Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A039508.324ON93693647640.0
NCAS0C032608.324ON98394935740.0
Suva_10.2228.324ON94393635560.0
NDAI0G025808.324ON95895235250.0
Smik_12.1928.324ON94393835200.0
SAKL0H15532g8.324ON94193635170.0
Skud_12.1988.324ON94393635170.0
Kpol_1036.698.324ON93693234940.0
TDEL0F045008.324ON93893334770.0
TPHA0C008108.324ON93793234650.0
YLR129W (DIP2)8.324ON94393634470.0
ZYRO0F10406g8.324ON93893133810.0
KAFR0H022608.324ON93893733790.0
KLTH0G12276g8.324ON93793533720.0
Kwal_56.239208.324ON93793533500.0
KNAG0G024508.324ON94293533120.0
CAGL0M04279g8.324ON94093632820.0
Ecym_42558.324ON93793232270.0
AGL196C8.324ON93593531800.0
KLLA0D16390g8.324ON93693630400.0
Skud_12.2858.435ON8175973311e-30
AGR180W8.435ON8067093301e-30
Suva_10.3168.435ON8186013221e-29
NDAI0E034408.435ON8576513212e-29
YLR222C (UTP13)8.435ON8175973202e-29
KAFR0H017508.435ON7836063192e-29
Smik_12.2798.435ON8175983085e-28
KNAG0A025108.435ON8496073078e-28
ZYRO0A09636g8.435ON8086993042e-27
TBLA0I025708.435ON8486573015e-27
TDEL0B020108.435ON8056372989e-27
CAGL0C00737g8.435ON8166332943e-26
NCAS0C027108.435ON8155902853e-25
TPHA0L010808.435ON8356102837e-25
Kpol_1031.498.435ON7606542763e-24
SAKL0H12760g8.435ON8416422756e-24
Kwal_27.115858.435ON8236582721e-23
KLTH0E10120g8.435ON8266532693e-23
KLLA0F13244g8.435ON8146532667e-23
Ecym_41348.435ON8102032433e-20
ZYRO0D01122g7.534ON4663152384e-20
Ecym_25236.363ON6462792406e-20
CAGL0C03608g6.363ON6433702389e-20
YCR084C (TUP1)6.363ON7132992381e-19
Skud_3.1566.363ON7132992381e-19
AGL234W6.363ON6292792362e-19
KLLA0F10263g6.363ON6822762362e-19
TPHA0M020006.363ON6992822362e-19
TBLA0F042406.363ON7273332362e-19
Smik_3.1836.363ON7092992344e-19
Suva_3.1216.363ON7002742335e-19
TDEL0A077806.363ON6572842325e-19
NCAS0D047806.363ON6212762317e-19
Kpol_1028.236.363ON7442832318e-19
SAKL0A00660g6.363ON6602842263e-18
ZYRO0D17292g6.363ON7182842263e-18
KNAG0D002506.363ON6552242229e-18
Kwal_23.64296.363ON7502822183e-17
CAGL0E00561g6.363ON8363402193e-17
KNAG0A037008.544ON8173012183e-17
KLTH0A07282g6.363ON7252842174e-17
Ecym_70388.544ON8001752157e-17
AEL246C8.544ON8152942141e-16
SAKL0F15972g7.534ON4703092111e-16
KAFR0C047406.363ON6653232131e-16
Kpol_487.71.399ON3032522051e-16
KAFR0E031808.544ON8143012132e-16
Skud_2.3248.544ON8023012103e-16
NDAI0K023506.363ON7932222094e-16
NDAI0C054908.544ON8593012069e-16
AEL269C7.534ON4552692039e-16
NCAS0A055206.363ON6712862051e-15
TBLA0F005206.363ON6632972041e-15
TPHA0I032407.534ON4772832012e-15
TPHA0I018808.544ON10342182042e-15
Smik_2.3388.544ON8003092032e-15
KLLA0E23453g8.544ON8261752032e-15
NCAS0A151707.534ON4743802003e-15
TBLA0H036208.544ON8123052013e-15
Suva_4.4528.544ON8002162014e-15
NCAS0B022008.544ON8222842005e-15
SAKL0H09988g8.544ON7492941987e-15
CAGL0M05335g8.544ON8063011971e-14
Suva_13.2952.431ON3192311901e-14
Skud_13.2752.431ON3192311901e-14
Smik_13.3052.431ON3192311901e-14
YMR116C (ASC1)2.431ON3192311901e-14
TPHA0L016908.544ON8322261961e-14
YBR198C (TAF5)8.544ON7983071952e-14
ZYRO0A12980g8.544ON8242551943e-14
Skud_14.3211.399ON3032521863e-14
KAFR0A005102.431ON3192341864e-14
TDEL0H003707.534ON4653161904e-14
TDEL0B030208.544ON8312951924e-14
KLTH0D04466g2.431ON3192371855e-14
Suva_14.3421.399ON3032521846e-14
SAKL0A03872g6.239ON8783181916e-14
Kpol_1013.377.534ON4682451887e-14
ZYRO0E04620g1.399ON3032521838e-14
TPHA0G023802.431ON3182301839e-14
TDEL0B059701.399ON3032521839e-14
Smik_14.3221.399ON3032521821e-13
YNL006W (LST8)1.399ON3032521821e-13
KAFR0B003707.534ON4612481842e-13
TPHA0O007101.399ON3042831792e-13
Kwal_27.120538.544ON7553021853e-13
AFL118W6.239ON8322911853e-13
KLTH0E12606g8.544ON7552161843e-13
AFR199C2.431ON3342281785e-13
KNAG0H016901.399ON3032521775e-13
Kpol_297.72.431ON3182301776e-13
Kpol_1024.428.544ON8432271826e-13
NDAI0G038303.25ON5102111807e-13
KNAG0F018406.239ON9112911827e-13
Kpol_1028.416.340ON5124441808e-13
Ecym_55015.631ON3272381768e-13
KNAG0F038707.534ON4652371798e-13
KLTH0H12122g1.399ON3032521759e-13
KAFR0H031401.399ON3032521759e-13
SAKL0F08404g7.231ON6431901801e-12
TDEL0A004403.25ON4512081771e-12
Ecym_24986.340ON5424381781e-12
Kpol_1048.598.544ON8502181791e-12
CAGL0H03729g1.399ON3032851731e-12
Ecym_43437.231ON5832331782e-12
TBLA0A060606.239ON8882911792e-12
NDAI0C026001.399ON3032881722e-12
Suva_14.223.25ON4692101762e-12
KLTH0A00880g7.534ON4712481752e-12
Kwal_23.53517.534ON4742451752e-12
KLTH0H03608g6.239ON8752921773e-12
Skud_14.223.25ON4672101753e-12
KAFR0L013907.322ON12061851773e-12
TPHA0P014903.25ON4592071743e-12
Ecym_28087.534ON4651591743e-12
KLTH0A06380g6.325ON9155691763e-12
Kwal_23.62406.325ON9135641764e-12
ADL082C7.231ON5691901744e-12
SAKL0E03960g2.431ON3202331704e-12
CAGL0J03476g6.340ON5174371744e-12
Skud_3.1456.340ON5153431735e-12
ZYRO0C03124g3.25ON4452081725e-12
CAGL0I03718g7.322ON12011591756e-12
Kpol_1070.117.231ON6661731746e-12
Kpol_1014.193.25ON4522081726e-12
KLLA0B01958g6.239ON8903101746e-12
TPHA0G016108.672ON4141441717e-12
ZYRO0D08206g6.340ON5152881727e-12
ZYRO0F07282g8.672ON4271461718e-12
NCAS0A139407.322ON12051591748e-12
TPHA0J025406.239ON8662891738e-12
Kwal_0.2121.399ON3032521678e-12
KLLA0C08547g6.340ON5152861718e-12
Ecym_20936.325ON9234141739e-12
ZYRO0D16742g7.231ON6082291729e-12
TPHA0D045007.322ON12081881739e-12
KAFR0I018807.231ON5911191711e-11
KNAG0E023102.431ON3192311671e-11
Smik_14.143.25ON4662801701e-11
TBLA0F022307.322ON12161771721e-11
YNL317W (PFS2)3.25ON4652101701e-11
KLLA0E12277g2.431ON3262441671e-11
CAGL0G09845g7.534ON5002811701e-11
CAGL0L03201g1.247ON5792391711e-11
KLLA0F04884g7.322ON12121881712e-11
YDL145C (COP1)7.322ON12011901712e-11
KNAG0B027207.322ON12041591712e-11
NDAI0A020907.322ON12001771712e-11
TPHA0M018306.340ON5154261692e-11
NDAI0A026107.231ON7671731702e-11
ADR077C7.322ON12041851702e-11
TPHA0B011201.247ON7191431692e-11
Skud_4.1097.322ON12011851702e-11
Ecym_60982.431ON3182291643e-11
CAGL0M04081g3.25ON4552051673e-11
TBLA0D041307.231ON5741161683e-11
TDEL0A075506.340ON5154301673e-11
Kpol_1028.546.325ON9053261693e-11
Smik_4.907.322ON12011851693e-11
SAKL0H06666g8.672ON4412121663e-11
CAGL0G04345g1.247ON7111161683e-11
Kwal_23.57697.231ON6272331673e-11
Kpol_2001.657.322ON12061881683e-11
NCAS0G036001.399ON3272931633e-11
NCAS0C039908.67ON7302841673e-11
Suva_3.1096.340ON5153431664e-11
KLTH0A04114g7.231ON6582331674e-11
Suva_4.997.322ON12011591684e-11
ZYRO0E07392g6.239ON8972911674e-11
TDEL0H021307.231ON5841731664e-11
YIL046W (MET30)7.231ON6401751664e-11
ZYRO0D03828g1.247ON7261231664e-11
TBLA0F041306.340ON5144771655e-11
TDEL0C022407.322ON12011591675e-11
AER263C6.340ON5131461655e-11
KNAG0B016101.247ON6742291665e-11
Smik_3.1726.340ON5153431655e-11
Suva_6.1871.247ON7141371665e-11
Suva_9.1547.231ON6381731655e-11
NCAS0D046106.340ON5152621646e-11
NCAS0A134307.231ON6081161656e-11
ZYRO0F11110g7.322ON12011851666e-11
Smik_3.1576.325ON9245241666e-11
KNAG0J016808.672ON3981441636e-11
KAFR0A033801.247ON6661541657e-11
YCR072C (RSA4)6.340ON5153431647e-11
Ecym_12931.399ON3032521607e-11
TDEL0A074006.325ON9013291657e-11
KLLA0D04840g1.399ON3032511608e-11
TBLA0E007607.534ON3841201628e-11
KLLA0F27511g7.231ON6232681648e-11
Skud_9.1237.231ON6391731648e-11
SAKL0D04796g1.247ON7692261648e-11
Ecym_80727.322ON12011741658e-11
NCAS0B078401.247ON5892021639e-11
KLLA0E07085g3.25ON4522131629e-11
SAKL0F10648g7.322ON12031851641e-10
KLTH0D11132g8.672ON4371851611e-10
TDEL0A061808.672ON4341461611e-10
TDEL0D013101.247ON7091901631e-10
KAFR0A069906.239ON8852921631e-10
Smik_5.200na 1ON3913831601e-10
KNAG0I028406.340ON5192631611e-10
SAKL0A01738g6.325ON9092431631e-10
KNAG0C014101.247ON6531341612e-10
SAKL0B02244g8.67ON7732861622e-10
NDAI0B051901.247ON6682191612e-10
KLTH0A06754g6.340ON5144461602e-10
AEL314W1.247ON7151441612e-10
NCAS0C044503.25ON4612071602e-10
Kpol_1016.111.247ON6691441612e-10
Ecym_80901.247ON7161281612e-10
TDEL0F002701.534ON7051781612e-10
Kpol_1031.361.247ON7061571612e-10
NDAI0I003506.340ON5152611602e-10
Kwal_26.87768.672ON4331441592e-10
KAFR0F043506.340ON5151421592e-10
TDEL0E054806.239ON8812921612e-10
NDAI0J003307.534ON4722191592e-10
Suva_3.936.325ON9204161603e-10
Ecym_24018.672ON4261461583e-10
KLTH0F16764g5.631ON3312301563e-10
KLTH0H01892g7.322ON12091591603e-10
Kwal_56.245267.322ON12101591603e-10
YCR057C (PWP2)6.325ON9235251603e-10
Smik_7.1356.239ON8872911603e-10
KNAG0I025406.325ON9185231603e-10
CAGL0L00781g7.231ON6731751593e-10
KNAG0A012503.25ON4522111573e-10
Skud_3.1336.325ON9163301593e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A03950
         (936 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...  1839   0.0  
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...  1381   0.0  
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...  1374   0.0  
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...  1362   0.0  
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...  1360   0.0  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...  1359   0.0  
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...  1359   0.0  
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...  1350   0.0  
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...  1343   0.0  
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...  1339   0.0  
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...  1332   0.0  
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...  1306   0.0  
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...  1306   0.0  
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...  1303   0.0  
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...  1295   0.0  
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...  1280   0.0  
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...  1268   0.0  
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...  1247   0.0  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...  1229   0.0  
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...  1175   0.0  
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...   132   1e-30
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...   131   1e-30
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...   128   1e-29
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...   128   2e-29
YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON} ...   127   2e-29
KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {O...   127   2e-29
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...   123   5e-28
KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {O...   122   8e-28
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...   121   2e-27
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...   120   5e-27
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...   119   9e-27
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...   117   3e-26
NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {O...   114   3e-25
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....   113   7e-25
Kpol_1031.49 s1031 (132811..133005,133055..133063,133288..133320...   110   3e-24
SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]...   110   6e-24
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...   109   1e-23
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...   108   3e-23
KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} high...   107   7e-23
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    98   3e-20
ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON...    96   4e-20
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    97   6e-20
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    96   9e-20
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    96   1e-19
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    96   1e-19
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    96   2e-19
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    96   2e-19
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    96   2e-19
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    96   2e-19
Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON...    95   4e-19
Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON...    94   5e-19
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    94   5e-19
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     94   7e-19
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    94   8e-19
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    92   3e-18
ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]...    92   3e-18
KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363...    90   9e-18
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    89   3e-17
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    89   3e-17
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    89   3e-17
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    88   4e-17
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    87   7e-17
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    87   1e-16
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    86   1e-16
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    87   1e-16
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    84   1e-16
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    87   2e-16
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    86   3e-16
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    85   4e-16
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             84   9e-16
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    83   9e-16
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    84   1e-15
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    83   1e-15
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    82   2e-15
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    83   2e-15
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    83   2e-15
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    83   2e-15
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    82   3e-15
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    82   3e-15
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    82   4e-15
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    82   5e-15
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    81   7e-15
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    80   1e-14
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    78   1e-14
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    78   1e-14
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    78   1e-14
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    78   1e-14
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    80   1e-14
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    80   2e-14
