (80%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVSTHN+DKPWDT DI+KW I+EFKPEDNASG PF EESSFMTLFPKYRETYL+ VW DV
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           TK+LD +H+ACTLDL+EGSMTVKTTRKTYDPAIILKARDLIKLLARSVP+PQA++ILQ+D
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN+V NKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM NVHPIYHIKELMIKREL+K+PELANEDWSRFLPMF             
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPAQLPRKVDLEIESGEYFL+                             
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300

Query: 301 DFIAPSEKEYKSS 313
           D+ AP EK Y ++
Sbjct: 301 DYTAPKEKAYGTT 313

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  481 bits (1239), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 229/317 (72%), Positives = 256/317 (80%), Gaps = 1/317 (0%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           M STHN+DKPWDTPDI+KW+I+EFKPEDN SGLPF+EESSFMTLFPKYRE YL+ VW DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           T++L+K+ ++C LDL+EGSMTVKTTRKTYDPAIILKARDLIKLLARSVP+PQA++ILQDD
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCMKNVHPIYHIKELMIKREL+KRP+LA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXX 299
                 VYTPFPP Q PRKVDL+IESGEYFLS                            
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300

Query: 300 XDFIAPSEKEYKSSLQK 316
            D++APSEKEY S+ ++
Sbjct: 301 KDYVAPSEKEYGSTAKR 317

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  480 bits (1235), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 231/312 (74%), Positives = 251/312 (80%), Gaps = 1/312 (0%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVSTHNRDKPWDT D++KW I+EFK EDNASG PF EESSFMTLFPKYRE YL+ +W DV
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           T++LDK++++C LDL+EGSMTVKTTRKTYDPAIILKARDLIKLLARSVP+PQA++ILQDD
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCMKNVHPIYHIKELMIKREL+KRPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXX 299
                 VYTPFPPAQLPRKVDLEIESGEYFLS                            
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA 300

Query: 300 XDFIAPSEKEYK 311
            +F+AP E+ YK
Sbjct: 301 KNFVAPQEEAYK 312

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  478 bits (1231), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 232/314 (73%), Positives = 251/314 (79%), Gaps = 1/314 (0%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVSTHNR+KPWDT DI+KW+I+EFK EDN SG PF EESSFMTLFPKYRE YL+ +W DV
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           T++LDK+++AC LDL+EGSMTVKTTRKTYDPAIILKARDLIKLLARSVP+PQA++ILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCMKN+HPIYHIKELMIKREL+KRPELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXX 299
                 VYTPFPPAQLPRKVDLEIESGEYFLS                            
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNEQKEKQMERELERQEERA 300

Query: 300 XDFIAPSEKEYKSS 313
            DF AP E+ YK S
Sbjct: 301 KDFTAPEEESYKPS 314

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  476 bits (1225), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 226/316 (71%), Positives = 256/316 (81%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVSTHN++KPWDT DI+KW++++FKPEDNASG+PF+EESSFMTLFPKYRE YL+ VW DV
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           TK+LDK+HVACTL+L++GSMTV TTRKTYDP IILKARDLIKLLARSVP+PQA++IL DD
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M+NVHPIYHIKELMIKREL+K+PELANEDWSRFLPMF             
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPP+QLPRKVDLEIESGEYFLS                             
Sbjct: 241 KREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300

Query: 301 DFIAPSEKEYKSSLQK 316
           ++IAP E++Y SS++K
Sbjct: 301 NYIAPKEEKYVSSIEK 316

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  474 bits (1219), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 226/317 (71%), Positives = 254/317 (80%), Gaps = 1/317 (0%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           M STHN+DKPWDTPDI+KW+I+EFKPEDN SG+PF EESSFMTLFPKYRE YL+ VW DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           T++LDK+++AC LDL+EGSMTVKTTR+TYDPAIILKARDLIKLLARSVP+PQA++ILQDD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXX-XXX 239
           KEVRRVVEDCM+N+HPIYHIKELMIKREL+KRP+LA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXX 299
                 VYTPFPPAQ PRK+DL+IESGEYFL+                            
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEKEAKKLEERKREQAEKQVEKNKERA 300

