Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A049201.3ON36036017100.0
NCAS0B091301.3ON36734111341e-155
NDAI0A001201.3ON37737411111e-151
KAFR0D001101.3ON36534111061e-150
YCL064C (CHA1)1.3ON36033110871e-148
KNAG0C001801.3ON35934610831e-147
Suva_3.1501.3ON36133510771e-146
Smik_3.121.3ON36035810701e-145
Skud_3.11.3ON36035810691e-145
Kpol_2002.61.3ON35034910481e-142
TPHA0E040401.3ON35733510351e-140
CAGL0B00286g1.3ON3603329681e-130
KAFR0F04430singletonON3433429611e-129
KAFR0I00130singletonON3443419511e-127
SAKL0C00418g1.3ON3643669271e-123
ZYRO0F15774gsingletonON4103569261e-123
NCAS0A15330singletonON3473349181e-122
NDAI0K02950singletonON3343299051e-120
KNAG0D05380singletonON3343378241e-108
KLTH0F00440g1.3ON3413388161e-107
ZYRO0F18524g1.3ON3353318151e-107
KLLA0C00440g1.3ON3773407951e-103
Ecym_10061.3ON3643447577e-98
AFR747W1.3ON4263617611e-97
SAKL0C13904gsingletonON3393257497e-97
Smik_9.2na 1ON3383277426e-96
Skud_9.2na 1ON3393267357e-95
Scer_YGOB_SDL1 (SDL1)na 1ON3373277357e-95
TDEL0D06540singletonON3373316904e-88
KLLA0E01805gsingletonON3223246886e-88
KNAG0A01150singletonON2312235684e-71
YIL167W (SDL1)singletonOFF2101924803e-58
YIL168WsingletonOFF1271222677e-28
SAKL0F11858g7.367ON5622691649e-12
KLLA0E19779g7.367ON5672671514e-10
NCAS0A142307.367ON5692651497e-10
ACR232C7.367ON5602611425e-09
Ecym_47087.367ON5702891363e-08
KAFR0K017007.367ON5792461354e-08
YER086W (ILV1)7.367ON5762681354e-08
Smik_5.2257.367ON5762681345e-08
Suva_5.1997.367ON5762691346e-08
CAGL0I05126g7.367ON5712651338e-08
Kpol_530.167.367ON5662691302e-07
Skud_5.2057.367ON5762691292e-07
TDEL0C018007.367ON5692681283e-07
NDAI0A018107.367ON5702691265e-07
KNAG0C036907.367ON5772651257e-07
TPHA0F031307.367ON5682661194e-06
TBLA0C050707.367ON5752911132e-05
ZYRO0B02772g7.367ON5692691132e-05
SAKL0A10626gsingletonON3202461023e-04
KLTH0B04884g7.367ON573266980.001
Kwal_33.148227.367ON562269970.002
TBLA0F023307.333ON54663750.90
SAKL0D12210g1.493ON649117703.7
TBLA0A073901.14ON40364693.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A04920
         (360 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   663   0.0  
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    441   e-155
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   432   e-151
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   430   e-150
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   423   e-148
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   421   e-147
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   419   e-146
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   416   e-145
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   416   e-145
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   408   e-142
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   403   e-140
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   377   e-130
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              374   e-129
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   370   e-127
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   361   e-123
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   361   e-123
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            358   e-122
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             353   e-120
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   322   e-108
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   318   e-107
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   318   e-107
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   310   e-103
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   296   7e-98
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   297   1e-97
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   293   7e-97
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      290   6e-96
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      287   7e-95
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   287   7e-95
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            270   4e-88
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   269   6e-88
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   223   4e-71
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   189   3e-58
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...   107   7e-28
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    68   9e-12
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    63   4e-10
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    62   7e-10
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    59   5e-09
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    57   3e-08
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    57   4e-08
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    57   4e-08
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    56   5e-08
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    56   6e-08
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    56   8e-08
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    55   2e-07
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    54   2e-07
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    54   3e-07
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    53   5e-07
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    53   7e-07
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    50   4e-06
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    48   2e-05
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    48   2e-05
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    44   3e-04
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    42   0.001
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    42   0.002
TBLA0F02330 Chr6 complement(576335..577975) [1641 bp, 546 aa] {O...    33   0.90 
SAKL0D12210g Chr4 complement(1009364..1011313) [1950 bp, 649 aa]...    32   3.7  
TBLA0A07390 Chr1 complement(1832812..1834023) [1212 bp, 403 aa] ...    31   3.9  

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/360 (91%), Positives = 328/360 (91%)

Query: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60
           MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR
Sbjct: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60

Query: 61  PQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120
           PQVF                   IPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD
Sbjct: 61  PQVFSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120

Query: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180
           DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS
Sbjct: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180

Query: 181 IXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240
           I             EKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT
Sbjct: 181 IGGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240

Query: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300
           STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN
Sbjct: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300

Query: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYKLDYSLPQTPEYIFTENHTPILSPVL 360
           ALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYKLDYSLPQTPEYIFTENHTPILSPVL
Sbjct: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYKLDYSLPQTPEYIFTENHTPILSPVL 360

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  441 bits (1134), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 214/341 (62%), Positives = 257/341 (75%), Gaps = 7/341 (2%)

Query: 1   MSIVYNKTPLLRQFFRG------SPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINS 54
           MSIVYNKTPLLRQFF        + IPQFFLKYEC+QPSGSFKSRGIGNLI+K+  +I  
Sbjct: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60

Query: 55  SNLNKRPQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGG 114
           S  NK PQVF                   +PCTVVVPTATK+RMV KI+ TGA VI+NG 
Sbjct: 61  SG-NKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGA 119

Query: 115 HWSEADDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNV 174
           HW EAD YL++ V+N IDLN  EPIYVHPFDNP IWEGHSTM+DEI+++LNEQNI +  +
Sbjct: 120 HWKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKI 179

Query: 175 KAITCSIXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTI 234
           K I CS+             EK+ LA KIPI+GVET GC VFNTSLKL K ++F KI +I
Sbjct: 180 KGIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSI 239

Query: 235 ATSLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYN 294
           ATSLGT++IS++TFE A KY+T+SVVV++ DVI+TCL+YT DFN VAEPACGA+LHLAYN
Sbjct: 240 ATSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYN 299

Query: 295 TGLIENALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYK 335
           T ++ENAL   L+ DDII+VIACGGSSNTVQ+LEE L++ +
Sbjct: 300 TNILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLR 340

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  432 bits (1111), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 220/374 (58%), Positives = 260/374 (69%), Gaps = 20/374 (5%)

Query: 1   MSIVYNKTPLLRQFFRGS-----------PIPQFFLKYECMQPSGSFKSRGIGNLILKSI 49
           MS+VYNKTPLLRQFF+ S             PQFF+KYEC+QPSGSFKSRGIGNLILKS 
Sbjct: 1   MSVVYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSA 60

Query: 50  DKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKV 109
             IN     K PQVF                   +PCTVVVPTATK+RMV KIK TGA V
Sbjct: 61  MNINKIG-QKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANV 119

Query: 110 IVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNI 169
           I+NG HW EAD +L+N ++NKID N IEPIYVHPFDNPLIWEGH+TM+DEI++SLN+QNI
Sbjct: 120 IINGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNI 179

Query: 170 DIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFP 229
            I  VK I CS+             +KYNLA KIPI+GVET GC VFNTSLKL K ++F 
Sbjct: 180 PINKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFS 239

Query: 230 KINTIATSLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAAL 289
           KI +IATSLGT+ IS KTFE A KY T+SVV+++ +VI+TCL+YT D+N V EPACGA++
Sbjct: 240 KITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASI 299

Query: 290 HLAYNTGLIENALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYK------LDYSLPQT 343
           HLAY+T ++E +L   L  DDII+VIACGGSSNT  +LE  LL  K      LD S    
Sbjct: 300 HLAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSSSTI 359

Query: 344 PEYIFTEN--HTPI 355
           P +I TEN  H PI
Sbjct: 360 PNFIDTENTQHFPI 373

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  430 bits (1106), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 204/341 (59%), Positives = 254/341 (74%), Gaps = 7/341 (2%)

Query: 1   MSIVYNKTPLLRQFFRGS------PIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINS 54
           MS+VYNKTPLLRQFF G+       +PQFFLKYEC+QPSGSFKSRGIGNLILK   +I+ 
Sbjct: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60

Query: 55  SNLNKRPQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGG 114
               KRP+VF                   +PCTVVVPTATK+RM+ KIKDTGA VI++G 
Sbjct: 61  KG-TKRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGA 119

Query: 115 HWSEADDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNV 174
            W EAD YL+  V+NKI+ NEI+PIYVHPFDNPLIWEGHS+++DEI+++L EQ +   N+
Sbjct: 120 FWKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNI 179

Query: 175 KAITCSIXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTI 234
           K I CS+             E++ L  KIP++GVET GC VFNTSLKL K V+F KI +I
Sbjct: 180 KGIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKITSI 239

Query: 235 ATSLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYN 294
           ATSL T++ISAKTFENALKY T+SV+V + DVI+TCL+YT D+N V EPACGA++HLAYN
Sbjct: 240 ATSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYN 299

Query: 295 TGLIENALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYK 335
             ++ENAL T LTKDD ++VIACGGSSNT+Q++EE LL+ +
Sbjct: 300 IDILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLR 340

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  423 bits (1087), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 202/331 (61%), Positives = 248/331 (74%), Gaps = 1/331 (0%)

Query: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60
           MSIVYNKTPLLRQFF G    QFFLKYEC+QPSGSFKSRGIGNLI+KS  +I      + 
Sbjct: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDG-KRS 59

Query: 61  PQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120
           PQVF                   +PCTVVVPTATK+RMV+KI++TGA+VIV+G +W EAD
Sbjct: 60  PQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEAD 119