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    79   3e-14
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    76   3e-14
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    76   4e-14
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    78   4e-14
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    79   4e-14
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    76   5e-14
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    75   6e-14
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    78   6e-14
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    77   7e-14
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    75   8e-14
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    75   9e-14
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    75   9e-14
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    75   1e-13
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    75   1e-13
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    75   2e-13
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    74   2e-13
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    76   3e-13
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    76   3e-13
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    75   3e-13
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    73   5e-13
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    73   5e-13
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    73   6e-13
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    75   6e-13
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      74   7e-13
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    75   7e-13
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    74   8e-13
Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar ...    72   8e-13
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    74   8e-13
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    72   9e-13
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    72   9e-13
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    74   1e-12
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    73   1e-12
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    73   1e-12
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    74   1e-12
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    71   1e-12
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    73   2e-12
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    74   2e-12
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      71   2e-12
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    72   2e-12
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    72   2e-12
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    72   2e-12
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    73   3e-12
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    72   3e-12
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    73   3e-12
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    72   3e-12
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    72   3e-12
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    72   3e-12
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    72   4e-12
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    72   4e-12
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    70   4e-12
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    72   4e-12
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    71   5e-12
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    71   5e-12
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    72   6e-12
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    72   6e-12
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    71   6e-12
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    72   6e-12
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    70   7e-12
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    71   7e-12
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    70   8e-12
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    72   8e-12
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    71   8e-12
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    69   8e-12
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    70   8e-12
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    71   9e-12
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    71   9e-12
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    71   9e-12
KAFR0I01880 Chr9 (386694..388469) [1776 bp, 591 aa] {ON} Anc_7.2...    70   1e-11
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    69   1e-11
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    70   1e-11
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    71   1e-11
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    70   1e-11
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    69   1e-11
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    70   1e-11
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    70   1e-11
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    70   2e-11
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    70   2e-11
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    70   2e-11
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    70   2e-11
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    70   2e-11
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     70   2e-11
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    70   2e-11
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    70   2e-11
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    70   2e-11
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    68   3e-11
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    69   3e-11
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    69   3e-11
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    69   3e-11
Kpol_1028.54 s1028 (125940..128657) [2718 bp, 905 aa] {ON} (1259...    70   3e-11
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    70   3e-11
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    69   3e-11
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    69   3e-11
Kwal_23.5769 s23 complement(1311598..1313481) [1884 bp, 627 aa] ...    69   3e-11
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    69   3e-11
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    67   3e-11
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    69   3e-11
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    69   4e-11
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    69   4e-11
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    69   4e-11
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    69   4e-11
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    69   4e-11
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    69   4e-11
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    69   4e-11
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    68   5e-11
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    69   5e-11
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    68   5e-11
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    69   5e-11
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    68   5e-11
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    69   5e-11
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    68   5e-11
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     68   6e-11
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    68   6e-11
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    69   6e-11
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    69   6e-11
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    67   6e-11
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    68   7e-11
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    68   7e-11
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    66   7e-11
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    68   7e-11
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    66   8e-11
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               67   8e-11
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    68   8e-11
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    68   8e-11
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    68   8e-11
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    68   8e-11
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    67   9e-11
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    67   9e-11
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    68   1e-10
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    67   1e-10
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    67   1e-10
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    67   1e-10
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    67   1e-10
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    66   1e-10
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    67   1e-10
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    67   1e-10
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    67   2e-10
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    67   2e-10
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    67   2e-10
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    66   2e-10
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    67   2e-10
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      66   2e-10
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    67   2e-10
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    67   2e-10
TDEL0F00270 Chr6 complement(40832..42949) [2118 bp, 705 aa] {ON}...    67   2e-10
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    67   2e-10
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       66   2e-10
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    66   2e-10
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    66   2e-10
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    67   2e-10
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      66   2e-10
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    66   3e-10
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    65   3e-10
KLTH0F16764g Chr6 complement(1358483..1359478) [996 bp, 331 aa] ...    65   3e-10
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    66   3e-10
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    66   3e-10
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    66   3e-10
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    66   3e-10
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    66   3e-10
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    66   3e-10
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    65   3e-10
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    66   3e-10
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    66   3e-10
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    65   4e-10
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    66   4e-10
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    65   5e-10
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    65   5e-10
AER081C Chr5 complement(785301..788372) [3072 bp, 1023 aa] {ON} ...    65   6e-10
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    65   6e-10
KNAG0D01690 Chr4 (286791..288755) [1965 bp, 654 aa] {ON} Anc_7.2...    65   6e-10
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    65   6e-10
AAR057W Chr1 (442821..445589) [2769 bp, 922 aa] {ON} Syntenic ho...    65   7e-10
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    64   7e-10
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    64   8e-10
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    65   9e-10
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    64   9e-10
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    64   1e-09
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    64   1e-09
KLLA0E21781g Chr5 complement(1944865..1945866) [1002 bp, 333 aa]...    63   1e-09
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    64   1e-09
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    63   1e-09
NCAS0D04480 Chr4 complement(851440..854187) [2748 bp, 915 aa] {O...    64   2e-09
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    64   2e-09
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    64   2e-09
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    63   2e-09
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    64   2e-09
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    63   2e-09
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    64   2e-09
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    64   2e-09
AGL024W Chr7 (667533..669803) [2271 bp, 756 aa] {ON} Syntenic ho...    64   2e-09
KAFR0J02550 Chr10 complement(484360..487080) [2721 bp, 906 aa] {...    64   2e-09
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    64   2e-09
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    63   2e-09
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    63   2e-09
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    63   3e-09
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    63   3e-09
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    63   3e-09
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       63   3e-09
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    62   3e-09
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      62   4e-09
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    62   4e-09
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    62   4e-09
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    61   4e-09
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    62   4e-09
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    62   4e-09
CAGL0K09284g Chr11 (915766..918501) [2736 bp, 911 aa] {ON} highl...    62   5e-09
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    62   5e-09
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    62   5e-09
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    62   5e-09
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    62   5e-09
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    62   6e-09
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    61   6e-09
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    61   6e-09
TPHA0K00780 Chr11 (163003..164088) [1086 bp, 361 aa] {ON} Anc_7....    61   6e-09