Query: 300 XDFIAPSEKEYKSSLQK 316
            D++AP EK Y+ S +K
Sbjct: 301 KDYVAPIEKGYEGSSKK 317

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  473 bits (1218), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 226/310 (72%), Positives = 249/310 (80%), Gaps = 1/310 (0%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVSTHN+DKPWDT +++KW I+EFKPEDN SGLPF EESSFMTLFPKYRE YL+ VW DV
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           T+SLD +H+AC L+L+EGSMTVKTTRKTYDPA+ILKARDLIKLLARSVP+PQA++IL+DD
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCMKNVHPIYHIKELMIKREL+K+PELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                +YTPFPPAQLPRKVDLEIESGEYFLS                             
Sbjct: 240 IKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299

Query: 301 DFIAPSEKEY 310
           DFIAP E +Y
Sbjct: 300 DFIAPKETDY 309

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  473 bits (1218), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 223/271 (82%), Positives = 244/271 (90%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVST+N++KPWDT DI+KW+ +EFKPEDNASGLPF EESSFMTLFPKYRE+YL+ VW DV
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           TK+L+K+H+AC LDL+EGSMTVKTTRKTYDPAIILKARDLIKLLARSVP+PQAI+IL+D+
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGN V+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM NVHPIYHIKELMIKREL+K+PELANEDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLS 271
                VYTPFPP QLPRKVDLEIESGEYFLS
Sbjct: 241 RKEKKVYTPFPPTQLPRKVDLEIESGEYFLS 271

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  473 bits (1217), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 225/315 (71%), Positives = 251/315 (79%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVSTHNRDKPWDT DI+KW+++EFKPEDNASGLPF EESSFMTLFPKYRE YL+ +W DV
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           T++L+ +H+AC LDL+EGSMTVKTTRKT+DPAIIL+ARDLIKLLARSVP+ QA++IL++D
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           +ACDVIKIGNVV NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED M+NVHPIY IKELMIKREL+KRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPAQ PRK+DLEIESGEYFLS                             
Sbjct: 241 RAEKKVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLKERREKQAEKQEEKEEARSK 300

Query: 301 DFIAPSEKEYKSSLQ 315
           D+IAP E  YKSSL+
Sbjct: 301 DYIAPKEDVYKSSLE 315

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  471 bits (1212), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 226/310 (72%), Positives = 252/310 (81%), Gaps = 1/310 (0%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVST N+DKPWDTPD++KW I+EF PED+ASGLPF EESSFMTLFPKYRETYL+ +W +V
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           T++L+K+H+AC L+L+EGSM+VKTTRKTYDPAIILKARDLIKLLARSVP PQAI+ILQDD
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
           IACDVIKIGN+V +KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGP+KGL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVEDCM+N+HPIYHIKELMIKREL+KRPELA EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPAQLPRKVDLEIE+GEYFLS                             
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKKEKEAKKLEARRAQQAEKQSEKEKERAK 299

Query: 301 DFIAPSEKEY 310
           D+IAP+E EY
Sbjct: 300 DYIAPAEPEY 309

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  464 bits (1195), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 223/313 (71%), Positives = 244/313 (77%)

Query: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60
           MVSTHN+DKPWDT +I+KW   EFK EDNASGLPF EESSFMTLFPKYRE YL+ +W DV
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120
           TK+L+KYHVAC LDL+EGSMTVKTTRKT DPAIILKARDLIKLLARSVP+PQA++IL+D+
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180
            ACDVIKIGN V NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+AMG +KGL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFXXXXXXXXXXXXX 240
           KEVRRVVED MKN+HPIYHIKELMIKREL+KRPELANEDWSRFLP F             
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARKKPMKI 240