Query: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180
            +L+ +V+NKID   IEPIYVHPFDNP IWEGHS+MIDEI++ L  Q+I +  VK I CS
Sbjct: 120 TFLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCS 179

Query: 181 IXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240
           +             E+Y LA +IPI+GVETNGC VFNTSLK+ + V+F KI +IATSLGT
Sbjct: 180 VGGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGT 239

Query: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300
           + IS +TFE A KYNT+SVV+++ DVI+TCL+YT+ FN V EPACGAALHL YNT ++EN
Sbjct: 240 AVISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILEN 299

Query: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEAL 331
           AL + L  DDI+I+IACGGSSNT+++LEEAL
Sbjct: 300 ALGSKLAADDIVIIIACGGSSNTIKDLEEAL 330

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  421 bits (1083), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 206/346 (59%), Positives = 250/346 (72%), Gaps = 2/346 (0%)

Query: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60
           MS+VYNKTPLLRQFF G  +PQ FLKYEC+QPSGSFKSRGIGNLILK+  +I      +R
Sbjct: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIG-ERR 59

Query: 61  PQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120
             VF                   +PCTVVVPTATK RMV KI++TGAKVIVNG HW EAD
Sbjct: 60  AHVFASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEAD 119

Query: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180
            +L+  V+++IDL   EPIYVHPFDNP IWEGH+T++DEI+E+LN Q I   NVK I CS
Sbjct: 120 QHLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCS 179

Query: 181 IXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240
           +             EK+ LA KIPI+GVET GC V NTSL L K ++F KI +IATSLGT
Sbjct: 180 VGGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGT 239

Query: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300
           ++IS +TFE A KYNT+SVVVD+  VI+TCL+YT DFN VAEPACGAALHLAYN  ++E 
Sbjct: 240 ASISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEK 299

Query: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYKLDYSLPQTPEY 346
           AL  +LT +D+I+VIACGGSSNT+++LE+ L+      S+P  PEY
Sbjct: 300 ALGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLN-SKSIPSPPEY 344

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  419 bits (1077), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 201/335 (60%), Positives = 245/335 (73%), Gaps = 1/335 (0%)

Query: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60
           MSIVYNKTPLLRQFF G  + QF+LKYEC+QPSGSFKSRGIGNLILK+  +I   N  + 
Sbjct: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQK-NGKRS 59

Query: 61  PQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120
           PQVF                   +PCTVVVPTATKERMV KI++TGA+VIVNG  W EAD
Sbjct: 60  PQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEAD 119

Query: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180
            YL+ +V+N ID   +EPIYVHPFDNP IWEGHS+M+DEI++ L  Q + +  VK I CS
Sbjct: 120 TYLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCS 179

Query: 181 IXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240
           +             E++ LA KIPI+GVET GC VFNTSL++ + V+F KI +IATSLGT
Sbjct: 180 VGGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGT 239

Query: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300
           + IS +TFE A KYNTKSVVV++ DVI+TCL+Y++ FN V EPACGAALHL Y+T ++E 
Sbjct: 240 ANISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILET 299

Query: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYK 335
           ALDT L  DDI+++IACGGSSNTVQ+LEE L   K
Sbjct: 300 ALDTKLAADDIVLIIACGGSSNTVQDLEETLASMK 334

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  416 bits (1070), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 203/358 (56%), Positives = 253/358 (70%), Gaps = 3/358 (0%)

Query: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60
           MSIVYNKTPLLRQFF G    QFFLKYEC+QPSGSFKSRGIGNLI+KS  +I      K 
Sbjct: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDG-KKS 59

Query: 61  PQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120
           PQ+F                   +PCTVVVPTATK+RMV KI++TGA+VIV+G +W EAD
Sbjct: 60  PQIFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEAD 119

Query: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180
            +L+  V+ KID   +EPIYVHPFDNP IWEGHS+M+DE+++ L  Q I +  VK I CS
Sbjct: 120 TFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCS 179

Query: 181 IXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240
           +             E+Y LA KIPI+GVETNGC VFNTSL++ + V+F KI +IATSLGT
Sbjct: 180 VGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGT 239

Query: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300
           + IS +TF+ A KYNT+SVV+++ DVI TCL+YT+ FN V EPACGAALHL YNT ++E 
Sbjct: 240 AVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILER 299

Query: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEALLKY--KLDYSLPQTPEYIFTENHTPIL 356
           AL + L  DDI+I+IACGGSSNT+Q+LEEAL  +  +   ++  T  +IF E  T  L
Sbjct: 300 ALGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPAIEVTDNFIFPEKTTATL 357

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  416 bits (1069), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 205/358 (57%), Positives = 256/358 (71%), Gaps = 3/358 (0%)

Query: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60
           MSIVYNKTPLLRQFF      QFFLKYEC+QPSGSFKSRGIGNLILK+  +I      + 
Sbjct: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDG-RRS 59

Query: 61  PQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120
           PQVF                   +PCTVVVPTATK+RMV KI++TGA+VIVNG +W EAD
Sbjct: 60  PQVFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEAD 119

Query: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180
            +L+ +++N+ID   +EPIYVHPFDNP IWEGHS+M+DEI++ L  Q I +  VK I CS
Sbjct: 120 TFLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCS 179

Query: 181 IXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240
           +             E+Y+LA KIPI+GVETNGC VFNTSL++ + V+F KI +IATSLGT
Sbjct: 180 VGGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGT 239

Query: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300
           + IS +TFE A KYNTKSVV+++ DVI+TCL+YT+  N VAEPACGAALHL Y+T ++E 
Sbjct: 240 AVISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEK 299

Query: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEAL--LKYKLDYSLPQTPEYIFTENHTPIL 356
           AL + L  DDI+I+IACGGSSNTVQ+LEE L  LK +   ++     +IF E  + IL
Sbjct: 300 ALGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFIFVEKTSTIL 357

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  408 bits (1048), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 204/349 (58%), Positives = 260/349 (74%), Gaps = 3/349 (0%)

Query: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60
           MS+VYNKTPLL+ FF G  +PQF+LKYE +QPSGSFKSRGIGNLILK+  +I   N+ K+
Sbjct: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINV-KK 59

Query: 61  PQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120
           P VF                   +PCTVVVPTATKERMV KI+ TGA VI+ G HW EAD
Sbjct: 60  PYVFSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEAD 119

Query: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180
           ++L+ +++N+I+ ++IEPIYVHPFDNPLIWEGHSTM+DEI+E+ ++Q  +I+N+KAI CS
Sbjct: 120 NFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCS 179

Query: 181 IXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240
           +             EKYNLA KIP++GVET GC VFNTSLKL K V+F KI+TIATSLGT
Sbjct: 180 VGGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGT 239

Query: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300
           + IS + F+ A KYNTKSVVV++ DV++TCL++T+D N V EPACGAA+HL Y+T L+E 
Sbjct: 240 ANISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLGYHTDLLET 299

Query: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYKL--DYSLPQTPEYI 347
           AL T LT DD ++++ACGGSSNTV+ELE ALL+  L    + P  P +I
Sbjct: 300 ALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSFI 348

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  403 bits (1035), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 198/335 (59%), Positives = 240/335 (71%), Gaps = 1/335 (0%)

Query: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60
           MS VYNKTPLLR  F G  +PQ FLKYEC QPSGSFKSRGIGNLI  +  +I   N  K 
Sbjct: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQK-NSKKS 59

Query: 61  PQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120
           P+VF                   +PCTVVVPTATK RMV KIK TGA VIV G HW EAD
Sbjct: 60  PEVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEAD 119

Query: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180
            YL+ +V++ ID   IEPIYVHPFDN  IWEGH+TMIDEI+E+  +Q+I I  VKAI CS
Sbjct: 120 TYLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCS 179

Query: 181 IXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240
           +             EK++LA+KIP++GVET GC VFNTSLK+ K+++F KINTIATSLGT
Sbjct: 180 VGGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGT 239

Query: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300
           + IS +TFE A KYNTKS+VVD++ V++TCL++T D N VAEPACGAALH+ YN  ++E 
Sbjct: 240 ANISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEK 299

Query: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYK 335
           +L   L  DDI+++IACGGSSNTVQELE +L + K
Sbjct: 300 SLGKKLATDDIVLIIACGGSSNTVQELEASLTELK 334

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  377 bits (968), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 181/332 (54%), Positives = 236/332 (71%), Gaps = 4/332 (1%)

Query: 4   VYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQV 63
           VYNKTPL+RQ F    IPQ +LK+EC QPSGSFKSRGIG+LI K   +I  + L K+P V
Sbjct: 3   VYNKTPLIRQIF--PSIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60

Query: 64  FXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYL 123
           F                   +PCTVV+PTATK+RM +KI+ TGA VIV+G  W EAD+YL
Sbjct: 61  FASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120

Query: 124 QNHVINKID--LNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSI 181
           ++++++K++     +EPIYVHPFDNP IWEGH++M+DEI+E    + I +  +KAI CS+
Sbjct: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180

Query: 182 XXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTS 241
                        EKYNLA KIPI+GVET GC VFNTSL++ K+V F KI +IATSLGT+
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240

Query: 242 TISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIENA 301
            IS + F+ A +Y TKSVV+ + DV+KTCLRYT+DFN V EPACGAA+HLAY+T ++E  
Sbjct: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300

Query: 302 LDTTLTKDDIIIVIACGGSSNTVQELEEALLK 333
           L T L  DDI++V+ACGGSSNTV+++E  L +
Sbjct: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQR 332

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  374 bits (961), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 184/342 (53%), Positives = 242/342 (70%), Gaps = 7/342 (2%)