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    62   6e-09
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    60   6e-09
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    61   7e-09
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    60   8e-09
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    61   9e-09
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    61   9e-09
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    60   9e-09
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    61   9e-09
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    60   1e-08
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    61   1e-08
ZYRO0G03586g Chr7 (285054..287969) [2916 bp, 971 aa] {ON} simila...    61   1e-08
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    61   1e-08
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    60   1e-08
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    61   1e-08
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    60   1e-08
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    61   1e-08
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    61   1e-08
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    61   1e-08
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    60   1e-08
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    60   1e-08
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    60   1e-08
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    60   2e-08
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    60   2e-08
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    60   2e-08
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    60   2e-08
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    60   2e-08
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    60   2e-08
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    60   2e-08
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    59   2e-08
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    60   2e-08
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    57   2e-08
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    60   2e-08
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      59   2e-08
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    59   3e-08
KLLA0B14410g Chr2 (1264616..1266736) [2121 bp, 706 aa] {ON} simi...    60   3e-08
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    60   3e-08
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     59   3e-08
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    59   3e-08
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    60   3e-08
TPHA0G02030 Chr7 (417868..418911) [1044 bp, 347 aa] {ON} Anc_2.3...    59   3e-08
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     59   3e-08
TPHA0G02570 Chr7 (531221..532261) [1041 bp, 346 aa] {ON} Anc_2.3...    59   3e-08
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    59   3e-08
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    57   3e-08
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    59   3e-08
Kpol_1002.74 s1002 complement(195739..198756) [3018 bp, 1005 aa]...    59   4e-08
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    58   4e-08
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    59   4e-08
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    59   4e-08
SAKL0A05412g Chr1 complement(489032..492025) [2994 bp, 997 aa] {...    59   4e-08
Smik_2.112 Chr2 (202544..205069) [2526 bp, 841 aa] {ON} YBL008W ...    59   5e-08
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     58   5e-08
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    59   5e-08
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    59   5e-08
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    59   6e-08
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    58   8e-08
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    58   8e-08
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    57   8e-08
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    57   8e-08
ACR091W Chr3 (520609..521595) [987 bp, 328 aa] {ON} Syntenic hom...    57   9e-08
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    57   9e-08
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    58   9e-08
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    58   1e-07
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    56   1e-07
Kpol_1054.60 s1054 (148854..151013) [2160 bp, 719 aa] {ON} (1488...    58   1e-07
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    57   1e-07
YBL008W Chr2 (209653..212175) [2523 bp, 840 aa] {ON}  HIR1Subuni...    58   1e-07
KLTH0D14960g Chr4 complement(1223765..1226584) [2820 bp, 939 aa]...    58   1e-07
Kpol_1055.64 s1055 (170524..173340) [2817 bp, 938 aa] {ON} (1705...    58   1e-07
Ecym_7301 Chr7 (634995..637349) [2355 bp, 784 aa] {ON} similar t...    58   1e-07
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    57   1e-07
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    57   1e-07
Ecym_3243 Chr3 (460611..463448) [2838 bp, 945 aa] {ON} similar t...    57   2e-07
TBLA0B09730 Chr2 (2309400..2310938) [1539 bp, 512 aa] {ON} Anc_2...    57   2e-07
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    57   2e-07
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    56   2e-07
Skud_2.103 Chr2 (193155..195677) [2523 bp, 840 aa] {ON} YBL008W ...    57   2e-07
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    57   2e-07
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    57   2e-07
Suva_2.117 Chr2 (203652..206174) [2523 bp, 840 aa] {ON} YBL008W ...    57   2e-07
Kpol_1032.61 s1032 (141357..143825) [2469 bp, 822 aa] {ON} (1413...    57   2e-07
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    56   2e-07
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    55   2e-07
TPHA0A04810 Chr1 complement(1090373..1092751) [2379 bp, 792 aa] ...    57   2e-07
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    56   2e-07
KAFR0B06670 Chr2 (1390238..1393234) [2997 bp, 998 aa] {ON} Anc_6...    57   3e-07
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    55   3e-07
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              56   3e-07
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    56   3e-07
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    56   3e-07
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    56   3e-07
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    56   3e-07
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    55   3e-07
Skud_4.530 Chr4 complement(945231..946247) [1017 bp, 338 aa] {ON...    55   3e-07
NDAI0A03310 Chr1 (750920..753373) [2454 bp, 817 aa] {ON} Anc_4.106     56   4e-07
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    55   4e-07
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    56   4e-07
AFL056C Chr6 complement(329216..332146) [2931 bp, 976 aa] {ON} S...    56   4e-07
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    55   4e-07
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    56   4e-07
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    56   4e-07
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    56   4e-07
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    56   5e-07
KLTH0D12188g Chr4 (990209..991582) [1374 bp, 457 aa] {ON} simila...    55   5e-07
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    55   5e-07
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    55   5e-07
Kwal_27.11126 s27 (651113..654103) [2991 bp, 996 aa] {ON} YPL183...    55   6e-07
YPL183C Chr16 complement(199495..202536) [3042 bp, 1013 aa] {ON}...    55   6e-07
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    55   7e-07
KNAG0B06260 Chr2 complement(1228060..1230876) [2817 bp, 938 aa] ...    55   7e-07
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    55   7e-07
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    55   7e-07
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    55   7e-07
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    54   7e-07
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    55   8e-07
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       55   8e-07
NCAS0D03330 Chr4 (623172..625046) [1875 bp, 624 aa] {ON} Anc_6.135     55   8e-07
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    54   8e-07
Suva_7.278 Chr7 complement(482297..483559) [1263 bp, 420 aa] {ON...    54   8e-07
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     54   8e-07
NCAS0I01170 Chr9 complement(210377..212017) [1641 bp, 546 aa] {O...    55   9e-07
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    55   9e-07
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    55   9e-07
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    55   9e-07
ZYRO0C15994g Chr3 (1255015..1256529) [1515 bp, 504 aa] {ON} simi...    54   9e-07
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    55   9e-07
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    55   9e-07
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    55   1e-06
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    54   1e-06
TPHA0B02080 Chr2 (477775..480600) [2826 bp, 941 aa] {ON} Anc_4.2...    55   1e-06
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    54   1e-06
Skud_7.55 Chr7 complement(95372..96565) [1194 bp, 397 aa] {ON} Y...    54   1e-06
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    54   1e-06
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    54   1e-06
NCAS0H01060 Chr8 complement(197867..200875) [3009 bp, 1002 aa] {...    54   1e-06
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    54   1e-06
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    54   1e-06
Kwal_23.4118 s23 (579251..582070) [2820 bp, 939 aa] {ON} YLR409C...    54   1e-06
Smik_6.388 Chr6 (622104..625145) [3042 bp, 1013 aa] {ON} YPL183C...    54   1e-06
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    54   1e-06
Smik_7.159 Chr7 (285146..286981) [1836 bp, 611 aa] {ON} YGL116W ...    54   1e-06
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    54   1e-06
Ecym_2239 Chr2 complement(467139..470081) [2943 bp, 980 aa] {ON}...    54   1e-06
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    53   2e-06
ADR264C Chr4 complement(1158216..1159256) [1041 bp, 346 aa] {ON}...    53   2e-06
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    54   2e-06
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    54   2e-06
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    53   2e-06
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    53   2e-06
YGL116W Chr7 (289809..291641) [1833 bp, 610 aa] {ON}  CDC20Cell-...    54   2e-06
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    54   2e-06
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    53   2e-06
TDEL0E00950 Chr5 (197384..200206) [2823 bp, 940 aa] {ON} Anc_4.2...    54   2e-06
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    52   2e-06
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    54   2e-06
ADR108C Chr4 complement(899198..900097) [900 bp, 299 aa] {ON} NO...    52   2e-06
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    53   2e-06
Suva_16.126 Chr16 complement(209255..212296) [3042 bp, 1013 aa] ...    54   3e-06
CAGL0M09845g Chr13 (975007..977817) [2811 bp, 936 aa] {ON} highl...    53   3e-06
Ecym_2356 Chr2 complement(697428..698819) [1392 bp, 463 aa] {ON}...    53   3e-06
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    53   3e-06
Smik_7.50 Chr7 complement(84865..86058) [1194 bp, 397 aa] {ON} Y...    52   3e-06
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    52   3e-06
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    53   3e-06
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    52   3e-06
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    52   4e-06
KLLA0B02827g Chr2 (254447..257275) [2829 bp, 942 aa] {ON} highly...    53   4e-06
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    53   4e-06
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    52   4e-06
KAFR0A05800 Chr1 (1177423..1180245) [2823 bp, 940 aa] {ON} Anc_4...    53   4e-06
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    53   4e-06
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    52   4e-06
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    52   4e-06
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    52   4e-06
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    52   4e-06
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    53   5e-06
NDAI0I01520 Chr9 complement(358776..360710) [1935 bp, 644 aa] {O...    52   5e-06
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    52   5e-06
Smik_13.344 Chr13 complement(540043..541086) [1044 bp, 347 aa] {...    52   5e-06
Suva_7.152 Chr7 (284623..286461) [1839 bp, 612 aa] {ON} YGL116W ...    52   5e-06
YGL213C Chr7 complement(90054..91247) [1194 bp, 397 aa] {ON}  SK...    52   5e-06
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    52   5e-06
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    52   5e-06
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    52   5e-06
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    52   6e-06
Ecym_6423 Chr6 (822758..824329) [1572 bp, 523 aa] {ON} similar t...    52   6e-06
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    52   6e-06
Skud_7.160 Chr7 (294214..296055) [1842 bp, 613 aa] {ON} YGL116W ...    52   6e-06
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    52   7e-06
CAGL0K00957g Chr11 (95657..98038) [2382 bp, 793 aa] {ON} similar...    52   7e-06
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    52   7e-06
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    51   7e-06
YMR146C Chr13 complement(557481..558524) [1044 bp, 347 aa] {ON} ...    51   7e-06
Smik_2.243 Chr2 (432627..434252) [1626 bp, 541 aa] {ON} YBR103W ...    52   7e-06
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    52   7e-06
ZYRO0F09284g Chr6 (754433..755767) [1335 bp, 444 aa] {ON} simila...    51   7e-06
Kwal_33.13515 s33 (259533..260729) [1197 bp, 398 aa] {ON} YNL253...    51   8e-06
TPHA0J02160 Chr10 (484299..487313) [3015 bp, 1004 aa] {ON} Anc_6...    52   8e-06
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    52   8e-06
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    51   8e-06
TPHA0A03680 Chr1 complement(804355..806004) [1650 bp, 549 aa] {O...    52   8e-06
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    51   8e-06