Query: 241 XXXXXVYTPFPPAQLPRKVDLEIESGEYFLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 300
                VYTPFPPAQ PRKVDLEIESGEYFL+                             
Sbjct: 241 RKEKKVYTPFPPAQTPRKVDLEIESGEYFLNKREKEAKKLEERREKQAEKQEERQKERRK 300

Query: 301 DFIAPSEKEYKSS 313
           DF+ P E++YK S
Sbjct: 301 DFLPPKEEDYKKS 313

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 45.4 bits (106), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R T LR  W  +   L D   +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 94  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 153

Query: 104 LARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFVKRRQRLVGPNGNTLKALELLTK 161
            A       AI +L+ DD+  +  ++ +V     +   +   R+ G +G T  A+E  T+
Sbjct: 154 FALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 213

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 214 TRIVLADSKIHILGGFTHIRMAREAV 239

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R T LR  W  +   L D   +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L+ DD+  +  +I +V   N +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 216 TRIVLADSKIHILGGFTHIRMAREAV 241

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R T LR  W  +   L D   +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L+ DD+  +  +I +V   N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETI 244

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R T LR  W  +   L D   +   ++L   ++ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    AI +L+ DD+  +  +I +V   N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R T LR  W  +   L D   +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    AI +L+ DD+  +  +I +V   N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 73/168 (43%), Gaps = 5/168 (2%)

Query: 24  FKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTV 82
           F   + A G     ES  + + P +R T LR  W  +   L D   +   ++L   S+ +
Sbjct: 77  FSSANKAEGAKVKLESRKVPV-PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVEL 135

Query: 83  KTTRK-TYDPAIILKARDLIKLLARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFV 139
           +T  K T DP  + K  D IK          +I +L+ DD+  +  +I +V     +   
Sbjct: 136 RTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLS 195

Query: 140 KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           +   R+ G +G T  A+E  T+  I++    +  +G F  ++  R  V
Sbjct: 196 RAIGRIAGKDGKTKFAIENATRTRIVLADTKIHILGGFTHIRMAREAV 243

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R T LR  W  +   L D   +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 96  PPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L+ DD+  +  +I +V   + +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 216 TRIVLADTKIHILGGFTHIRMAREAV 241

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 68/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R T LR  W  +   L +   +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFVKRRQRLVGPNGNTLKALELL 159
           K  A       +I +L+ DD+  +  ++ +V     +   +   R+ G +G T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFV 247

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R T LR  W  +   L +   +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 100 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 159

Query: 104 LARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L+ DD+  +  +I +V   N +   +   R+ G +G T  A+E  T+
Sbjct: 160 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 219

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 220 TRIVLADSKIHILGGFTHIRMAREAV 245

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R T LR  W  +   L +   +   ++L   S+ +++  R+T DP  + K  D IK 
Sbjct: 97  PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRSHPRQTTDPGALQKGADFIKA 156

Query: 104 LARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L+ DD+  +  ++ +V   N +   +   R+ G +G T  A+E  T+
Sbjct: 157 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 216

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 217 TRIVLADAKIHILGGFTHIRMAREAV 242

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 75/168 (44%), Gaps = 5/168 (2%)

Query: 24  FKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTV 82
           F   + AS      ES  + + P +R T LR  W  +   L D   +   ++L   S+ +
Sbjct: 84  FSSANKASETKIKAESRKVAV-PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVEL 142

Query: 83  KTT-RKTYDPAIILKARDLIKLLARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFV 139
           +T  + T DP  + K  D IK          +I +L+ DD+  +  ++ +V   + +   
Sbjct: 143 RTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLHGDHLS 202

Query: 140 KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           +   R+ G +G T  A+E  T+  I++  + +  +G F  ++  R  V
Sbjct: 203 RAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 250

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 65/146 (44%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R T LR  W  +   L D   +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 102 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L+ DD+  +  +I +V     +   +   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 222 TRIVLADTKIHILGGFTHIRMARESV 247