Query: 1   MSIVYNKTPLLRQFF----RGSP--IPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINS 54
           M  VYNKTPLLR +F    RG+    PQ F KYE  QP  SFKSRGIGNLILK+  K+  
Sbjct: 1   MPTVYNKTPLLRPYFLEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNAKKVEE 60

Query: 55  SNLNKRPQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGG 114
             + K  +VF                   IPCTVVVP++TK RMV KI+ TGA+VIV+G 
Sbjct: 61  EGI-KTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGN 119

Query: 115 HWSEADDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNV 174
            W EAD+YL+N VINK+D +++EP+YVHPFD+PLIWEGHST+IDEI+ESLN++N+    V
Sbjct: 120 FWKEADEYLRNSVINKVDSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVHTSKV 179

Query: 175 KAITCSIXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTI 234
           K + CSI             E++ LA KIP+I VET GC VFNT L+L K V+F KI++I
Sbjct: 180 KGVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEKISSI 239

Query: 235 ATSLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYN 294
           ATSLG+ +IS KTFE A KY++K VV+ +IDV++TCLRY+ D N + EPAC A++HLAYN
Sbjct: 240 ATSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVHLAYN 299

Query: 295 TGLIENALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYKL 336
             ++E AL+  L+KDD+II+IACGGS+ T+Q+++++L K K+
Sbjct: 300 VDILEEALNKKLSKDDVIIIIACGGSATTLQDIKDSLAKLKI 341

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  370 bits (951), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 178/341 (52%), Positives = 237/341 (69%), Gaps = 7/341 (2%)

Query: 1   MSIVYNKTPLLRQFFRGSPI------PQFFLKYECMQPSGSFKSRGIGNLILKSIDKINS 54
           M IVYNKTPL+ Q F G+ I      PQ  +KYE +QPSGSFKSRGIGNL+ +   +I  
Sbjct: 1   MPIVYNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQK 60

Query: 55  SNLNKRPQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGG 114
            N  K P+VF                   +PCTVVVP ATK+RM+ KI+ TGAKV ++G 
Sbjct: 61  -NSTKNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGT 119

Query: 115 HWSEADDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNV 174
            W  AD Y++N V+N+I+  ++EPIYVHP D+PLIWEG+S ++DE++ESL EQ ID   V
Sbjct: 120 FWKGADKYMKNSVLNEINTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKV 179

Query: 175 KAITCSIXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTI 234
           KAI CS+             E+Y LA KIPI+GVET+G  VFNT LK  K ++F KI+T+
Sbjct: 180 KAIVCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKISTV 239

Query: 235 ATSLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYN 294
           ATSLG+++I+ KTFE A+KY  + V+V +I+V++TCLRYT D+N + EPACGAA+HLAY+
Sbjct: 240 ATSLGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHLAYH 299

Query: 295 TGLIENALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYK 335
             ++E ALDT L  DD++I+IACGGSSN++ ++EE L K K
Sbjct: 300 VDILEKALDTRLDGDDVVIIIACGGSSNSLHDMEETLKKMK 340

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  361 bits (927), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 190/366 (51%), Positives = 235/366 (64%), Gaps = 13/366 (3%)

Query: 1   MSIVYNKTPLLRQFFRGSPI---PQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNL 57
           M+  Y+KTPLLR+ F  S +   PQF +KYE  QPSGSFKSRGIG+LI +S  +I S   
Sbjct: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEG- 59

Query: 58  NKRPQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWS 117
           NK   VF                   +PCTVVVPT T  RMV KI+ TGA VIV+G HW 
Sbjct: 60  NKTAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWG 119

Query: 118 EADDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAI 177
           +AD YL   V+  ID  + EP+Y HPFDNP+IWEGHST++DEI+ESL  Q I    VK I
Sbjct: 120 DADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGI 179

Query: 178 TCSIXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATS 237
            CSI             EK++LA+ IPIIGVET GC+VF+ SLK  K + F KI ++ATS
Sbjct: 180 VCSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATS 239

Query: 238 LGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGL 297
           LGT+TI  KT ENALKYNTKSVV+ + DV++TCL +  D N V EPACGA+LH  YN  L
Sbjct: 240 LGTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHL 299

Query: 298 IENALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYKLDYSLPQTPEYIFTENHTPI-- 355
           +E+ L  +L  +DIIIVIACGGSS TVQ+L++     ++    P TP   FT   TP+  
Sbjct: 300 LEDTLGGSLGPEDIIIVIACGGSSTTVQDLQQ----MQVRLGRPLTPS--FTYETTPVDR 353

Query: 356 -LSPVL 360
            L PV+
Sbjct: 354 KLEPVV 359

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  361 bits (926), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 176/356 (49%), Positives = 234/356 (65%), Gaps = 7/356 (1%)

Query: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60
           M  +YNKTPLL+Q F  +   Q F+KYEC+QPSGSFKSRGIG+LI K    I      K 
Sbjct: 47  MPSIYNKTPLLKQIFNHATSAQVFVKYECLQPSGSFKSRGIGHLISKRAKDIQGDG-RKS 105

Query: 61  PQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120
           P VF                   +PCTVV+PT TK+RM +KI+  GA V+V G HW EAD
Sbjct: 106 PHVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVVVQGSHWKEAD 165

Query: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180
            +L+N + N++++  +EPIYVHPFDNP IWEGH++++DEII SL  +N  +  VK I CS
Sbjct: 166 SHLKNILQNQVNMAILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENTALNRVKGIVCS 225

Query: 181 IXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240
           +             EKYNLA+KIP++ VET GC V NTSL++ + V+F K+N++ATSL T
Sbjct: 226 VGGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNKMNSVATSLCT 285

Query: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300
           S IS++T +   KY +KS+V+++ +V++TCL+Y  +FN + EPACGA+LHL Y+  LIE 
Sbjct: 286 SQISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLHLGYHPQLIER 345

Query: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYKLDYSLPQTPEYIFTENHTPIL 356
           AL   L KDD+IIVIACGGSSNT+ +LEE+L K      L + P      N TP L
Sbjct: 346 ALGKNLDKDDVIIVIACGGSSNTILDLEESLAK------LEEAPHLSIRRNATPSL 395

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  358 bits (918), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 171/334 (51%), Positives = 226/334 (67%), Gaps = 6/334 (1%)

Query: 1   MSIVYNKTPLLRQFF----RGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSN 56
           MS+VYNKTPLLR+ F    +    PQ ++KYE +QPSGSFKSRGIG+LI+K+  ++    
Sbjct: 1   MSLVYNKTPLLRRVFPTGLKVPSAPQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQLG 60

Query: 57  LNKRPQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHW 116
             K   VF                   +PCTVVVPT+TK RMV KI++ G +VIV G HW
Sbjct: 61  -GKSLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSHW 119

Query: 117 SEADDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKA 176
            EAD +L+N VI  +D  E EPIYVHPFD+P +WEGHSTM+DEI+++   QN+ +  VKA
Sbjct: 120 KEADSFLKNSVIPSVDRIE-EPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLNKVKA 178

Query: 177 ITCSIXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIAT 236
           I CS+             EKY+LA KIP+I +ET+GC  FN  LK KK V+ PKI ++AT
Sbjct: 179 IVCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPKITSVAT 238

Query: 237 SLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTG 296
           SLG + ++ K FEN  +Y + SVV+ +IDV+ TCL+Y  DFN + EPACGA+LH+AYNT 
Sbjct: 239 SLGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMAYNTK 298

Query: 297 LIENALDTTLTKDDIIIVIACGGSSNTVQELEEA 330
           LIE AL   L  DDII++IACGGS+NT+++L+ +
Sbjct: 299 LIEKALGKKLDSDDIIVIIACGGSANTMEDLQNS 332

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  353 bits (905), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 170/329 (51%), Positives = 227/329 (68%), Gaps = 3/329 (0%)

Query: 1   MSIVYNKTPLLRQFFRGSPI-PQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNK 59
           MS +YNKTPLLRQ F  + I P+ FLKYE +QPSGSFKSRGIG LIL+ I+K+     NK
Sbjct: 1   MSFIYNKTPLLRQTFDSAKIGPRIFLKYENLQPSGSFKSRGIGCLILQHINKLKQDG-NK 59

Query: 60  RPQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEA 119
              VF                   +PCTVVVP +TKERMVNKI+ TGA V++ G HW EA
Sbjct: 60  TAHVFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDHWKEA 119

Query: 120 DDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITC 179
           DD+L+   + ++D  + +PIYVHPFD+P+IWEGHST+IDEI+++L  + I I  VK I C
Sbjct: 120 DDFLRKS-MKEMDNTQEQPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIEKVKGIIC 178

Query: 180 SIXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLG 239
           S+             E++NLA  IP+I VET GC V N SLK    V+ PKI ++ATSLG
Sbjct: 179 SVGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPKITSVATSLG 238

Query: 240 TSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIE 299
           ++ IS+  FENA+KYN++S+ +++ DV++TCL+Y  DF+   EPACGA++HLAYN G++E
Sbjct: 239 STYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLAYNPGIVE 298

Query: 300 NALDTTLTKDDIIIVIACGGSSNTVQELE 328
           +AL T L+  DI+IV+ CGGSS T+ +LE
Sbjct: 299 SALGTALSNHDIVIVVLCGGSSCTLHDLE 327

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  322 bits (824), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 165/337 (48%), Positives = 213/337 (63%), Gaps = 5/337 (1%)

Query: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60
           M  +YNKTPLL +   G   P F  KYE MQP GSFK RG+ +LI K +++I S    K 
Sbjct: 1   MPALYNKTPLLPKNLSGGDGPTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIKSEG-KKP 59

Query: 61  PQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120
           P VF                   IPCTVVVPT TK RMV KI+   A+VIV G +W EAD
Sbjct: 60  PHVFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSNWKEAD 119