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    51   9e-06
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    51   9e-06
Ecym_7078 Chr7 complement(156495..157436) [942 bp, 313 aa] {ON} ...    51   9e-06
TBLA0C02090 Chr3 complement(495831..498683) [2853 bp, 950 aa] {O...    52   9e-06
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    51   9e-06
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    52   9e-06
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    51   9e-06
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    52   9e-06
NDAI0A01560 Chr1 (352038..353129) [1092 bp, 363 aa] {ON} Anc_5.6...    51   9e-06
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    51   1e-05
ZYRO0G10054g Chr7 (802784..805312) [2529 bp, 842 aa] {ON} simila...    52   1e-05
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    51   1e-05
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    51   1e-05
YOR269W Chr15 (826385..827869) [1485 bp, 494 aa] {ON}  PAC1Prote...    51   1e-05
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    51   1e-05
Skud_7.283 Chr7 complement(493716..494972) [1257 bp, 418 aa] {ON...    51   1e-05
TDEL0C04860 Chr3 (881043..882584) [1542 bp, 513 aa] {ON} Anc_3.3...    51   1e-05
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    51   1e-05
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    51   1e-05
NCAS0J01650 Chr10 complement(294247..297069) [2823 bp, 940 aa] {...    51   1e-05
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    51   1e-05
Kpol_1032.65 s1032 complement(150052..151095) [1044 bp, 347 aa] ...    50   1e-05
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    50   1e-05
KNAG0M00450 Chr13 complement(65548..68523) [2976 bp, 991 aa] {ON...    51   1e-05
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...    50   1e-05
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    50   1e-05
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    51   1e-05
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    51   2e-05
TDEL0A01730 Chr1 complement(310640..312433) [1794 bp, 597 aa] {O...    50   2e-05
AFL009C Chr6 complement(420007..421248) [1242 bp, 413 aa] {ON} S...    50   2e-05
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    50   2e-05
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    50   2e-05
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    50   2e-05
KLLA0A08866g Chr1 (776960..778231) [1272 bp, 423 aa] {ON} simila...    50   2e-05
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    50   2e-05
KAFR0K01900 Chr11 complement(388463..389554) [1092 bp, 363 aa] {...    50   2e-05
CAGL0K12188g Chr11 (1192017..1193624) [1608 bp, 535 aa] {ON} sim...    50   2e-05
KLTH0C00616g Chr3 complement(62501..63724) [1224 bp, 407 aa] {ON...    50   2e-05
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    50   2e-05
SAKL0H08932g Chr8 (763703..764647) [945 bp, 314 aa] {ON} similar...    49   2e-05
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    50   2e-05
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    50   2e-05
Suva_10.525 Chr10 complement(900164..902983) [2820 bp, 939 aa] {...    50   2e-05
SAKL0G08492g Chr7 (725684..727894) [2211 bp, 736 aa] {ON} simila...    50   2e-05
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    50   2e-05
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    50   2e-05
Ecym_1202 Chr1 complement(408312..409565,409631..409633) [1257 b...    50   2e-05
CAGL0C01441g Chr3 complement(156930..159947) [3018 bp, 1005 aa] ...    50   2e-05
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    50   2e-05
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    50   3e-05
Smik_7.286 Chr7 complement(482658..483911) [1254 bp, 417 aa] {ON...    50   3e-05
Kpol_1033.58 s1033 (147020..149881) [2862 bp, 953 aa] {ON} (1470...    50   3e-05
SAKL0B07458g Chr2 (642864..644393) [1530 bp, 509 aa] {ON} simila...    50   3e-05
ZYRO0G02420g Chr7 (184509..186686) [2178 bp, 725 aa] {ON} simila...    50   3e-05
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    49   3e-05
KLLA0F22000g Chr6 complement(2044973..2047354) [2382 bp, 793 aa]...    50   3e-05
ZYRO0F14960g Chr6 complement(1228479..1229438) [960 bp, 319 aa] ...    49   3e-05
NDAI0A07830 Chr1 (1802204..1804156) [1953 bp, 650 aa] {ON} Anc_3...    50   3e-05
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    50   3e-05
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    49   3e-05
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    49   3e-05
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    50   3e-05
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    49   4e-05
Smik_16.106 Chr16 (194195..196564) [2370 bp, 789 aa] {ON} YGR200...    50   4e-05
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    49   4e-05
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    49   4e-05
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    49   4e-05
ZYRO0D00616g Chr4 complement(47163..48347) [1185 bp, 394 aa] {ON...    49   4e-05
KAFR0D04430 Chr4 (874649..876928) [2280 bp, 759 aa] {ON} Anc_5.3...    49   4e-05
YLR409C Chr12 complement(934414..937233) [2820 bp, 939 aa] {ON} ...    49   4e-05
TPHA0E00770 Chr5 (154048..155115) [1068 bp, 355 aa] {ON} Anc_7.4...    49   5e-05
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    49   5e-05
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    49   5e-05
KLLA0C07513g Chr3 complement(656060..657379) [1320 bp, 439 aa] {...    49   5e-05
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    49   5e-05
Suva_7.48 Chr7 complement(86451..87644) [1194 bp, 397 aa] {ON} Y...    49   5e-05
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    49   6e-05
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    49   6e-05
Kwal_55.21559 s55 complement(889630..890685) [1056 bp, 351 aa] {...    48   6e-05
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    49   6e-05
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    49   6e-05
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    49   6e-05
KLTH0B01628g Chr2 (129632..132004) [2373 bp, 790 aa] {ON} simila...    49   6e-05
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    49   6e-05
Kpol_1048.38 s1048 (104927..105949) [1023 bp, 340 aa] {ON} (1049...    48   7e-05
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    48   7e-05
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    49   7e-05
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    48   7e-05
TPHA0A05850 Chr1 (1327076..1328374) [1299 bp, 432 aa] {ON} Anc_3...    48   8e-05
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    48   8e-05
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    48   8e-05
NDAI0E00950 Chr5 complement(192199..193734) [1536 bp, 511 aa] {O...    48   8e-05
ZYRO0G03168g Chr7 (241103..242923) [1821 bp, 606 aa] {ON} simila...    48   9e-05
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    48   9e-05
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    48   9e-05
KAFR0G01710 Chr7 (373483..375048) [1566 bp, 521 aa] {ON} Anc_3.3...    48   9e-05
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    47   9e-05
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    48   9e-05
YGL004C Chr7 complement(490703..491956) [1254 bp, 417 aa] {ON}  ...    48   1e-04
KAFR0A04550 Chr1 complement(901244..903100) [1857 bp, 618 aa] {O...    48   1e-04
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    47   1e-04
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    48   1e-04
KNAG0E02020 Chr5 (416909..417949) [1041 bp, 346 aa] {ON} Anc_2.3...    47   1e-04
NDAI0H00820 Chr8 (185870..186940) [1071 bp, 356 aa] {ON} Anc_5.6...    47   1e-04
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    47   1e-04
AGR207C Chr7 complement(1146704..1147666) [963 bp, 320 aa] {ON} ...    47   2e-04
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    47   2e-04
YER066W Chr5 (290242..290799) [558 bp, 185 aa] {ON}  RRT13Putati...    45   2e-04
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    47   2e-04
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...    47   2e-04
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    47   2e-04
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    47   2e-04
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    47   2e-04
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    47   2e-04
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    47   2e-04
TPHA0G03110 Chr7 (661602..663428) [1827 bp, 608 aa] {ON} Anc_2.4...    47   2e-04
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    47   2e-04
NCAS0A14470 Chr1 complement(2848835..2849923) [1089 bp, 362 aa] ...    47   2e-04
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    47   2e-04
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    47   2e-04
Suva_7.494 Chr7 complement(856266..858641) [2376 bp, 791 aa] {ON...    47   2e-04
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    47   2e-04
KAFR0I00640 Chr9 (128872..129819) [948 bp, 315 aa] {ON} Anc_8.58...    46   2e-04
Kpol_1050.33 s1050 complement(78024..80390) [2367 bp, 788 aa] {O...    47   2e-04
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    47   2e-04
ZYRO0B12980g Chr2 complement(1045283..1048102) [2820 bp, 939 aa]...    47   2e-04
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    47   3e-04
CAGL0I07073g Chr9 complement(681102..682283) [1182 bp, 393 aa] {...    46   3e-04
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    46   3e-04
NDAI0I02940 Chr9 (693605..694816) [1212 bp, 403 aa] {ON} Anc_3.5...    46   3e-04
AER035W Chr5 (699524..702544) [3021 bp, 1006 aa] {ON} Syntenic h...    47   3e-04
NCAS0A07850 Chr1 complement(1561758..1563596) [1839 bp, 612 aa] ...    47   3e-04
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    47   3e-04
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    46   3e-04
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    46   4e-04
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    46   4e-04
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    46   4e-04
TPHA0I01690 Chr9 (377629..378651) [1023 bp, 340 aa] {ON} Anc_8.5...    45   4e-04
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    46   4e-04
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    46   4e-04
KLTH0E15158g Chr5 (1346780..1348309) [1530 bp, 509 aa] {ON} simi...    46   5e-04
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    45   5e-04
CAGL0L06952g Chr12 complement(782790..783833) [1044 bp, 347 aa] ...    45   5e-04
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    45   5e-04
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    45   5e-04
TBLA0H02380 Chr8 (568334..570721) [2388 bp, 795 aa] {ON} Anc_5.1...    46   5e-04
Smik_15.451 Chr15 (775983..777467) [1485 bp, 494 aa] {ON} YOR269...    45   6e-04
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    46   6e-04
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    45   6e-04
Kpol_467.21 s467 (46346..48160) [1815 bp, 604 aa] {ON} (46346..4...    45   6e-04
Kwal_55.20233 s55 (311887..314130) [2244 bp, 747 aa] {ON} YDR324...    45   6e-04
SAKL0F01804g Chr6 complement(151476..152714,152788..152790) [124...    45   6e-04
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    45   6e-04
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    45   7e-04
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    45   7e-04
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    45   7e-04
Skud_7.536 Chr7 complement(874704..877070) [2367 bp, 788 aa] {ON...    45   7e-04
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    45   7e-04
SAKL0C10098g Chr3 complement(909553..912489) [2937 bp, 978 aa] {...    45   7e-04
Kwal_47.17465 s47 (415977..418379) [2403 bp, 800 aa] {ON} YBL008...    45   8e-04
AGL301C Chr7 complement(137221..138306) [1086 bp, 361 aa] {ON} S...    45   8e-04
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    45   9e-04
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    45   9e-04
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    45   9e-04
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    45   0.001
TPHA0C00320 Chr3 (53120..54184) [1065 bp, 354 aa] {ON} Anc_5.631...    44   0.001
NCAS0B00430 Chr2 (57814..59280) [1467 bp, 488 aa] {ON} Anc_8.717...    45   0.001
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    45   0.001
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...    44   0.001
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    45   0.001
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    45   0.001
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    45   0.001
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    45   0.001
SAKL0D02068g Chr4 (167213..168823) [1611 bp, 536 aa] {ON} simila...    45   0.001
NDAI0H03030 Chr8 complement(733181..734233) [1053 bp, 350 aa] {O...    44   0.001
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    44   0.001
SAKL0H05566g Chr8 complement(500251..501663) [1413 bp, 470 aa] {...    44   0.001
TBLA0A03210 Chr1 complement(762289..764535) [2247 bp, 748 aa] {O...    45   0.001
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    44   0.001
KNAG0G03310 Chr7 complement(709092..710552) [1461 bp, 486 aa] {O...    44   0.001
Ecym_7402 Chr7 complement(827224..829044) [1821 bp, 606 aa] {ON}...    44   0.001
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    44   0.001
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    44   0.001
NCAS0D01130 Chr4 (208915..209958) [1044 bp, 347 aa] {ON} Anc_2.3...    44   0.001
CAGL0J06512g Chr10 complement(622640..624277) [1638 bp, 545 aa] ...    44   0.001
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    45   0.001
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    44   0.001
YGR200C Chr7 complement(899904..902270) [2367 bp, 788 aa] {ON}  ...    44   0.001
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    44   0.001
Kpol_1036.22 s1036 (54759..57860) [3102 bp, 1033 aa] {ON} (54759...    44   0.002
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    44   0.002
AER337W Chr5 (1256750..1258087) [1338 bp, 445 aa] {ON} Syntenic ...    44   0.002
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               44   0.002
NDAI0D03490 Chr4 (820778..822079) [1302 bp, 433 aa] {ON} Anc_4.1...    44   0.002
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    44   0.002
NCAS0A06510 Chr1 (1283824..1285056) [1233 bp, 410 aa] {ON} Anc_4...    44   0.002
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    44   0.002
ACL116W Chr3 (140589..143003) [2415 bp, 804 aa] {ON} Syntenic ho...    44   0.002