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R T LR  W  +   L D   +   ++L   ++ ++T  K T DP  + K  D IK 
Sbjct: 89  PPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKA 148

Query: 104 LARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L+ DD+  +  ++ +V     +   +   R+ G +G T  A+E  T+
Sbjct: 149 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 208

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 209 TRIVLADSKIHILGGFTHIRMAREAV 234

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R T L+  W  +   L D   +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 102 PPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPYPQAIRILQ-DDIACDVIKIGNVVNNKERFVKRR-QRLVGPNGNTLKALELLTK 161
                    +I +L+ DD+  +  +I +V   +   + R   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 222 TRIVLADSKIHILGGFTHIRMARESV 247

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R T LR  W  +   L +   +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 102 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 161

Query: 102 KLLARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          +I +L+ DD+  +  ++ +V     +   +   R+ G +G T  A+E  
Sbjct: 162 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 221

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 222 TRTRIVLADSKIHILGGFTHIRMARESV 249

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R T LR  W  +   L +   +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          +I +L+ DD+  +  ++ +V     +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTTRK-TYDPAIILKARDLIKL 103
           P +R T LR  W  +   L +   +   ++L   S+ ++T  K T DP  + K  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L+ DD+  +  ++ +V     +   +   R+ G +G T  A+E  T+
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAV 249

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTTRK-TYDPAIILKARDLI 101
           + P +R T LR  W  +   L +   +   ++L   S+ ++T  K T DP  + K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          +I +L+ DD+  +  ++ +V     +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSAMGPFKGLKEVRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYRETYLREVWGDVTKSL-DKYHVACTLDLIEGSMTVKTT-RKTYDPAIILKARDLIKL 103
           P +R T LR  W  +   L D   +   ++L   S+ ++T  + T DP  + K  D IK 
Sbjct: 99  PPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPYPQAIRILQ-DDIACDVIKIGNVVN-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L+ DD+  +  ++ +V     +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSAMGPFKGLKEVRRVV 187
             I++  + +  +G F  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESI 244

>TBLA0H01830 Chr8 complement(433992..435212) [1221 bp, 406 aa] {ON}
           Anc_5.375 YDR331W
          Length = 406

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 3/64 (4%)

Query: 79  SMTVKTTRKTYDPAIILKARDLIKLLAR-SVPYPQAIRILQDDIACDVIKI--GNVVNNK 135
           ++ V T+R  ++   +  A  + +   R  VP  Q I +L DD+AC+   +  G+V NNK
Sbjct: 30  AVIVSTSRFWFNYRHMANALSMYRTFKRLGVPDSQIILMLSDDVACNSRNLFPGSVFNNK 89

Query: 136 ERFV 139
           +RF+
Sbjct: 90  DRFL 93

>AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR003W (MRPL32)
          Length = 178

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 57/145 (39%), Gaps = 31/145 (21%)

Query: 56  VWGDVTKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIR 115
           VWG+V ++L +    CT  L          R       ++  R L++LL R+    QA  
Sbjct: 6   VWGNVGRALSE----CTAALF--------PRLELGSGSVIAPRTLLELLRRAGGSQQAGT 53

Query: 116 ILQDDIACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMG 175
                +  D + +  V   K    KRRQ+L GP    L+ +  L KC          + G
Sbjct: 54  A---AVGADGLVLA-VPKKKVSHQKRRQKLYGPGKKQLQMVHHLGKC---------PSCG 100

Query: 176 PFKGLKEVRRVVEDCMKNVHPIYHI 200
            +K L  +      CM  V  I HI
Sbjct: 101 HYKRLNTL------CMYCVGEIRHI 119

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query: 145 LVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNVHPIY 198
           L+GP GNTL+ L+  +KC I ++G      G  K  K    + E  M    P++
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRG-----RGSVKEGKHANDLPEGAMNMEDPLH 199

>AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR116W
           (MSL5)
          Length = 507