Query: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180
           DYL+  VI     N ++PIYV+PFD+PL+WEGHSTMIDEI+ +LN++NI +  VK I CS
Sbjct: 120 DYLRGTVI--ASNNAVQPIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLDAVKGIVCS 177

Query: 181 IXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240
           +             E + LA  IP++ VET GC V   SL  +K V+  KI++IATSLG+
Sbjct: 178 VGGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKIDSIATSLGS 237

Query: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300
           S +S + F+NA+K+ ++SVV+ + DV+ TC RY  DFN + EPACGA +H AY+  ++E 
Sbjct: 238 SYVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTAYHYKILEK 297

Query: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYKLD 337
           AL   LT  DIII+I CGGS  T+Q+LE A  K KLD
Sbjct: 298 ALGQKLTPSDIIIIIVCGGSCVTIQDLENA--KRKLD 332

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  318 bits (816), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 162/338 (47%), Positives = 216/338 (63%), Gaps = 6/338 (1%)

Query: 1   MSIVYNKTPLLRQFFRGSP-----IPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSS 55
           M   + KTPLL  +F  S       PQF LK E +QPSGSFKSRGIG +I K   KI S 
Sbjct: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60

Query: 56  NLNKRPQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGH 115
             NK P VF                   IPC+VVVP +T  RMV KI + GA+V V G +
Sbjct: 61  G-NKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRN 119

Query: 116 WSEADDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVK 175
           W EAD +L+  +I+  + +  + IY HPFD+PLIWEGHS+++DEII+SL EQ ID++N+K
Sbjct: 120 WKEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIK 179

Query: 176 AITCSIXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIA 235
           AI CS+              ++ L  KIPIIGVE+ GC+VFN+SLKL KL +F  I +IA
Sbjct: 180 AIVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIA 239

Query: 236 TSLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNT 295
           TS+GT++IS KT ENAL+Y+TKSVV+ + ++I TCLR+  + N + EPACGAALHL Y  
Sbjct: 240 TSIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYP 299

Query: 296 GLIENALDTTLTKDDIIIVIACGGSSNTVQELEEALLK 333
            ++  AL++  T +D+II+I CGGS+ +  +L     K
Sbjct: 300 DILYQALNSDFTPEDVIIMIGCGGSATSYNDLASLFSK 337

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  318 bits (815), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 160/331 (48%), Positives = 212/331 (64%), Gaps = 10/331 (3%)

Query: 1   MSIVYNKTPLLRQFFRG---SPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNL 57
           M+  Y KTPLLRQ       + +PQ F+KYE +QP GSFKSRGIGNLI      + S N 
Sbjct: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLI-----SLKSENG 55

Query: 58  NKRPQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWS 117
             +  V                    +PCTVVVPT+TK+RMV KIK++GA+VI+ G HW 
Sbjct: 56  LVKSHVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWK 115

Query: 118 EADDYLQNHVINKI-DLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKA 176
           EAD+YLQ + I    +    +P+YVHPFD+P +WEGHSTM+ EII++L EQNI + NV+ 
Sbjct: 116 EADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRG 175

Query: 177 ITCSIXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIAT 236
           I CS+             E + LA KIP+I VET GC V N SL   + V   KI ++AT
Sbjct: 176 IVCSVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLAT 235

Query: 237 SLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTG 296
           SLG++ I    FENA++Y  KS+V+++ DVI+TCLRY  DF Q+ EPACGA+LH+ Y+  
Sbjct: 236 SLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPE 295

Query: 297 LIENALDTTLTKDDIIIVIACGGSSNTVQEL 327
           L+EN L    +KDDII++IACGGS+ T ++L
Sbjct: 296 LLENFLG-GFSKDDIIVIIACGGSTTTFKDL 325

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  310 bits (795), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 149/340 (43%), Positives = 213/340 (62%)

Query: 4   VYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQV 63
           +++KTPLL+  F+ S  PQ  LKYE +QPSGSFKSRGIG+LI   +++I  S+  K   V
Sbjct: 24  LFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHV 83

Query: 64  FXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYL 123
           F                   +PCTVVV  AT+ R++ KI+  GA V+V+G HW EAD ++
Sbjct: 84  FASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFM 143

Query: 124 QNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXX 183
           + H++ K+D  + EPIY HPFDNPLIWEGHS M+DEI++ L    I I  +K I CS   
Sbjct: 144 KEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFGG 203

Query: 184 XXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTI 243
                      ++YNLA KIPI+ VET G  V + SL++   V+F KI++ ATSLGT+TI
Sbjct: 204 GGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATI 263

Query: 244 SAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIENALD 303
           S   ++N  ++ +KS V+ + +VI TCL+++ D N VAEP CGA L+  YN   ++N L 
Sbjct: 264 STTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNILG 323

Query: 304 TTLTKDDIIIVIACGGSSNTVQELEEALLKYKLDYSLPQT 343
           + +  DD +I+I CGGSS ++++L+E       ++ LP T
Sbjct: 324 SDIKDDDYVILIGCGGSSTSLEDLKELSSFTNCEFELPST 363

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  296 bits (757), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 157/344 (45%), Positives = 214/344 (62%), Gaps = 13/344 (3%)

Query: 1   MSIVYNKTPLLRQFFRGSP------IPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINS 54
           MS +Y KTPLLR+ F G P      +PQF +KYE  QPSGSFKSRGIGNLI   + +I  
Sbjct: 1   MSSLYVKTPLLRRAF-GKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRR 59

Query: 55  SNLNKRPQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGG 114
            +  K+P VF                   IPCTVVVPT+T++R++ KI  TGA +I  G 
Sbjct: 60  -DPAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGD 118

Query: 115 HWSEADDYLQNHVINKIDLNEIE----PIYVHPFDNPLIWEGHSTMIDEIIESLNEQNID 170
           +++EAD YL++ +    + N  +    PIYVHPF++PLIW GHS +++EI+ESL  +NI 
Sbjct: 119 YFAEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIP 178

Query: 171 IRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPK 230
              VK I CS+             E+++LA+ IPIIGVET GC+V + SL   KL+ F K
Sbjct: 179 YSRVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKK 238

Query: 231 INTIATSLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALH 290
             ++ATSL   TI+ +T   A KY TKS+V+   +V+ TCLR+T + N V EPACGA LH
Sbjct: 239 ALSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLH 298

Query: 291 LAYNTGLIENALDTTLTKDDIIIVIACGGSSNTVQELEEALLKY 334
           L Y+  ++   L   L+ +DI+I+IACGGS+ T+ +L E  LKY
Sbjct: 299 LGYHPAILHKELG-PLSSEDIVILIACGGSATTLADLRELKLKY 341

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  297 bits (761), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 159/361 (44%), Positives = 218/361 (60%), Gaps = 20/361 (5%)

Query: 1   MSIVYNKTPLLRQFF-----RGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSS 55
           M+  Y KTPL+R  F     R +  P+  LKYE  QPSGSFKSRGIGNLI K + KI   
Sbjct: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQ- 127

Query: 56  NLNKRPQVFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGH 115
           N + +P VF                   +PCTVVVP  T+ RMV +I+ TGA VI  G  
Sbjct: 128 NSSLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSV 187

Query: 116 WSEADDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVK 175
             E+DDYL++ ++  ++L ++ PIY HPFDNPLIWEGH+TM+DE++E+L+ Q + + +VK
Sbjct: 188 LKESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVK 247

Query: 176 AITCSIXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKF-PKINTI 234
            I CS+             EK+ LA  IP++ VET GC+V + SL L + V   PK  ++
Sbjct: 248 GIVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNPK--SV 305

Query: 235 ATSLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYN 294
           ATSL TS ++  T   A KY TKSVV+D + V++TCL +  + N V EPACGAALHL Y+
Sbjct: 306 ATSLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYH 365

Query: 295 TGLIENALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYKLDYSLPQTPEYIFTENHTP 354
             ++E  L   LT  D++IVIACGGS+  + +L+E+      D   P+  ++     HTP
Sbjct: 366 PEILERELG-PLTPQDVVIVIACGGSTMNLADLKES-----EDQLQPKIKDF-----HTP 414

Query: 355 I 355
           I
Sbjct: 415 I 415

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  293 bits (749), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 148/325 (45%), Positives = 201/325 (61%), Gaps = 2/325 (0%)

Query: 5   YNKTPLL-RQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQV 63
           YNKTPLL R        P+FFLKYE +QP GSFKSRGIG L+ KS +K       K   V
Sbjct: 8   YNKTPLLPRVLTTTDGAPRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDG-GKSLAV 66

Query: 64  FXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYL 123
           F                   I CTVVVP  TK RMV KI+ TGA+V+V G HW  AD+YL
Sbjct: 67  FSSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGMADEYL 126

Query: 124 QNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXX 183
           +  V+ ++D++++ P+YVHPFDNP+IW+GHST++DE++  L E+N+ I  VKAI CS+  
Sbjct: 127 REVVMKEVDVSKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKVKAIVCSVGG 186

Query: 184 XXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTI 243
                      E + LA +IPI+ +ET GC V N SL     V    + ++A+SL +  I
Sbjct: 187 GGLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSVASSLASPYI 246

Query: 244 SAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIENALD 303
           S K FENA KY +KS+++ +  VI+TCL +  D   V EPACGA+L+  Y+  L+   + 
Sbjct: 247 SEKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYHPELLPLYIG 306

Query: 304 TTLTKDDIIIVIACGGSSNTVQELE 328
             LT+DD+I+VIACGGS+ T ++LE
Sbjct: 307 KELTEDDVIVVIACGGSAVTYKDLE 331

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  290 bits (742), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 204/327 (62%), Gaps = 2/327 (0%)

Query: 5   YNKTPLLRQFF-RGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQV 63
           Y KTPL+RQ F  G   P F++K++ +QP GSFKSRGIG+LI K  +K   +  + +  V
Sbjct: 6   YEKTPLIRQVFDNGKTNPLFYIKHDMLQPGGSFKSRGIGHLIRKK-NKEALAEGSGKLVV 64