KLTH0C04378g Chr3 (381355..382860) [1506 bp, 501 aa] {ON} simila...    44   0.002
NCAS0B01020 Chr2 complement(161030..162634) [1605 bp, 534 aa] {O...    44   0.002
Ecym_7149 Chr7 (308042..309139) [1098 bp, 365 aa] {ON} similar t...    43   0.002
Suva_2.435 Chr2 complement(769135..770127) [993 bp, 330 aa] {ON}...    43   0.002
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    44   0.002
KNAG0C03490 Chr3 (684848..685936) [1089 bp, 362 aa] {ON} Anc_7.4...    43   0.002
Kpol_1045.33 s1045 (77282..78367) [1086 bp, 361 aa] {ON} (77284....    43   0.002
Ecym_5334 Chr5 (679515..682574) [3060 bp, 1019 aa] {ON} similar ...    44   0.002
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....    43   0.002
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    44   0.002
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    44   0.003
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    43   0.003
Smik_4.585 Chr4 complement(1040861..1043125) [2265 bp, 754 aa] {...    44   0.003
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    43   0.003
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    44   0.003
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    43   0.003
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    43   0.003
Kwal_26.8628 s26 (871377..872645) [1269 bp, 422 aa] {ON} YOR212W...    43   0.003
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    43   0.003
SAKL0F12782g Chr6 complement(999031..1000134) [1104 bp, 367 aa] ...    43   0.003
KNAG0C06240 Chr3 complement(1212466..1213533) [1068 bp, 355 aa] ...    43   0.003
KAFR0E02470 Chr5 complement(503462..505351) [1890 bp, 629 aa] {O...    43   0.003
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    43   0.003
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    43   0.003
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    43   0.003
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    43   0.003
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      43   0.003
KAFR0C03870 Chr3 (783131..784120) [990 bp, 329 aa] {ON} Anc_2.65...    43   0.003
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    43   0.004
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    43   0.004
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    43   0.004
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    43   0.004
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    43   0.004
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    43   0.004
Kpol_1025.38 s1025 (90229..90465,90467..91492) [1263 bp, 420 aa]...    43   0.004
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    43   0.004
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    42   0.004
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    42   0.004
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    43   0.004
ZYRO0C09724g Chr3 (738113..739588) [1476 bp, 491 aa] {ON} simila...    42   0.004
KAFR0F04190 Chr6 (822926..824110) [1185 bp, 394 aa] {ON} Anc_3.5...    42   0.005
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    42   0.005
CAGL0A00561g Chr1 complement(63710..64948) [1239 bp, 412 aa] {ON...    42   0.005
NCAS0F02940 Chr6 complement(582657..584924) [2268 bp, 755 aa] {O...    43   0.005
SAKL0H22330g Chr8 complement(1943859..1945094) [1236 bp, 411 aa]...    42   0.005
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...    42   0.005
Kwal_27.12586 s27 (1290276..1291805) [1530 bp, 509 aa] {ON} YBR1...    42   0.005
TPHA0D02150 Chr4 complement(441410..443737) [2328 bp, 775 aa] {O...    43   0.005
AGR367C Chr7 complement(1408852..1411167) [2316 bp, 771 aa] {ON}...    43   0.005
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    42   0.005
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    42   0.005
ZYRO0G02618g Chr7 (201987..204629) [2643 bp, 880 aa] {ON} simila...    43   0.005
Ecym_4433 Chr4 complement(893223..894923) [1701 bp, 566 aa] {ON}...    42   0.006
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    42   0.006
KAFR0B05030 Chr2 (1040952..1041998) [1047 bp, 348 aa] {ON} Anc_2...    42   0.006
Skud_5.232 Chr5 complement(369506..370603) [1098 bp, 365 aa] {ON...    42   0.006
KNAG0A03450 Chr1 (439716..440648) [933 bp, 310 aa] {ON} Anc_8.58...    42   0.006
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    42   0.006
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    42   0.006
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...    42   0.006
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    42   0.006
KLLA0F13750g Chr6 complement(1274110..1275972) [1863 bp, 620 aa]...    42   0.006
CAGL0G03399g Chr7 complement(325879..326988) [1110 bp, 369 aa] {...    42   0.007
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    42   0.007
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    42   0.007
CAGL0G00704g Chr7 (65805..67127) [1323 bp, 440 aa] {ON} similar ...    42   0.007
Kwal_26.8953 s26 (1017811..1019187) [1377 bp, 458 aa] {ON} YOR26...    42   0.007
ZYRO0A03234g Chr1 (258942..260183) [1242 bp, 413 aa] {ON} simila...    42   0.007
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    42   0.008
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    42   0.008
TDEL0A01140 Chr1 complement(192604..194151) [1548 bp, 515 aa] {O...    42   0.008
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    42   0.008
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    42   0.008
ZYRO0D10516g Chr4 (883922..886171) [2250 bp, 749 aa] {ON} simila...    42   0.008
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    42   0.009
KNAG0J02560 Chr10 (482741..484294) [1554 bp, 517 aa] {ON} Anc_3....    42   0.009
Suva_11.210 Chr11 (387997..388986) [990 bp, 329 aa] {ON} YKL018W...    41   0.009
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    42   0.009
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    42   0.009
TDEL0C02650 Chr3 complement(460884..461978) [1095 bp, 364 aa] {O...    41   0.009
KLLA0A08800g Chr1 (770989..772308) [1320 bp, 439 aa] {ON} simila...    42   0.009
ZYRO0A08184g Chr1 (655686..656726) [1041 bp, 346 aa] {ON} highly...    41   0.010
Smik_11.237 Chr11 (391046..392035) [990 bp, 329 aa] {ON} YKL018W...    41   0.010
Skud_11.108 Chr11 (200902..203460) [2559 bp, 852 aa] {ON} YKL121...    42   0.010
NCAS0A07270 Chr1 complement(1442956..1445355) [2400 bp, 799 aa] ...    42   0.010
Skud_11.211 Chr11 (384964..385953) [990 bp, 329 aa] {ON} YKL018W...    41   0.010
YKL018W Chr11 (404102..405091) [990 bp, 329 aa] {ON}  SWD2Subuni...    41   0.010
Skud_2.302 Chr2 (549799..550803) [1005 bp, 334 aa] {ON} YBR175W ...    41   0.010
Kpol_1050.22 s1050 (54876..56171) [1296 bp, 431 aa] {ON} (54876....    41   0.010
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    41   0.010
TBLA0C03990 Chr3 (960225..961538) [1314 bp, 437 aa] {ON} Anc_4.1...    41   0.011
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    42   0.011
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    42   0.011
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    41   0.011
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    41   0.011
Skud_1.64 Chr1 (130376..131662) [1287 bp, 428 aa] {ON} YAR003W (...    41   0.011
TBLA0A09070 Chr1 complement(2236928..2238094) [1167 bp, 388 aa] ...    41   0.011
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    42   0.011
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    41   0.012
TBLA0B08980 Chr2 complement(2125687..2129208) [3522 bp, 1173 aa]...    42   0.012
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    41   0.013
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    41   0.013
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    41   0.013
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    41   0.013
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    41   0.013
NDAI0J01840 Chr10 (459174..460466) [1293 bp, 430 aa] {ON} Anc_4....    41   0.013
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    41   0.013
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    41   0.013
CAGL0F07337g Chr6 complement(714870..716735) [1866 bp, 621 aa] {...    41   0.013
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    41   0.013
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...    41   0.014
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    41   0.014
ABL043W Chr2 (314670..316490) [1821 bp, 606 aa] {ON} Syntenic ho...    41   0.015
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    41   0.016
Kwal_47.17572 s47 complement(461322..462626) [1305 bp, 434 aa] {...    41   0.016
KAFR0A05270 Chr1 complement(1043260..1044975) [1716 bp, 571 aa] ...    41   0.016
KAFR0G01170 Chr7 (265249..267603) [2355 bp, 784 aa] {ON} Anc_5.1...    41   0.016
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    41   0.017
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    40   0.017
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    41   0.017
NCAS0G01830 Chr7 complement(326874..328520) [1647 bp, 548 aa] {O...    41   0.018
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    40   0.018
TBLA0D04920 Chr4 complement(1202907..1204853) [1947 bp, 648 aa] ...    41   0.019
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    40   0.019
Kwal_34.15818 s34 (74248..75297) [1050 bp, 349 aa] {ON} YMR146C ...    40   0.019
KNAG0E02460 Chr5 complement(488247..490064) [1818 bp, 605 aa] {O...    40   0.019
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    40   0.020
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    40   0.021
TDEL0D03660 Chr4 (671946..673298) [1353 bp, 450 aa] {ON} Anc_3.2...    40   0.022
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    40   0.022
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    40   0.022
ZYRO0B03652g Chr2 complement(301728..302804) [1077 bp, 358 aa] {...    40   0.023
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    40   0.024
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    40   0.025
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    40   0.025
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    40   0.025
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    40   0.025
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    40   0.025
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    40   0.025
YER107C Chr5 complement(373448..374545) [1098 bp, 365 aa] {ON}  ...    40   0.026
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    40   0.026
KLTH0H15752g Chr8 complement(1359449..1360501) [1053 bp, 350 aa]...    40   0.026
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     40   0.026
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    40   0.026
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    40   0.026
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    40   0.027
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    40   0.027
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    40   0.028
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    40   0.029
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    40   0.029
TDEL0G03100 Chr7 (582165..583205) [1041 bp, 346 aa] {ON} Anc_2.3...    40   0.031
ZYRO0D00748g Chr4 (56274..57251) [978 bp, 325 aa] {ON} highly si...    40   0.031
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    40   0.032
TBLA0B08930 Chr2 complement(2117704..2119536) [1833 bp, 610 aa] ...    40   0.033
KLLA0F07403g Chr6 (697593..698636) [1044 bp, 347 aa] {ON} simila...    40   0.033
SAKL0G01760g Chr7 (147664..148656) [993 bp, 330 aa] {ON} highly ...    39   0.033
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    40   0.034
Suva_14.159 Chr14 complement(292113..293789) [1677 bp, 558 aa] {...    40   0.034
SAKL0E05368g Chr5 complement(444630..445679) [1050 bp, 349 aa] {...    39   0.034
YNL182C Chr14 complement(295960..297627) [1668 bp, 555 aa] {ON} ...    40   0.034
KLLA0D13222g Chr4 complement(1132067..1134277) [2211 bp, 736 aa]...    40   0.036
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    40   0.037
KLLA0A01650g Chr1 complement(146030..147235) [1206 bp, 401 aa] {...    39   0.039
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    40   0.039
Smik_5.253 Chr5 complement(382390..383487) [1098 bp, 365 aa] {ON...    39   0.039
NDAI0C04390 Chr3 complement(993861..996212) [2352 bp, 783 aa] {O...    40   0.041
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    40   0.041
TDEL0B07520 Chr2 complement(1320439..1321422) [984 bp, 327 aa] {...    39   0.042
CAGL0M02805g Chr13 (317204..319822) [2619 bp, 872 aa] {ON} simil...    40   0.043
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    40   0.045
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    39   0.045
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    39   0.046
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    40   0.047
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    39   0.047
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    40   0.047
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    40   0.048
YDR324C Chr4 complement(1114433..1116763) [2331 bp, 776 aa] {ON}...    39   0.048
KLTH0E06930g Chr5 (637945..639609) [1665 bp, 554 aa] {ON} simila...    39   0.048
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    39   0.049
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    39   0.050
ZYRO0G13596g Chr7 complement(1084499..1085908) [1410 bp, 469 aa]...    39   0.050
KLTH0G15620g Chr7 complement(1363249..1366056) [2808 bp, 935 aa]...    39   0.050
CAGL0J07854g Chr10 complement(767587..768885) [1299 bp, 432 aa] ...    39   0.051
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    39   0.051
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    39   0.052
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    39   0.052
KLTH0B07040g Chr2 (567756..569276) [1521 bp, 506 aa] {ON} simila...    39   0.055
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    39   0.057
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    39   0.057
TBLA0I00360 Chr9 (56206..57300) [1095 bp, 364 aa] {ON} Anc_7.405...    39   0.057
ZYRO0F16104g Chr6 complement(1322975..1324183) [1209 bp, 402 aa]...    39   0.059
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    39   0.059
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    39   0.061
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    39   0.062
Ecym_8020 Chr8 (52179..53834) [1656 bp, 551 aa] {ON} similar to ...    39   0.062
KNAG0G00800 Chr7 (147792..150164) [2373 bp, 790 aa] {ON} Anc_5.1...    39   0.062