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I+++G
Sbjct: 169 LLGPRGNTLKQLQQQSGCKIVIRG 192

>ZYRO0D06974g Chr4 complement(598154..603664) [5511 bp, 1836 aa]
           {ON} highly similar to uniprot|Q04952 Saccharomyces
           cerevisiae YMR306W FKS3 Protein of unknown function has
           similarity to 1,3-beta-D-glucan synthase catalytic
           subunits Fks1p and Gsc2p
          Length = 1836

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%), Gaps = 1/63 (1%)

Query: 101 IKLLARSVPYPQAIRILQDDIACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLT 160
           IKLL R V  P  I++  D++      + N+ N K R +   QR    N +  +A ELL 
Sbjct: 918 IKLLYR-VENPSMIQLYGDNVDALENALANMANRKFRMLVAMQRYTKFNKDEREATELLL 976

Query: 161 KCY 163
           K Y
Sbjct: 977 KAY 979

>KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.309
           YLR116W
          Length = 497

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I ++G
Sbjct: 148 LLGPRGNTLKQLQKQSNCKIAIRG 171

>ZYRO0E04356g Chr5 complement(332059..332619) [561 bp, 186 aa] {ON}
           similar to uniprot|P25348 Saccharomyces cerevisiae
           YCR003W MRPL32 Mitochondrial ribosomal protein of the
           large subunit
          Length = 186

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 47/104 (45%), Gaps = 12/104 (11%)

Query: 116 ILQDDIACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMG 175
           I+++D   +  ++  V   K    K+RQRL  P    LK +  L KC          + G
Sbjct: 57  IVEEDFFSNNGRLLAVPKKKVTHQKKRQRLYAPGKKQLKFIHELNKC---------PSCG 107

Query: 176 PFKGLKEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANED 219
            +   K    +   C+++V  I+  + +  ++E S+  EL++ D
Sbjct: 108 HY---KRANCLCMHCVQHVRHIWKTQTVKERQEPSQEQELSDLD 148

>KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} similar
           to uniprot|Q12096 Saccharomyces cerevisiae YOR320C GNT1
           N-acetylglucosaminyltransferase capable of modification
           of N-linked glycans in the Golgi apparatus
          Length = 486

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 40/99 (40%), Gaps = 20/99 (20%)

Query: 137 RFV-KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGLKEVRRVVEDCMKNVH 195
           RF+ KRR RLVG  G  +  + L  KC +  Q N        + ++  R        N+H
Sbjct: 2   RFLFKRRLRLVGAIGAVVLLISLTAKCVVQFQLN--------REIEHYRTFFRKHKDNIH 53

Query: 196 PIYH-----------IKELMIKRELSKRPELANEDWSRF 223
            IY            I+ L   R+    P+ +  DW ++
Sbjct: 54  DIYDPLNIKQIPYETIESLYQLRKTGDVPKKSPIDWGKY 92

>Smik_4.591 Chr4 (1056001..1057236) [1236 bp, 411 aa] {ON} YDR331W
           (REAL)
          Length = 411

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 65  DKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLAR-SVPYPQAIRILQDDIAC 123
           D  H A   +    ++ V T+R  ++   +     + + + R  +P  Q I +L DD+AC
Sbjct: 26  DAAHEAIATNTNNWAVLVSTSRFWFNYRHMANVLSMYRTVKRLGIPDSQIILMLSDDVAC 85

Query: 124 DVIKI--GNVVNNKERFV 139
           +   +  G+V NNK+  +
Sbjct: 86  NSRNLFPGSVFNNKDHAI 103

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,602,869
Number of extensions: 1131505
Number of successful extensions: 2840
Number of sequences better than 10.0: 51
Number of HSP's gapped: 2853
Number of HSP's successfully gapped: 51
Length of query: 316
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 207
Effective length of database: 40,982,805
Effective search space: 8483440635
Effective search space used: 8483440635
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)