Query: 64  FXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYL 123
           F                   + CTVVVP  TK RMV KI+  GAKVI++G HW EAD+YL
Sbjct: 65  FSSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHWGEADEYL 124

Query: 124 QNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXX 183
           +  V+ +   +  + +YVHPFD+ +IWEGHST++DEI++ L E++I    VK + CS+  
Sbjct: 125 KQEVMAQEGQHGSKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQVKGLVCSVGG 184

Query: 184 XXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTI 243
                      E+  LA KIPI+ VET GC V N SLK    V   ++ ++ATSLG+  I
Sbjct: 185 GGLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSVATSLGSPYI 244

Query: 244 SAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIENALD 303
           +   FE+ + Y  KSVV+ + DV+ TCLRY  D+N + EPACGA+LHL Y+  ++E AL 
Sbjct: 245 APFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYHPEILEKALG 304

Query: 304 TTLTKDDIIIVIACGGSSNTVQELEEA 330
             L++DD++I+IACGGS  T ++L +A
Sbjct: 305 QKLSEDDVVIIIACGGSCMTYEDLVKA 331

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  287 bits (735), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 203/326 (62%), Gaps = 2/326 (0%)

Query: 5   YNKTPLLRQFFR-GSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQV 63
           Y +TPL+ Q F  G   P+ ++K+E +QP GSFKSRGIG+LI +S ++  +    K   V
Sbjct: 6   YERTPLIHQVFNNGQTGPRLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSGKLA-V 64

Query: 64  FXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYL 123
           F                   + CTVVVP  TK RM+ KI++ GAKVI++G HW EAD+YL
Sbjct: 65  FSSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEADEYL 124

Query: 124 QNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXX 183
           +  ++ +      + +YVHPFD+  IWEGHST++DE+++ L E+NI +  +KA+ CS+  
Sbjct: 125 RQELMIQESQLGSKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIKAMVCSVGG 184

Query: 184 XXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTI 243
                      E+ NLA KI +I VET GC V N SL     +   ++++IATSLG+  I
Sbjct: 185 GGLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIATSLGSPYI 244

Query: 244 SAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIENALD 303
           +   FE+   Y  KSVV+ + DV+ TCLRY  D+N + EPACGA+LHL Y+  ++ENAL+
Sbjct: 245 APFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQEILENALE 304

Query: 304 TTLTKDDIIIVIACGGSSNTVQELEE 329
             L+ DDI+I+IACGGS  T ++L E
Sbjct: 305 QKLSDDDIVIIIACGGSCMTYEDLVE 330

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  287 bits (735), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 148/327 (45%), Positives = 203/327 (62%), Gaps = 3/327 (0%)

Query: 5   YNKTPLLRQFFR-GSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQV 63
           Y KTPL+RQF   G     F++K+E +QP GSFKSRGIG+LI KS ++  S    K   V
Sbjct: 6   YEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKLA-V 64

Query: 64  FXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYL 123
           F                   + C+VVVP  TK RMV KI+  GAKVI++G HW EAD+YL
Sbjct: 65  FSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADEYL 124

Query: 124 QNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXX 183
           + H + +   +  + +YVHPFDN  IWEGHST++DEIIE L E +I +  VKA+ CS+  
Sbjct: 125 R-HEMAQESQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGG 183

Query: 184 XXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTI 243
                      ++  LA KIP++ VET GC V N SLK    V   K+ ++ATSL +  I
Sbjct: 184 GGLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYI 243

Query: 244 SAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIENALD 303
           ++  FE+  KY  KSVV+ + DV+ TCLRY  D+N + EPACGA+LHL Y+  ++E+ L+
Sbjct: 244 ASFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILE 303

Query: 304 TTLTKDDIIIVIACGGSSNTVQELEEA 330
             + +DDI+I+IACGGS  T ++L +A
Sbjct: 304 QKIYEDDIVIIIACGGSCMTYEDLVKA 330

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  270 bits (690), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 141/331 (42%), Positives = 196/331 (59%), Gaps = 4/331 (1%)

Query: 6   NKTPLLRQFFRGSPI--PQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQV 63
           +K+PLL + F+ S    PQFFLKYE +QPSGSFKSRGIG LI  S  K   S       V
Sbjct: 5   HKSPLLNRRFKESEKDGPQFFLKYETLQPSGSFKSRGIGYLI-NSKAKEARSRDGSDVHV 63

Query: 64  FXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYL 123
           F                   + CTVVVP  TK  M+++I++ G++VIV+G HW  AD YL
Sbjct: 64  FSSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGMADTYL 123

Query: 124 QNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXX 183
           +  V+ K+  N +EP+YVHPFD+PL+WEGHS MIDEI+E L EQ   +R+VK I CS+  
Sbjct: 124 KEVVMKKVPSN-VEPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGIICSVGG 182

Query: 184 XXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTI 243
                      E++  A KIPII VET G      SL   K V+  ++ +IA+SLG+  I
Sbjct: 183 GGLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASSLGSPYI 242

Query: 244 SAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIENALD 303
           +  +FE A++Y T+S V  + + ++T LR+  + N + EPAC A++ L Y+   +   L 
Sbjct: 243 AQDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDELNKLLS 302

Query: 304 TTLTKDDIIIVIACGGSSNTVQELEEALLKY 334
             L+  DI+IVI CGGS+ T+ +LE    +Y
Sbjct: 303 CKLSSKDIVIVIVCGGSATTISDLEMLQRRY 333

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  269 bits (688), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 141/324 (43%), Positives = 199/324 (61%), Gaps = 13/324 (4%)

Query: 7   KTPLL--RQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVF 64
           KTPLL  R+   G P   F LKYE +QP GSFKSRGI +LI  ++D I  S+      V+
Sbjct: 7   KTPLLPFREPLNGGP--TFLLKYENLQPGGSFKSRGISHLIKTTMDSI--SDPENELAVY 62

Query: 65  XXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQ 124
                              +PCTV+VP +TK RM+ KI+  GAKV++ G HW EAD YL+
Sbjct: 63  SSSGGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHWKEADTYLR 122

Query: 125 NHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXX 184
            +V+ +   +    +YVHPFDNP+IW+GHSTMIDEIIE L E + DI +VK I CS+   
Sbjct: 123 EYVMRQSSYSNT--LYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDINDVKGIVCSVGGG 180

Query: 185 XXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTIS 244
                     E++ LA  IP+  +ET+GC V + SL   + V   +I++IATSLG++ I 
Sbjct: 181 GLYNGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRISSIATSLGSTEIC 240

Query: 245 AKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIENALDT 304
           A +F+ A+K+++KS+V+D+ +V+ TCLR+  + + + EPACGA+LH  Y   L+      
Sbjct: 241 ADSFQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHTCYRPELL-----G 295

Query: 305 TLTKDDIIIVIACGGSSNTVQELE 328
            L  DDI++VI CGGS NT  +L+
Sbjct: 296 PLGPDDIVVVILCGGSCNTYDDLK 319

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  223 bits (568), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 109/223 (48%), Positives = 151/223 (67%), Gaps = 2/223 (0%)

Query: 108 KVIVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQ 167
           +V V+  +  EAD YLQN VI+     +++PIYV+PFD+PLIWEGHST+IDEI+ +L ++
Sbjct: 4   EVFVHVANLKEADYYLQNVVIDL--YKDVQPIYVNPFDDPLIWEGHSTIIDEILNTLTQE 61

Query: 168 NIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVK 227
           NI++ +VK I CS              EKY+LA  IP++ VET GC V N SL   K V+
Sbjct: 62  NIEVGSVKGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPVQ 121

Query: 228 FPKINTIATSLGTSTISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGA 287
              I +IA SLG+S +S K F+N +KY++KS+V+++ D + TC +Y  DF  V EPACGA
Sbjct: 122 LDSITSIAKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACGA 181

Query: 288 ALHLAYNTGLIENALDTTLTKDDIIIVIACGGSSNTVQELEEA 330
           ++H AY+  ++E ALD  L  DD+II+IACGGS  T Q+LE A
Sbjct: 182 SVHTAYHYNVLEEALDQKLRPDDVIIIIACGGSCATFQDLERA 224

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  189 bits (480), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 127/192 (66%)

Query: 139 IYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYN 198
           +YVHPFDN  IWEGHST++DEIIE L E +I +  VKA+ CS+             ++  
Sbjct: 12  LYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSGIIKGLDRNQ 71

Query: 199 LASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKS 258
           LA KIP++ VET GC V N SLK    V   K+ ++ATSL +  I++  FE+  KY  KS
Sbjct: 72  LAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFESFNKYGCKS 131

Query: 259 VVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIENALDTTLTKDDIIIVIACG 318
           VV+ + DV+ TCLRY  D+N + EPACGA+LHL Y+  ++E+ L+  + +DDI+I+IACG
Sbjct: 132 VVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYEDDIVIIIACG 191

Query: 319 GSSNTVQELEEA 330
           GS  T ++L +A
Sbjct: 192 GSCMTYEDLVKA 203

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score =  107 bits (267), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 56/122 (45%), Positives = 72/122 (59%), Gaps = 2/122 (1%)

Query: 5   YNKTPLLRQFFR-GSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQV 63
           Y KTPL+RQF   G     F++K+E +QP GSFKSRGIG+LI KS ++  S    K   V
Sbjct: 6   YEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKLA-V 64

Query: 64  FXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYL 123
           F                   + C+VVVP  TK RMV KI+  GAKVI++G HW EAD+YL
Sbjct: 65  FSSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADEYL 124