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    39   0.063
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    39   0.065
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    39   0.066
Ecym_2695 Chr2 complement(1343162..1344724) [1563 bp, 520 aa] {O...    39   0.066
KLTH0B04136g Chr2 complement(335902..338352) [2451 bp, 816 aa] {...    39   0.069
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    39   0.069
Kwal_33.14971 s33 (896070..898526) [2457 bp, 818 aa] {ON} YMR049...    39   0.069
Skud_4.592 Chr4 complement(1050634..1052892) [2259 bp, 752 aa] {...    39   0.070
TPHA0D04170 Chr4 (894124..895845) [1722 bp, 573 aa] {ON} Anc_3.4...    39   0.071
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    39   0.075
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    39   0.075
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    39   0.075
Kwal_55.21144 s55 (703153..704865) [1713 bp, 570 aa] {ON} YPR137...    39   0.077
Skud_14.152 Chr14 complement(286929..288704) [1776 bp, 591 aa] {...    39   0.077
AER439W Chr5 (1476148..1476150,1476201..1477442) [1245 bp, 414 a...    39   0.079
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    39   0.082
Kwal_27.10785 s27 (495263..496366) [1104 bp, 367 aa] {ON} YER107...    38   0.082
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    39   0.082
KLLA0C09262g Chr3 (805512..807188) [1677 bp, 558 aa] {ON} highly...    39   0.084
KLTH0E08184g Chr5 complement(751459..752772) [1314 bp, 437 aa] {...    39   0.084
Suva_2.495 Chr2 complement(871929..874187) [2259 bp, 752 aa] {ON...    39   0.084
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    39   0.085
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    39   0.085
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    39   0.088
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    39   0.090
Kpol_262.1 s262 (224..2131) [1908 bp, 635 aa] {ON} (224..2131) [...    39   0.092
AFL006C Chr6 complement(425925..427226) [1302 bp, 433 aa] {ON} S...    38   0.092
KLTH0E03872g Chr5 (353271..355511) [2241 bp, 746 aa] {ON} simila...    39   0.092
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    38   0.093
NCAS0F02050 Chr6 complement(409352..413923) [4572 bp, 1523 aa] {...    39   0.095
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    39   0.096
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    39   0.10 
ZYRO0F00616g Chr6 (54556..56964) [2409 bp, 802 aa] {ON} similar ...    39   0.10 
Ecym_2240 Chr2 (470406..473900) [3495 bp, 1164 aa] {ON} similar ...    39   0.10 
KLTH0H01518g Chr8 (138469..139353) [885 bp, 294 aa] {ON} highly ...    38   0.10 
KLTH0C06358g Chr3 (556638..557741) [1104 bp, 367 aa] {ON} highly...    38   0.11 
CAGL0L04950g Chr12 complement(564488..566905) [2418 bp, 805 aa] ...    38   0.11 
KNAG0H00220 Chr8 (32961..33944) [984 bp, 327 aa] {ON} Anc_2.657 ...    38   0.11 
TDEL0B07060 Chr2 complement(1243893..1246289) [2397 bp, 798 aa] ...    38   0.11 
KLTH0F14344g Chr6 (1177844..1179556) [1713 bp, 570 aa] {ON} high...    38   0.11 
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    38   0.11 
Skud_15.66 Chr15 complement(114566..117898) [3333 bp, 1110 aa] {...    38   0.11 
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    38   0.12 
NCAS0A01850 Chr1 complement(356138..358243) [2106 bp, 701 aa] {O...    38   0.12 
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    38   0.13 
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    38   0.13 
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...    38   0.13 
Smik_14.148 Chr14 complement(275170..276837) [1668 bp, 555 aa] {...    38   0.13 
YAR003W Chr1 (155005..156285) [1281 bp, 426 aa] {ON}  SWD1Subuni...    38   0.13 
Kpol_1044.27 s1044 complement(63632..65197) [1566 bp, 521 aa] {O...    38   0.13 
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    38   0.14 
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    38   0.14 
TDEL0E02620 Chr5 (508356..510593) [2238 bp, 745 aa] {ON} Anc_5.3...    38   0.14 
TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {O...    38   0.14 
NCAS0A00740 Chr1 (143564..144946) [1383 bp, 460 aa] {ON} Anc_1.1...    38   0.14 
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    38   0.14 
Kwal_27.10385 s27 (317980..319590) [1611 bp, 536 aa] {ON} YML102...    38   0.15 
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    38   0.15 
TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa] ...    38   0.15 
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    38   0.15 
Suva_5.228 Chr5 complement(347755..348852) [1098 bp, 365 aa] {ON...    37   0.15 
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    38   0.15 
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    37   0.15 
TBLA0C00970 Chr3 complement(193861..194844) [984 bp, 327 aa] {ON...    37   0.15 
ZYRO0F11374g Chr6 complement(934451..935983) [1533 bp, 510 aa] {...    38   0.16 
KLLA0D08371g Chr4 (710885..712411) [1527 bp, 508 aa] {ON} simila...    38   0.16 
TPHA0N01540 Chr14 complement(335055..337412) [2358 bp, 785 aa] {...    38   0.16 
ABL141C Chr2 complement(131670..133226) [1557 bp, 518 aa] {ON} S...    38   0.16 
TPHA0O01610 Chr15 (319614..321224) [1611 bp, 536 aa] {ON} Anc_2....    38   0.16 
ACL099W Chr3 (165316..166389) [1074 bp, 357 aa] {ON} Syntenic ho...    37   0.16 
SAKL0F03432g Chr6 complement(274302..276029) [1728 bp, 575 aa] {...    37   0.17 
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    37   0.17 
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    38   0.17 
Kpol_387.7 s387 (15235..16893) [1659 bp, 552 aa] {ON} (15235..16...    37   0.18 
Suva_1.74 Chr1 (131924..133210) [1287 bp, 428 aa] {ON} YAR003W (...    37   0.18 
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    37   0.18 
TPHA0M00700 Chr13 complement(132140..135313) [3174 bp, 1057 aa] ...    38   0.19 
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    37   0.19 
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    37   0.20 
TBLA0I03300 Chr9 (802032..803279) [1248 bp, 415 aa] {ON} Anc_3.5...    37   0.20 
AAR102C Chr1 complement(526057..527832) [1776 bp, 591 aa] {ON} S...    37   0.21 
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    37   0.21 
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    37   0.23 
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    37   0.23 
NDAI0A03090 Chr1 (692473..694143) [1671 bp, 556 aa] {ON} Anc_7.2...    37   0.23 
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    37   0.23 
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    37   0.23 
Kwal_14.906 s14 (105782..106768) [987 bp, 328 aa] {ON} YKL018W (...    37   0.23 
Smik_1.70 Chr1 (138173..139459) [1287 bp, 428 aa] {ON} YAR003W (...    37   0.24 
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    37   0.24 
Kpol_2002.54 s2002 complement(118705..125166) [6462 bp, 2153 aa]...    37   0.24 
TPHA0O01210 Chr15 complement(238057..239778) [1722 bp, 573 aa] {...    37   0.25 
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    37   0.25 
KNAG0I01650 Chr9 (324016..325590) [1575 bp, 524 aa] {ON} Anc_1.3...    37   0.26 
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    37   0.26 
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    37   0.26 
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    37   0.26 
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    37   0.26 
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    37   0.27 
SAKL0E12892g Chr5 (1062422..1064002) [1581 bp, 526 aa] {ON} simi...    37   0.27 
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    37   0.27 
ADL054W Chr4 (586898..588772) [1875 bp, 624 aa] {ON} Syntenic ho...    37   0.28 
Ecym_8393 Chr8 complement(805739..807394) [1656 bp, 551 aa] {ON}...    37   0.28 
TDEL0D05080 Chr4 (924017..927007) [2991 bp, 996 aa] {ON} Anc_3.1...    37   0.28 
NCAS0E00530 Chr5 (89654..90853) [1200 bp, 399 aa] {ON} Anc_3.526...    37   0.30 
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    37   0.31 
KLLA0F26653g Chr6 (2461876..2464251) [2376 bp, 791 aa] {ON} simi...    37   0.31 
TPHA0J01070 Chr10 complement(249880..251535) [1656 bp, 551 aa] {...    37   0.32 
Ecym_6170 Chr6 complement(316353..317675) [1323 bp, 440 aa] {ON}...    37   0.33 
TDEL0C05940 Chr3 complement(1070975..1072264) [1290 bp, 429 aa] ...    37   0.33 
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    37   0.33 
Smik_15.69 Chr15 complement(118407..121760) [3354 bp, 1117 aa] {...    37   0.34 
Kpol_1061.35 s1061 (98864..100180) [1317 bp, 438 aa] {ON} (98864...    36   0.35 
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    37   0.35 
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...    36   0.36 
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    36   0.36 
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    37   0.36 
TDEL0H01690 Chr8 (289748..291382) [1635 bp, 544 aa] {ON} Anc_7.2...    36   0.37 
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    37   0.38 
Smik_5.221 Chr5 complement(332843..334507) [1665 bp, 554 aa] {ON...    36   0.38 
Kpol_1050.100 s1050 (228171..229895) [1725 bp, 574 aa] {ON} (228...    36   0.39 
YFR021W Chr6 (194812..196314) [1503 bp, 500 aa] {ON}  ATG18Phosp...    36   0.40 
TPHA0F00760 Chr6 (173015..174415) [1401 bp, 466 aa] {ON} Anc_4.1...    36   0.41 
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    36   0.42 
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    37   0.42 
KLLA0B11077g Chr2 complement(970761..972464) [1704 bp, 567 aa] {...    36   0.43 
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    37   0.43 
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...    36   0.44 
KLLA0C06633g Chr3 (580349..582244) [1896 bp, 631 aa] {ON} simila...    36   0.44 
Skud_13.205 Chr13 complement(349265..351682) [2418 bp, 805 aa] {...    36   0.45 
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    36   0.45 
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    36   0.45 
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    36   0.46 
Kpol_1057.7 s1057 complement(16034..17017) [984 bp, 327 aa] {ON}...    36   0.46 
KAFR0A07550 Chr1 (1523221..1524804) [1584 bp, 527 aa] {ON} Anc_2...    36   0.47 
KLLA0D04664g Chr4 (397818..399320) [1503 bp, 500 aa] {ON} simila...    36   0.47 
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    36   0.48 
Smik_13.219 Chr13 complement(356393..358813) [2421 bp, 806 aa] {...    36   0.49 
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    36   0.50 
KLTH0F01452g Chr6 complement(109643..110863) [1221 bp, 406 aa] {...    36   0.51 
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    36   0.52 
Ecym_1499 Chr1 complement(1025285..1027051) [1767 bp, 588 aa] {O...    36   0.52 
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    36   0.53 
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    36   0.54 
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    36   0.54 
Kpol_401.8 s401 (21214..22521) [1308 bp, 435 aa] {ON} (21214..22...    36   0.55 
ZYRO0E08602g Chr5 (687971..689242) [1272 bp, 423 aa] {ON} simila...    36   0.55 
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    36   0.55 
NDAI0A04540 Chr1 complement(1023305..1025011) [1707 bp, 568 aa] ...    36   0.56 
KLTH0C00748g Chr3 (72171..73157) [987 bp, 328 aa] {ON} highly si...    35   0.56 
KAFR0L01120 Chr12 complement(211027..212679) [1653 bp, 550 aa] {...    36   0.58 
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    35   0.59 
Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {O...    36   0.64 
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    36   0.65 
KLTH0F01166g Chr6 (90708..92939) [2232 bp, 743 aa] {ON} similar ...    36   0.65 
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    35   0.67 
KAFR0C01310 Chr3 (268850..271888) [3039 bp, 1012 aa] {ON} Anc_3....    36   0.68 
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    35   0.68 
NDAI0F03380 Chr6 (813767..815455) [1689 bp, 562 aa] {ON} Anc_2.7...    35   0.69 
KNAG0B00550 Chr2 complement(90327..91658) [1332 bp, 443 aa] {ON}...    35   0.74 
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    35   0.74 
TPHA0N01800 Chr14 complement(386979..387968) [990 bp, 329 aa] {O...    35   0.74 
ZYRO0B04444g Chr2 complement(363742..365469) [1728 bp, 575 aa] {...    35   0.75 
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    35   0.76 
AFR715C Chr6 complement(1753288..1755438) [2151 bp, 716 aa] {ON}...    35   0.78 
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    35   0.81 
KLTH0G18348g Chr7 (1581039..1582844) [1806 bp, 601 aa] {ON} simi...    35   0.86 
KAFR0C04130 Chr3 (825105..827501) [2397 bp, 798 aa] {ON} Anc_2.6...    35   0.86 
Suva_6.93 Chr6 (160006..161508) [1503 bp, 500 aa] {ON} YFR021W (...    35   0.87 
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    35   0.88 
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    35   0.90 
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    35   0.90 
Suva_5.195 Chr5 complement(298871..300550) [1680 bp, 559 aa] {ON...    35   0.90 
Kpol_1018.103 s1018 complement(268887..269966) [1080 bp, 359 aa]...    35   0.91 
KLTH0G01650g Chr7 complement(121279..122466,122554..122556) [119...    35   0.93 
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    35   0.93 
Kwal_56.23207 s56 (446947..449748) [2802 bp, 933 aa] {ON} YOL087...    35   0.94 
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    35   0.94 
TPHA0I01180 Chr9 (274330..276999) [2670 bp, 889 aa] {ON} Anc_1.3...    35   0.95 
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    35   0.98 
TDEL0D05940 Chr4 (1076418..1077710) [1293 bp, 430 aa] {ON} Anc_3...    35   1.00 
Suva_13.43 Chr13 (68221..68556,68574..69404) [1167 bp, 388 aa] {...    35   1.0  
KLLA0E20703g Chr5 complement(1841092..1842207) [1116 bp, 371 aa]...    35   1.0  
KLLA0B07667g Chr2 (667863..673862) [6000 bp, 1999 aa] {ON} some ...    35   1.0  
CAGL0J10340g Chr10 complement(1010761..1011777) [1017 bp, 338 aa...    35   1.0  
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    35   1.1  
KLLA0F16038g Chr6 complement(1487475..1490063) [2589 bp, 862 aa]...    35   1.1  
AER280C Chr5 complement(1148956..1150488) [1533 bp, 510 aa] {ON}...    35   1.1  
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    35   1.1  
KAFR0C04445 Chr3 (882595..884274) [1680 bp, 559 aa] {ON}               35   1.1  
TDEL0C06690 Chr3 complement(1221419..1223716) [2298 bp, 765 aa] ...    35   1.1  
YKL121W Chr11 (214142..216700) [2559 bp, 852 aa] {ON}  DGR2Prote...    35   1.1  
KLLA0F21076g Chr6 (1966373..1969036) [2664 bp, 887 aa] {ON} weak...    35   1.1  