Query: 124 QN 125
           ++
Sbjct: 125 RH 126

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 67.8 bits (164), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 70/269 (26%), Positives = 110/269 (40%), Gaps = 22/269 (8%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK E + P  SFK RG  N+I K    ++ S   K   V                    I
Sbjct: 83  LKREDLLPVFSFKLRGAYNMIAK----LDESQ--KTQGVIACSAGNHAQGVAYASKHLNI 136

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHPF 144
           P T+V+P +T       +   G++V++ G  + EA          +   N      + PF
Sbjct: 137 PATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLTEERGLTN------IPPF 190

Query: 145 DNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIP 204
           D+P +  G  T+  EI+  ++  +     +KA+ C++             ++  +A  I 
Sbjct: 191 DHPYVIAGQGTIAMEILRQVHNAS----KIKAVFCAVGGGGLITGVGAYLKR--IAPHIK 244

Query: 205 IIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVVDNI 264
           +IGVET      +TSLK  K V  P + T A       I  +TF  A K     VV+ N 
Sbjct: 245 VIGVETYDAATLHTSLKAGKRVPLPNVGTFADGTSVRMIGEETFRVA-KDVVDEVVLVNT 303

Query: 265 DVIKTCLRYTY-DFNQVAEPACGAALHLA 292
           D I   ++  + D   + EP+   AL +A
Sbjct: 304 DEICAAVKDIFEDTRSIVEPS--GALSVA 330

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 106/267 (39%), Gaps = 22/267 (8%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK E + P  SFK RG  N+I K +D+       K   V                    I
Sbjct: 88  LKREDLLPVFSFKLRGAYNMIAK-LDETQ-----KNAGVIACSAGNHAQGVAFSSNHMNI 141

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIY-VHP 143
           P T+V+P +T       +   GA+V++ G  + EA        +    L E   +  + P
Sbjct: 142 PATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDEAK-------LECARLAEERGMTDIPP 194

Query: 144 FDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKI 203
           FD+P +  G  T+  EI+  +   +    N+ A+ C++             ++  +A  I
Sbjct: 195 FDHPYVIAGQGTIAMEILRQVQNGS----NIGAVFCAVGGGGLISGIGSYLKR--IAPHI 248

Query: 204 PIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVVDN 263
            +IGVET      + SLK  K    P + T A       I  +TF    +     V++ N
Sbjct: 249 KVIGVETYDAATLDVSLKNGKRTPLPSVGTFADGTSVRLIGEETFR-VCQDVVDEVILVN 307

Query: 264 IDVIKTCLRYTY-DFNQVAEPACGAAL 289
            D I   ++  + D   + EP+   A+
Sbjct: 308 TDEICAAVKDVFEDTRSIVEPSGALAV 334

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 103/265 (38%), Gaps = 18/265 (6%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK E + P  SFK RG  N+I K    ++ S  N+   V                    I
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK----LDDSQRNQ--GVIACSAGNHAQGVAYAAKHLGI 143

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHPF 144
           P T+V+P +T       +   G++V++ G  + EA          +   N      + PF
Sbjct: 144 PATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTN------IPPF 197

Query: 145 DNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIP 204
           D+P +  G  T+  EI+  ++  N     + A+   +             ++  +A  I 
Sbjct: 198 DHPYVIAGQGTVAMEILRQVHNAN----KIGAVFVPVGGGGFIAGVGAYLKR--IAPHIK 251

Query: 205 IIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVVDNI 264
           +IGVET      +TSLK  K    P + T A       I  +TF  A +   + V+V+  
Sbjct: 252 VIGVETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVIGEETFRVAQQVVDEVVLVNTD 311

Query: 265 DVIKTCLRYTYDFNQVAEPACGAAL 289
           ++         D   + EP+   A+
Sbjct: 312 EICAAVKDIFEDTRSIVEPSGALAV 336

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 61/261 (23%), Positives = 103/261 (39%), Gaps = 20/261 (7%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK E + P  SFK RG  N+I       N     K   V                    I
Sbjct: 82  LKREDLLPVFSFKLRGAYNMI------SNLDEYQKSAGVIACSAGNHAQGVAFSARELGI 135

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHPF 144
              +V+PT+T     N +   GA+V++ G  + EA    +        L+++  I   PF
Sbjct: 136 RAMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEA----KAECARLAQLHKLTDI--PPF 189

Query: 145 DNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIP 204
           D+P +  G  T+  EI+  ++  +     + A+ C +             ++  +A  I 
Sbjct: 190 DHPYVIAGQGTIATEILRQVHNAS----QIGAVFCGVGGGGLIAGIGSYLKR--IAPHIK 243

Query: 205 IIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVVDNI 264
           IIGVET+     +T+LK  +    P +   A       +  +TF  A +     VV+ N 
Sbjct: 244 IIGVETHDAPTLHTALKQGRRTMLPAVGCFADGTSVRMMGEETFRVA-RDVVDEVVLVNT 302

Query: 265 DVIKTCLRYTY-DFNQVAEPA 284
           D +   ++  + D   + EP+
Sbjct: 303 DELCAAIKDIFEDTRAIVEPS 323

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 117/289 (40%), Gaps = 23/289 (7%)

Query: 4   VYNKTPLLRQFFRGSPI-PQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQ 62
           + N++P+ R  F  S +     LK E + P  SFK RG  N+I    D      + K+  
Sbjct: 69  IINESPISRSEFLSSRLNTDVQLKREDLLPVFSFKLRGAYNMISHLDD------VQKKCG 122

Query: 63  VFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDY 122
           V                    IP T+V+P +T       +   GA+V++ G ++  A   
Sbjct: 123 VIACSAGNHAQGVAYSAKHLGIPATIVMPVSTPSIKYQNVSRLGAEVVLYGDNFDAAK-- 180

Query: 123 LQNHVINKIDLNEIEPIY-VHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSI 181
                +    L+E + +Y + PFD+P +  G  T+  EI++ +   +     + A+ C++
Sbjct: 181 -----VECSRLSEEKGLYDIPPFDHPYVIAGQGTIAMEILKQIQNSS----KIGAVFCAV 231

Query: 182 XXXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTS 241
                        ++   A  I +IGVET      +TS++        ++   A      
Sbjct: 232 GGGGLIAGVGAYIKR--AAPHIKVIGVETYDAATLHTSMQNNARTTLSQVGGFADGTSVR 289

Query: 242 TISAKTFENALKYNTKSVVVDNIDVIKTCLRYTY-DFNQVAEPACGAAL 289
            I  ++F  A +     V++ N D I   ++  + D   V EP+   A+
Sbjct: 290 LIGEESFRVAREV-VDEVILVNTDEICAAIKDIFEDTRAVVEPSGALAV 337

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 60/246 (24%), Positives = 97/246 (39%), Gaps = 26/246 (10%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK E + P  SFK RG  N+I K  D + +        V                    I
Sbjct: 100 LKREDLLPVFSFKLRGAYNMIAKLDDNVRNQG------VIACSAGNHAQGVAYAAKKLGI 153

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIY-VHP 143
           P T+V+P +T       +   G++V++ G  + EA             L+E   +  + P
Sbjct: 154 PATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAK-------LSEERGLTNIPP 206

Query: 144 FDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKI 203
           FD+P +  G  T+  EI+  ++  N     + A+   +             ++  +A  I
Sbjct: 207 FDHPYVIAGQGTVAMEILRQVHNAN----KINAVFVPVGGGGLIAGVGAYLKR--IAPHI 260

Query: 204 PIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVVDN 263
            +IGVET      +TSL+  K  +  K+ T A       I  +TF  A +      VVD 
Sbjct: 261 KVIGVETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETFRVAQE------VVDE 314

Query: 264 IDVIKT 269
           I ++ T
Sbjct: 315 IVLVNT 320

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 62/268 (23%), Positives = 102/268 (38%), Gaps = 20/268 (7%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK E + P  SFK RG  N+I K    ++ S  N+   V                    I
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK----LDDSQRNQ--GVIACSAGNHAQGVAFAAKHLKI 150

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHPF 144
           P T+V+P  T       +   G++V++ G  + EA          +   N      + PF
Sbjct: 151 PATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTN------IPPF 204

Query: 145 DNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIP 204
           D+P +  G  T+  EI+  +   N     + A+   +             ++  +A  I 
Sbjct: 205 DHPYVIAGQGTVAMEILRQVRTAN----KIGAVFVPVGGGGLIAGIGAYLKR--VAPHIK 258

Query: 205 IIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVVDNI 264
           IIGVET      + SL+  +    P + T A       I  +TF  A +   + V+V+  
Sbjct: 259 IIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVLVNTD 318

Query: 265 DVIKTCLRYTYDFNQVAEPACGAALHLA 292
           ++         D   + EP+   AL +A
Sbjct: 319 EICAAVKDIFEDTRSIVEPS--GALSVA 344

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 61/268 (22%), Positives = 102/268 (38%), Gaps = 20/268 (7%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK E + P  SFK RG  N+I K    ++ S  N+   V                    I
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK----LDDSQRNQ--GVIACSAGNHAQGVAFAAKHLKI 150

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHPF 144
           P T+V+P  T       +   G++V++ G  + EA          +   N      + PF
Sbjct: 151 PATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTN------IPPF 204

Query: 145 DNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIP 204
           D+P +  G  T+  EI+  +   N     + A+   +             ++  +A  I 
Sbjct: 205 DHPYVIAGQGTVAMEILRQVRTAN----KIGAVFVPVGGGGLIAGIGAYLKR--VAPHIK 258

Query: 205 IIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVVDNI 264
           +IGVET      + SL+  +    P + T A       I  +TF  A +   + V+V+  
Sbjct: 259 VIGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVLVNTD 318

Query: 265 DVIKTCLRYTYDFNQVAEPACGAALHLA 292
           ++         D   + EP+   AL +A
Sbjct: 319 EICAAVKDIFEDTRSIVEPS--GALSVA 344

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 104/269 (38%), Gaps = 22/269 (8%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK E + P  SFK RG  N+I K    ++ S  N+   V                    I
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK----LDDSQRNQ--GVIACSAGNHAQGVAFAAKHLKI 150

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHPF 144
           P T+V+P  T       +   G++V++ G  + EA          +   N      + PF
Sbjct: 151 PATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDEAKAECTKLAEERGLTN------IPPF 204

Query: 145 DNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIP 204
           D+P +  G  T+  EI+  +   N     + A+   +             ++  +A  I 
Sbjct: 205 DHPYVIAGQGTVAMEILRQVRTVN----KIGAVFVPVGGGGLIAGIGAYLKR--IAPHIK 258

Query: 205 IIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVVDNI 264
           +IGVET      + SL+  +    P + T A       I  +TF  A +     VV+ N 
Sbjct: 259 VIGVETYDAATLHNSLQRNQRTPLPAVGTFADGTSVRMIGEETFRVAQQV-VDEVVLVNT 317

Query: 265 DVIKTCLRYTY-DFNQVAEPACGAALHLA 292
           D I   ++  + D   + EP+   AL +A
Sbjct: 318 DEICAAVKDVFEDTRSIVEPS--GALSVA 344

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 59/265 (22%), Positives = 98/265 (36%), Gaps = 18/265 (6%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK E + P  SFK RG  N+I K  D        +   V                    I
Sbjct: 92  LKREDLLPVFSFKLRGAYNMIAKLDDT------QRNQGVIACSAGNHAQGVAYAARHLDI 145

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHPF 144
           P T+V+P +T       +   G++V++ G  + EA          +   N      + PF
Sbjct: 146 PATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTN------IPPF 199

Query: 145 DNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIP 204
           D+P +  G  T+  EI+  +   N     + A+   +             ++  +   I 
Sbjct: 200 DHPYVIAGQGTVAMEILRQVYNSN----KIGAVFVPVGGGGLIAGVGAYLKR--VTPHIK 253

Query: 205 IIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVVDNI 264
           IIGVET+     +TSL+  K      + T A       I  +TF  A +   + V+V+  
Sbjct: 254 IIGVETHDAATLHTSLQRNKRTNLASVGTFADGTSVRIIGEETFRVAREVVDEIVLVNTD 313

Query: 265 DVIKTCLRYTYDFNQVAEPACGAAL 289
           ++         D   + EP+   A+
Sbjct: 314 EICAAVKDVFEDTRSIVEPSGALAV 338

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 103/269 (38%), Gaps = 22/269 (8%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK E + P  SFK RG  N++ K  D        K   V                    I
Sbjct: 87  LKREDLLPVFSFKLRGAYNMMAKLDDS------QKNQGVIACSAGNHAQGIAYAAKHLNI 140

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHPF 144
           P T+V+P +T       +   G++V++ G  + EA          +   N      + PF
Sbjct: 141 PATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECARLAEERGLTN------IPPF 194

Query: 145 DNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIP 204
           D+P +  G  T+  EI+  +++ N     + A+   +             ++  +A  I 
Sbjct: 195 DHPYVIAGQGTVAMEILRQVHKAN----KIGAVFVPVGGGGLIAGVGAYLKR--IAPHIK 248

Query: 205 IIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVVDNI 264
           IIGVET       TSL+  K V    + T A       I  +TF    +     VV+ N 
Sbjct: 249 IIGVETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIGEETFR-VCQEVVDEVVLVNT 307

Query: 265 DVIKTCLRYTY-DFNQVAEPACGAALHLA 292
           D I   ++  + D   + EP+   AL +A
Sbjct: 308 DEICAAVKDVFEDTRSIVEPS--GALSVA 334

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 63/269 (23%), Positives = 104/269 (38%), Gaps = 22/269 (8%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK E + P  SFK RG  N+I K    ++ S  N+   V                    I
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK----LDDSQRNQ--GVIACSAGNHAQGVAFAAKHLKI 150

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHPF 144
           P T+V+P  T       +   G++V++ G  + EA          +   N      + PF
Sbjct: 151 PATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTN------IPPF 204

Query: 145 DNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIP 204
           D+P +  G  T+  EI+  +   N     + A+   +             ++  +A  I 
Sbjct: 205 DHPYVIAGQGTVAMEILRQVRTAN----KIGAVFVPVGGGGLIAGIGAYLKR--VAPHIK 258

Query: 205 IIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVVDNI 264
           +IGVET      + SL+  +    P + + A       I  +TF  A +     VV+ N 
Sbjct: 259 VIGVETFDAPTLHNSLQRNQRTPLPVVGSFADGTSVRMIGEETFRVAQQV-VDEVVLVNT 317

Query: 265 DVIKTCLRYTY-DFNQVAEPACGAALHLA 292
           D I   ++  + D   + EP+   AL +A
Sbjct: 318 DEICAAVKDVFEDTRSIVEPS--GALSVA 344

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 97/268 (36%), Gaps = 24/268 (8%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK E + P  SFK RG  N+I K  D        K   V                    I
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAKLDDS------QKNQGVIACSAGNHAQGVAFAAKHMSI 143

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIY-VHP 143
           P T+V+P +T       +   G++V++ G  + EA             L+E   +  + P
Sbjct: 144 PATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTR-------LSEERGLTNIPP 196

Query: 144 FDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKY--NLAS 201
           FD+P +  G  T+  EI+         +RN   I  ++               Y   +A 
Sbjct: 197 FDHPYVIAGQGTVAMEILRQ-------VRNSAKI-GAVFVPCGGGGLVAGIGAYLKRIAP 248

Query: 202 KIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVV 261
            I IIGVET      +TSLK  K      + T A       I  +TF  A     + V+V
Sbjct: 249 HIKIIGVETFDSATLHTSLKNGKRTPLASVGTFADGTSVRMIGEETFRIAQDVVDEVVLV 308

Query: 262 DNIDVIKTCLRYTYDFNQVAEPACGAAL 289
              ++         D   + EP+   A+
Sbjct: 309 GTDEICAAIKDIFEDTRGIVEPSGALAV 336

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 65/269 (24%), Positives = 101/269 (37%), Gaps = 22/269 (8%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK E + P  SFK RG  N+I K    ++ S  N+   V                    I
Sbjct: 91  LKREDLLPVFSFKLRGAYNMIAK----LDDSQRNQ--GVIACSAGNHAQGVAFAAKHLNI 144

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHPF 144
           P T+V+P +T       +   G++V++ G  + EA          +   N      + PF
Sbjct: 145 PATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLAEERGLTN------IPPF 198

Query: 145 DNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIP 204
           D+P +  G  T+  EI+  ++  N      K     +                 +A  I 
Sbjct: 199 DHPYVIAGQGTVAMEILRQVHNAN------KIGAVFVPVGGGGLVAGVGAYLKRIAPHIK 252

Query: 205 IIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVVDNI 264
           IIGVET+      TSLK  +      +   A       I  +TF  A +     VV+ N 
Sbjct: 253 IIGVETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLIGEETFRVAQEV-VDEVVLVNT 311

Query: 265 DVIKTCLRYTY-DFNQVAEPACGAALHLA 292
           D I   ++  + D   + EP+   AL +A
Sbjct: 312 DEICAAVKDVFEDTRSIVEPS--GALSVA 338

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 59/265 (22%), Positives = 94/265 (35%), Gaps = 18/265 (6%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK E + P  SFK RG  N++ K  D        K   V                    I
Sbjct: 98  LKREDLLPVFSFKLRGAYNMMAKLDDT------QKNQGVIACSAGNHAQGVAFAAKHLDI 151

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHPF 144
           P T+V+P +T       +   G++V++ G  + EA          +   N      + PF
Sbjct: 152 PATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTKLSKERGLTN------IPPF 205

Query: 145 DNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIP 204
           D+P +  G  T+  EI+  ++  N      K     +                 +A  I 
Sbjct: 206 DHPYVIAGQGTVAMEILRQVHIAN------KIGAVFVPVGGGGLVAGVGAYLKRIAPHIK 259

Query: 205 IIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVVDNI 264
           IIGVET       TSL+  +    P + T A       I  +TF  +     + V+V+  
Sbjct: 260 IIGVETFDASTLYTSLQRGRRTSLPSVGTFADGTSVKLIGEETFRISQDVVDEVVLVNTD 319

Query: 265 DVIKTCLRYTYDFNQVAEPACGAAL 289
           ++         D   + EP+   A+
Sbjct: 320 EICAAVKDIFEDTRSIVEPSGALAV 344

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 59/266 (22%), Positives = 100/266 (37%), Gaps = 20/266 (7%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK + + P  SFK RG  N++ K  D        K   V                    I
Sbjct: 89  LKRDDLLPVFSFKLRGAYNMMAKLDDT------QKNQGVIACSAGNHAQGVAYAAKHLKI 142

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHPF 144
           P T+V+P +T       +   G++V++ G  + EA          +   N      + PF
Sbjct: 143 PATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECARLAEERGLTN------IPPF 196

Query: 145 DNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIP 204
           D+P +  G  T+  EI+  ++  +     + A+   +             ++  +A  I 
Sbjct: 197 DHPYVIAGQGTVAMEILRQVHMSS----KIGAVFVPVGGGGLIAGVGTYLKR--IAPHIK 250

Query: 205 IIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVVDNI 264
           IIGVET       TSL+  K      + + A       +  +TF  A +     VV+ N 
Sbjct: 251 IIGVETYDACALYTSLQSGKRAALESVGSFADGTAVRLLGEETFRVAQEV-VDEVVLVNT 309

Query: 265 DVIKTCLRYTY-DFNQVAEPACGAAL 289
           D I   ++  + D   + EP+   A+
Sbjct: 310 DEICAGIKDIFEDTRSIVEPSGALAV 335

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/291 (21%), Positives = 111/291 (38%), Gaps = 23/291 (7%)

Query: 4   VYNKTPLLRQFFRGSPI-PQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQ 62
           V N++P+ +     S +  Q  LK E + P  SFK RG  N++ K +D+       ++  
Sbjct: 69  VINESPMTKGIGLSSKLNSQIQLKREDLLPVFSFKMRGAYNMVAK-LDETQ-----RKQG 122

Query: 63  VFXXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDY 122
           V                    IP T+V+P +T       +   G++V++ G  +  +   
Sbjct: 123 VIACSAGNHAQGVAYAAKHLGIPATIVMPVSTPSIKYENVSRLGSQVVLYGNDFDSSKGE 182

Query: 123 LQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIX 182
            +     +  +N      + PFD+P +  G  T+  EI+  +        + K     + 
Sbjct: 183 CERLCEERGLVN------IPPFDHPYVIAGQGTVAMEILRQVKN------SAKIGAVFVP 230

Query: 183 XXXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTST 242
                           +A  I I+GVET       TSL   K  +   + T A       
Sbjct: 231 VGGGGLVAGIGAYLKRIAPHIKIVGVETYDAATLKTSLDNGKRTELNTVGTFADGTAVKM 290

Query: 243 ISAKTFENALKYNTKSVVVDNIDVIKTCLRYTY-DFNQVAEPACGAALHLA 292
           I  +TF  + K     +V+ N D +   ++  + D   + EP+   AL +A
Sbjct: 291 IGEETFRVS-KDVVDEIVLVNTDELCAAVKDIFEDTRSIVEPS--GALSVA 338

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/269 (21%), Positives = 105/269 (39%), Gaps = 22/269 (8%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQ-VFXXXXXXXXXXXXXXXXXXX 83
           LK E + P  SFK RG  N+I K +D+      N++ Q V                    
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-LDE------NQKNQGVIACSAGNHAQGVAYAARHMN 142

Query: 84  IPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHP 143
           IP T+V+P +T       +   G++V++ G  + EA          +   N      + P
Sbjct: 143 IPATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAKLAEERGLTN------IPP 196

Query: 144 FDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKI 203
           FD+P +  G  T+  EI+  ++        + A+   +             ++  +A  I
Sbjct: 197 FDHPYVIAGQGTVAMEILRQVHNS----LKIGAVFVPVGGGGLIAGIGAYLKR--IAPHI 250

Query: 204 PIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVVDN 263
            I+GVET+     + S+K  K      + + A       I  +TF  + +   + V+V+ 
Sbjct: 251 KIVGVETHDAPTLSASMKTGKRELLKTVGSFADGTSVRIIGEETFRVSQEVVDEIVLVNT 310

Query: 264 IDVIKTCLRYTYDFNQVAEPACGAALHLA 292
            ++         D   + EP+   AL +A
Sbjct: 311 DEICAAVKDIFEDTRSIIEPS--GALSVA 337

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/246 (21%), Positives = 85/246 (34%), Gaps = 24/246 (9%)

Query: 6   NKTPLLRQFFRGSPI-PQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVF 64
           NKTP+L      + +  + + K E  Q  G+FK RG  N +LK   +  ++       V 
Sbjct: 21  NKTPVLTSRTVNAELGAEVYFKCENFQRIGAFKFRGAMNTLLKLTQEQRAAG------VV 74

Query: 65  XXXXXXXXXXXXXXXXXXXIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQ 124
                              +P T+V+P       V      GA ++         D Y +
Sbjct: 75  AFSSGNHAQAIALSAKLLGVPATIVMPNDAPAAKVRATAGYGANIV-------RYDRYTE 127

Query: 125 NH-VINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXX 183
           +   I +    E     V P+D+P +  G  T   E+IE + E ++           +  
Sbjct: 128 DREQIGRALAEEKGLTLVPPYDHPDVIAGQGTAAKELIEEVGELDL---------LFVPL 178

Query: 184 XXXXXXXXXXXEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTI 243
                          L+ +  IIGVE         SL+   +V      TIA    T  +
Sbjct: 179 GGGGLLSGSALAAKRLSPRCEIIGVEPEAGNDGQQSLRSGSIVHIDTPETIADGAQTQHL 238

Query: 244 SAKTFE 249
              TFE
Sbjct: 239 GQYTFE 244

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 59/266 (22%), Positives = 90/266 (33%), Gaps = 20/266 (7%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK E + P  SFK RG  N++ K       S   K   V                    I
Sbjct: 94  LKREDLLPVFSFKLRGAYNMMAKL------SEAQKNQGVIACSAGNHAQGVAFASRHLNI 147

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEPIYVHPF 144
           P  +V+P  T       +   G +V++ G  + EA       +  +  L  I P     F
Sbjct: 148 PAIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEAKTEC-TRISEERGLTNIPP-----F 201

Query: 145 DNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIP 204
           D+P +  G  T+  EI+  ++         K     +                 +A  I 
Sbjct: 202 DHPYVIAGQGTVAMEILRQVHNA------AKIGAVFVPVGGGGLVAGVAAYLKRIAPHIK 255

Query: 205 IIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVVVDNI 264
           IIGVET       TSL+         + T A       I  +TF          V++ N 
Sbjct: 256 IIGVETYDSATLKTSLEAGTRTPLSTVGTFADGTSVRMIGEETFRICQDL-VDDVILVNT 314

Query: 265 DVIKTCLRYTY-DFNQVAEPACGAAL 289
           D I   ++  + D   + EP+   A+
Sbjct: 315 DEICAAVKDIFEDTRSIVEPSGALAV 340

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/269 (21%), Positives = 91/269 (33%), Gaps = 26/269 (9%)

Query: 25  LKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKRPQVFXXXXXXXXXXXXXXXXXXXI 84
           LK E + P  SFK RG  N++ K    +     NK   V                    I
Sbjct: 83  LKREDLLPVFSFKLRGAYNMMAK----LAEGQGNK--GVIACSAGNHAQGVAFASRHLNI 136

Query: 85  PCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEADDYLQNHVINKIDLNEIEP----IY 140
           P  +V+P  T       +   G +V++ G  + EA          KI+   I        
Sbjct: 137 PAIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEA----------KIECARISEERGLTN 186

Query: 141 VHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLA 200
           + PFD+P +  G  T+  EI+  ++  +      K     +                 +A
Sbjct: 187 IPPFDHPYVIAGQGTVAMEILRQVHNAS------KIGAVFVPVGGGGLVAGVAAYLKRIA 240

Query: 201 SKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGTSTISAKTFENALKYNTKSVV 260
             I I+GVET       TSL          + T A       I  +TF     +  + V+
Sbjct: 241 PHIKIVGVETYDSATLKTSLDAGCRTPLTSVGTFADGTSVRMIGEETFRICEDFVDEVVL 300

Query: 261 VDNIDVIKTCLRYTYDFNQVAEPACGAAL 289
           V+  ++         D   + EP+   A+
Sbjct: 301 VNTDEICAAVKDIFEDTRSIVEPSGALAV 329

>TBLA0F02330 Chr6 complement(576335..577975) [1641 bp, 546 aa] {ON}
           Anc_7.333 YDL156W
          Length = 546

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 3/63 (4%)

Query: 108 KVIVNGGHWSEADDYLQNHVINKIDLN-EIEPIYVHPFDNPLIWEGHSTMIDEIIESLNE 166
           + IV    WS+ DDY  + +I   D    I  I   PFDN L+  G+   I   +  +NE
Sbjct: 375 RKIVKEPEWSQYDDYESHQIIGTYDSRLSISAISYSPFDNTLVCNGYDDTIR--LFDVNE 432

Query: 167 QNI 169
            NI
Sbjct: 433 NNI 435

>SAKL0D12210g Chr4 complement(1009364..1011313) [1950 bp, 649 aa]
           {ON} similar to uniprot|P39682 Saccharomyces cerevisiae
           YML046W PRP39 U1 snRNP protein involved in splicing
           contains multiple tetriatricopeptide repeats
          Length = 649

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 52/117 (44%), Gaps = 7/117 (5%)

Query: 151 EGHSTMIDEIIESLNEQNIDIRNVKAITCSIXXXXXXXXXXXXXEKYNLASKIPIIGVET 210
           E H     ++IE LN+QN+ +  V+ I  +              + +N  SK+P +   T
Sbjct: 428 EKHGLADSQLIEILNDQNVAVVIVELIKVTWLILKNTMQTR---KYFNSFSKLPQLRTST 484

Query: 211 NGCQVFNTSLKLKKLVK-FPKINTIATSLGTSTISAKTFENALKYNTKSVVVDNIDV 266
           +    + T  K +K  K F K+N   ++LGT      T  N +  + K+  + N DV
Sbjct: 485 S---FWLTYYKFEKTFKNFNKLNKFVSNLGTEFTLPITIMNDILVDYKTFYLTNSDV 538

>TBLA0A07390 Chr1 complement(1832812..1834023) [1212 bp, 403 aa]
           {ON} Anc_1.14 YCL052C
          Length = 403

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 198 NLASKIPIIGVETNGCQVFNTSLKL--KKLVKFPKINTIATSLGTSTISAKTFENALKYN 255
           NL    PI+     GC VF +S      KLVK P + +   S+  S I+     +  ++N
Sbjct: 62  NLLQNSPILPTYPYGCSVFTSSNSTDDSKLVKVPDLYSSFHSMDQSCINRIPSLDGFEFN 121

Query: 256 TKSV 259
           TKS+
Sbjct: 122 TKSI 125

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,765,112
Number of extensions: 1519481
Number of successful extensions: 4868
Number of sequences better than 10.0: 66
Number of HSP's gapped: 4877
Number of HSP's successfully gapped: 66
Length of query: 360
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 249
Effective length of database: 40,753,473
Effective search space: 10147614777
Effective search space used: 10147614777
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)