Skud_4.423 Chr4 (754186..755523) [1338 bp, 445 aa] {ON} YDR165W ...    35   1.1  
Kpol_2002.33 s2002 (67641..69998) [2358 bp, 785 aa] {ON} (67641....    35   1.1  
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    35   1.2  
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    35   1.2  
NCAS0A10500 Chr1 complement(2087347..2088783) [1437 bp, 478 aa] ...    35   1.2  
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    35   1.2  
KLLA0E18877g Chr5 complement(1676876..1680310) [3435 bp, 1144 aa...    35   1.2  
YNL253W Chr14 (170018..171286) [1269 bp, 422 aa] {ON}  TEX1Prote...    35   1.3  
NCAS0D00540 Chr4 complement(85322..86953) [1632 bp, 543 aa] {ON}...    35   1.3  
KNAG0F01250 Chr6 complement(226031..227653) [1623 bp, 540 aa] {O...    35   1.3  
CAGL0J03344g Chr10 complement(324829..326460) [1632 bp, 543 aa] ...    35   1.3  
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    35   1.3  
NDAI0C00390 Chr3 complement(63036..65537) [2502 bp, 833 aa] {ON}...    35   1.3  
Skud_6.105 Chr6 (190549..192051) [1503 bp, 500 aa] {ON} YFR021W ...    35   1.3  
Suva_11.103 Chr11 (200612..203182) [2571 bp, 856 aa] {ON} YKL121...    35   1.4  
KAFR0G01090 Chr7 complement(247902..250883) [2982 bp, 993 aa] {O...    35   1.4  
Ecym_5599 Chr5 complement(1220881..1221930) [1050 bp, 349 aa] {O...    34   1.4  
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    35   1.4  
TBLA0C05340 Chr3 complement(1293851..1295560) [1710 bp, 569 aa] ...    35   1.4  
KLTH0D10054g Chr4 complement(835206..837818) [2613 bp, 870 aa] {...    35   1.4  
NCAS0H03450 Chr8 complement(653985..654968) [984 bp, 327 aa] {ON...    34   1.4  
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    34   1.4  
SAKL0F09504g Chr6 complement(728890..730611) [1722 bp, 573 aa] {...    35   1.5  
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    34   1.5  
NDAI0A00750 Chr1 complement(144773..151225) [6453 bp, 2150 aa] {...    35   1.5  
Suva_2.329 Chr2 (578891..580228) [1338 bp, 445 aa] {ON} YDR165W ...    34   1.5  
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    34   1.5  
SAKL0H22418g Chr8 complement(1951429..1952724) [1296 bp, 431 aa]...    34   1.5  
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    34   1.5  
NCAS0E03500 Chr5 complement(694491..696143) [1653 bp, 550 aa] {O...    34   1.6  
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    35   1.6  
Suva_7.435 Chr7 (752189..754315) [2127 bp, 708 aa] {ON} YGR145W ...    34   1.6  
TBLA0B04120 Chr2 (941318..943987) [2670 bp, 889 aa] {ON} Anc_8.6...    35   1.6  
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    34   1.6  
TDEL0F02220 Chr6 (406232..407542) [1311 bp, 436 aa] {ON} Anc_4.1...    34   1.6  
NDAI0C00230 Chr3 (35404..36426) [1023 bp, 340 aa] {ON} Anc_2.657...    34   1.7  
TPHA0F00520 Chr6 (121962..124103) [2142 bp, 713 aa] {ON} Anc_4.7...    34   1.7  
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    34   1.7  
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    34   1.8  
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    34   1.8  
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    34   1.8  
YPR137W Chr16 (802359..804080) [1722 bp, 573 aa] {ON}  RRP9Prote...    34   1.8  
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    34   1.8  
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    34   1.8  
TDEL0F03590 Chr6 (659038..660756) [1719 bp, 572 aa] {ON} Anc_3.4...    34   1.9  
Kwal_33.14449 s33 complement(675978..677504) [1527 bp, 508 aa] {...    34   1.9  
NCAS0A07160 Chr1 complement(1419393..1420385) [993 bp, 330 aa] {...    34   1.9  
NDAI0B01710 Chr2 (407575..408939) [1365 bp, 454 aa] {ON} Anc_7.1...    34   1.9  
ZYRO0C08976g Chr3 complement(684862..686514) [1653 bp, 550 aa] {...    34   1.9  
Ecym_2075 Chr2 (127773..129054,129182..129780) [1881 bp, 626 aa]...    34   2.0  
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    34   2.0  
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    34   2.0  
Kpol_1072.46 s1072 (103226..105850) [2625 bp, 874 aa] {ON} (1032...    34   2.0  
Kpol_1055.2 s1055 complement(663..2915) [2253 bp, 750 aa] {ON} c...    34   2.1  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    34   2.1  
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    34   2.1  
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    34   2.1  
Skud_14.85 Chr14 (158809..160077) [1269 bp, 422 aa] {ON} YNL253W...    34   2.2  
TBLA0B02480 Chr2 complement(569751..571400) [1650 bp, 549 aa] {O...    34   2.2  
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    33   2.2  
NDAI0A05790 Chr1 (1315884..1317374) [1491 bp, 496 aa] {ON}             34   2.2  
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    34   2.2  
Skud_12.121 Chr12 complement(236234..238000) [1767 bp, 588 aa] {...    34   2.2  
KNAG0C00410 Chr3 (69301..71367) [2067 bp, 688 aa] {ON} Anc_1.34 ...    34   2.3  
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    34   2.3  
Smik_16.383 Chr16 (679641..681362) [1722 bp, 573 aa] {ON} YPR137...    34   2.3  
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    34   2.3  
TBLA0E03460 Chr5 (859536..863192) [3657 bp, 1218 aa] {ON} Anc_3....    34   2.3  
Suva_16.464 Chr16 (804728..806449) [1722 bp, 573 aa] {ON} YPR137...    34   2.3  
SAKL0G19536g Chr7 complement(1683650..1684636) [987 bp, 328 aa] ...    33   2.4  
Kwal_23.5962 s23 complement(1391198..1392856) [1659 bp, 552 aa] ...    34   2.4  
SAKL0G01694g Chr7 (142556..145099) [2544 bp, 847 aa] {ON} simila...    34   2.4  
Suva_16.415 Chr16 complement(715808..717157) [1350 bp, 449 aa] {...    33   2.4  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    34   2.4  
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    33   2.5  
Kwal_47.17093 s47 complement(245346..246860) [1515 bp, 504 aa] {...    33   2.5  
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    34   2.6  
Suva_15.79 Chr15 complement(128494..131850) [3357 bp, 1118 aa] {...    34   2.6  
Kwal_14.1235 s14 complement(247700..249523) [1824 bp, 607 aa] {O...    33   2.6  
KNAG0A07760 Chr1 complement(1232666..1234366) [1701 bp, 566 aa] ...    33   2.6  
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    34   2.6  
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    33   2.7  
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    34   2.7  
SAKL0D09504g Chr4 (792974..794599) [1626 bp, 541 aa] {ON} highly...    33   2.7  
KAFR0D00320 Chr4 (46078..48531) [2454 bp, 817 aa] {ON} Anc_1.34 ...    33   2.8  
Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W ...    33   2.8  
KNAG0H00450 Chr8 (70320..72755) [2436 bp, 811 aa] {ON} Anc_2.613...    33   2.9  
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    33   2.9  
CAGL0H08217g Chr8 complement(806660..807637) [978 bp, 325 aa] {O...    33   2.9  
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...    33   2.9  
KNAG0C05420 Chr3 (1059879..1062236) [2358 bp, 785 aa] {ON} Anc_5...    33   2.9  
Skud_5.201 Chr5 complement(318460..320142) [1683 bp, 560 aa] {ON...    33   2.9  
TPHA0J02880 Chr10 (639057..640961) [1905 bp, 634 aa] {ON} Anc_5....    33   3.0  
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    33   3.0  
KLLA0A07106g Chr1 complement(640536..641468) [933 bp, 310 aa] {O...    33   3.0  
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    33   3.1  
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...    33   3.1  
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    33   3.1  
KLTH0H11000g Chr8 complement(943669..946260) [2592 bp, 863 aa] {...    33   3.1  
KLLA0F08811g Chr6 complement(819834..821744) [1911 bp, 636 aa] {...    33   3.1  
KLTH0A05082g Chr1 complement(424327..425985) [1659 bp, 552 aa] {...    33   3.1  
TBLA0D01190 Chr4 complement(301525..302820) [1296 bp, 431 aa] {O...    33   3.1  
ACL034W Chr3 (302396..304048) [1653 bp, 550 aa] {ON} Syntenic ho...    33   3.2  
NCAS0A11750 Chr1 (2335605..2337320) [1716 bp, 571 aa] {ON} Anc_3...    33   3.3  
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    33   3.3  
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    33   3.3  
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    33   3.6  
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    33   3.6  
CAGL0L08140g Chr12 (894198..900467) [6270 bp, 2089 aa] {ON} simi...    33   3.6  
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    33   3.6  
TDEL0F02720 Chr6 complement(498279..500363) [2085 bp, 694 aa] {O...    33   3.7  
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    33   3.7  
KAFR0C02420 Chr3 (471045..472484) [1440 bp, 479 aa] {ON} Anc_1.3...    33   3.7  
Kwal_47.19083 s47 (1089260..1090234) [975 bp, 324 aa] {ON} YGL21...    33   3.8  
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...    33   3.8  
NDAI0E02310 Chr5 (477468..478811) [1344 bp, 447 aa] {ON}               33   3.9  
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    33   4.0  
Smik_4.386 Chr4 complement(701174..702304) [1131 bp, 376 aa] {ON...    33   4.0  
YER082C Chr5 complement(324272..325936) [1665 bp, 554 aa] {ON}  ...    33   4.0  
NDAI0I01360 Chr9 complement(331085..332122) [1038 bp, 345 aa] {O...    33   4.1  
AFR153W Chr6 (711168..712898) [1731 bp, 576 aa] {ON} Syntenic ho...    33   4.1  
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    33   4.1  
Kwal_YGOB_27.12717 s27 (1347453..1348746,1348819..1349414) [1890...    33   4.1  
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    33   4.1  
CAGL0L09757g Chr12 complement(1048895..1049875) [981 bp, 326 aa]...    33   4.2  
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    33   4.2  
YOL087C Chr15 complement(155287..158637) [3351 bp, 1116 aa] {ON}...    33   4.3  
KNAG0A07390 Chr1 complement(1156310..1157542) [1233 bp, 410 aa] ...    33   4.4  
ZYRO0F17842g Chr6 complement(1477727..1480000) [2274 bp, 757 aa]...    33   4.4  
KLLA0E11177g Chr5 (983669..985150) [1482 bp, 493 aa] {ON} simila...    33   4.4  
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    33   4.5  
KNAG0F02190 Chr6 (418793..422137) [3345 bp, 1114 aa] {ON} Anc_6....    33   4.6  
Smik_8.275 Chr8 complement(450898..455568) [4671 bp, 1556 aa] {O...    33   4.6  
KAFR0B01580 Chr2 (298942..303528) [4587 bp, 1528 aa] {ON} Anc_5....    33   4.6  
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    33   4.7  
Skud_16.427 Chr16 (761681..763402) [1722 bp, 573 aa] {ON} YPR137...    33   4.8  
TBLA0B04670 Chr2 (1088358..1089392) [1035 bp, 344 aa] {ON} Anc_6...    33   4.8  
YHR186C Chr8 complement(475999..480672) [4674 bp, 1557 aa] {ON} ...    33   4.9  
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    33   5.0  
ZYRO0G20988g Chr7 complement(1723533..1726193) [2661 bp, 886 aa]...    33   5.1  
Smik_2.423 Chr2 complement(750642..753278) [2637 bp, 878 aa] {ON...    33   5.2  
Ecym_1039 Chr1 (72890..75073) [2184 bp, 727 aa] {ON} similar to ...    33   5.3  
Skud_3.23 Chr3 (40457..42805) [2349 bp, 782 aa] {ON} YCL039W (REAL)    33   5.3  
Kwal_26.8604 s26 complement(859891..862494) [2604 bp, 867 aa] {O...    33   5.3  
YDR030C Chr4 complement(501753..503273) [1521 bp, 506 aa] {ON}  ...    33   5.4  
NDAI0H03610 Chr8 (887848..889410) [1563 bp, 520 aa] {ON} Anc_1.359     33   5.5  
KLLA0F06754g Chr6 complement(650475..651509) [1035 bp, 344 aa] {...    32   5.5  
SAKL0C01188g Chr3 (104624..106948) [2325 bp, 774 aa] {ON} simila...    33   5.5  
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    33   5.5  
Suva_15.389 Chr15 complement(680068..684735) [4668 bp, 1555 aa] ...    33   5.7  
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...    32   5.8  
CAGL0J11286g Chr10 (1097912..1099498) [1587 bp, 528 aa] {ON} sim...    32   5.9  
TBLA0J01290 Chr10 (294789..296456) [1668 bp, 555 aa] {ON} Anc_7....    32   6.0  
KNAG0F02280 Chr6 complement(432897..433967) [1071 bp, 356 aa] {O...    32   6.0  
KLLA0C18491g Chr3 (1632791..1636387) [3597 bp, 1198 aa] {ON} sim...    33   6.1  
Suva_10.139 Chr10 complement(252982..254748) [1767 bp, 588 aa] {...    32   6.3  
KNAG0B03930 Chr2 complement(756034..757881) [1848 bp, 615 aa] {O...    32   6.4  
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     32   6.5  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    32   6.6  
Smik_12.117 Chr12 complement(232159..233895) [1737 bp, 578 aa] {...    32   6.7  
KAFR0H00750 Chr8 (140330..141574) [1245 bp, 414 aa] {ON} Anc_3.3...    32   7.2  
Skud_8.252 Chr8 complement(444916..449586) [4671 bp, 1556 aa] {O...    32   7.2  
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...    32   7.2  
TPHA0G01890 Chr7 (392062..394737) [2676 bp, 891 aa] {ON} Anc_8.6...    32   7.3  
CAGL0D04884g Chr4 (475678..477369) [1692 bp, 563 aa] {ON} highly...    32   7.3  
KNAG0D03740 Chr4 complement(680549..682639) [2091 bp, 696 aa] {O...    32   7.4  
TPHA0N01070 Chr14 complement(224464..225525) [1062 bp, 353 aa] {...    32   7.5  
YBR281C Chr2 complement(764970..767606) [2637 bp, 878 aa] {ON}  ...    32   7.6  
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    32   7.7  
KNAG0F03800 Chr6 (723847..725154) [1308 bp, 435 aa] {ON} Anc_7.5...    32   7.8  
KAFR0F03630 Chr6 complement(718854..720935) [2082 bp, 693 aa] {O...    32   7.9  
KLTH0C01848g Chr3 complement(165526..166121,166518..167517) [159...    32   8.0  
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    32   8.1  
SAKL0H24530g Chr8 complement(2127253..2128998) [1746 bp, 581 aa]...    32   8.1  
KLLA0A04653g Chr1 complement(417313..419415) [2103 bp, 700 aa] {...    32   8.1  
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    32   8.2  
CAGL0J03564g Chr10 (340647..343736) [3090 bp, 1029 aa] {ON} simi...    32   8.2  
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    32   8.3  
CAGL0M01430g Chr13 (164428..166683) [2256 bp, 751 aa] {ON} highl...    32   8.7  
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    32   9.1  
NCAS0D03490 Chr4 (650325..651362) [1038 bp, 345 aa] {ON} Anc_6.159     32   9.1  
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    32   9.2  
SAKL0H07832g Chr8 (669398..671995) [2598 bp, 865 aa] {ON} simila...    32   9.4  
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    32   9.6  
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    32   9.6  
SAKL0G07040g Chr7 (577213..578250) [1038 bp, 345 aa] {ON} simila...    32   9.7  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    32   9.8  
AFR634W Chr6 (1594214..1595686) [1473 bp, 490 aa] {ON} Syntenic ...    32   9.8  
NDAI0D03780 Chr4 complement(895256..897379) [2124 bp, 707 aa] {O...    32   9.8  
KLTH0H09130g Chr8 (783260..785347) [2088 bp, 695 aa] {ON} simila...    32   10.0 

>TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.324
           YLR129W
          Length = 936

 Score = 1839 bits (4764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 905/936 (96%), Positives = 905/936 (96%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXXXLGKVITGALENISVWDLKTSELEYV 60
           MVKSYQRFEQSSVFGVISSNSNCVWVPP       LGKVITGALENISVWDLKTSELEYV
Sbjct: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPSSKKSKSLGKVITGALENISVWDLKTSELEYV 60

Query: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120
           LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS
Sbjct: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120

Query: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK 180
           RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK
Sbjct: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK 180

Query: 181 DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240
           DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI
Sbjct: 181 DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240

Query: 241 EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT 300
           EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT
Sbjct: 241 EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT 300

Query: 301 EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY 360
           EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY
Sbjct: 301 EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY 360

Query: 361 YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC 420
           YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC
Sbjct: 361 YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC 420

Query: 421 IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480
           IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND
Sbjct: 421 IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480

Query: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540
           GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK
Sbjct: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540

Query: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF 600
           FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF
Sbjct: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF 600

Query: 601 GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA 660
           GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA
Sbjct: 601 GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA 660

Query: 661 VSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADDTFKG 720
           VSDNGERVVSVSHDHSIRIWEETDDQVFL             DTLLASLEEGNADDTFKG
Sbjct: 661 VSDNGERVVSVSHDHSIRIWEETDDQVFLEEEREKELEEQYEDTLLASLEEGNADDTFKG 720

Query: 721 DVKNDEDDEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQRIDAP 780
           DVKNDEDDEATRVSKQTIESLKAGERLMDALDLGIK           MVKYKKKQRIDAP
Sbjct: 721 DVKNDEDDEATRVSKQTIESLKAGERLMDALDLGIKEIEEMENYEAEMVKYKKKQRIDAP 780

Query: 781 VKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMKVPNI 840
           VKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMKVPNI
Sbjct: 781 VKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMKVPNI 840

Query: 841 LNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFNIQGL 900
           LNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFNIQGL
Sbjct: 841 LNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFNIQGL 900

Query: 901 KFIKQQWNMKHNFEFVDDYDQQAQAEKSAKKEYSVP 936
           KFIKQQWNMKHNFEFVDDYDQQAQAEKSAKKEYSVP
Sbjct: 901 KFIKQQWNMKHNFEFVDDYDQQAQAEKSAKKEYSVP 936

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 1381 bits (3574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 661/949 (69%), Positives = 788/949 (83%), Gaps = 18/949 (1%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXXXLGKVITGALENISVWDLKTSELEYV 60
           MVKSYQRFEQ+SVFGVISSNSNCVW+P         G++ITGALEN+++WDLKT EL   
Sbjct: 28  MVKSYQRFEQASVFGVISSNSNCVWLPSTSSKKSHPGQIITGALENVNIWDLKTGELASF 87

Query: 61  LSDGL--PPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGH 118
           L+DGL  PPGSVD KSSKPAE ++LQ H ET L+A GY DGV+K+WDL SKTVL + NGH
Sbjct: 88  LNDGLVPPPGSVDAKSSKPAETTFLQHHKETNLLAVGYNDGVVKVWDLYSKTVLCNLNGH 147

Query: 119 KSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCD--SDN--- 173
            S IT LKFD +GT+LISGS DSNIIVWDLVSEVGLYKLRSHK  ITG+WC+  ++N   
Sbjct: 148 SSAITALKFDTSGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEVTNNNQE 207

Query: 174 -----WLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQ 228
                WLISTSKDGLIK+WDLK QQC+ETHIAHTGECW+L +  D V+T+S+DSQ+K WQ
Sbjct: 208 ENELDWLISTSKDGLIKIWDLKIQQCVETHIAHTGECWSLAVRNDLVITTSSDSQVKFWQ 267

Query: 229 MDLEGEP---GSKLIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKD 285
           + L+ +    GSKLIEKG +EKQSKQRGL++EF  + DGV FF +QNAD+TVEIFRLRK+
Sbjct: 268 LSLQDDTVPNGSKLIEKGIYEKQSKQRGLNVEFIDSIDGVGFFLIQNADRTVEIFRLRKE 327

Query: 286 IEIAKAIKRREKRLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLST 345
            EI+KA+K+REKRLTEKGMT ++IK ++ +S+VS +MHPFQ++RS+YK+K+  WT++ ST
Sbjct: 328 EEISKALKKREKRLTEKGMTPDEIKKSLEDSFVSMMMHPFQIIRSIYKVKAATWTIATST 387

Query: 346 KLEVVVTTNSNTIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATA 405
           KLE+ VTT +NTIEYYS+PYEKR+PT P   K + +ELQG RTD+RSIDISDDN LLATA
Sbjct: 388 KLELTVTTANNTIEYYSIPYEKREPTQPIANKLYNVELQGQRTDIRSIDISDDNKLLATA 447

Query: 406 SNGELKIWNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIE 465
           SNG LKIWNL TK CIRTFECGYALTCKFLPGG+LV++GTR G LQLFDLASS  +  IE
Sbjct: 448 SNGSLKIWNLKTKLCIRTFECGYALTCKFLPGGMLVIIGTRAGELQLFDLASSTQIANIE 507

Query: 466 AAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLE 525
            AH+ AIWSLD+T+DGKRL+TGSADKS+KFW+FQ++QEL+ GTSDK+VP++ + HD+TLE
Sbjct: 508 EAHDAAIWSLDLTSDGKRLITGSADKSVKFWNFQLEQELVPGTSDKFVPKLGLHHDTTLE 567

Query: 526 LGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVII 585
           L DDILS+++S +DKFLA+SLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS D+K+II
Sbjct: 568 LSDDILSVRVSPEDKFLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKMII 627

Query: 586 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFEC 645
           TSSADKNIKIWGLDFGDCHKSLFAHQDSIM VKF+P SHNFFS SKDG +KYWDGDKFEC
Sbjct: 628 TSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGIIKYWDGDKFEC 687

Query: 646 IQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTL 705
           IQKLAAHQSEVWALA++++   VVS SHDHSIRIWEET+D+VFL             DTL
Sbjct: 688 IQKLAAHQSEVWALAIANDASFVVSSSHDHSIRIWEETEDEVFLEEERDKEMEEQYEDTL 747

Query: 706 LASLEEGNADDTFKGDVK---NDEDDEATRVSKQTIESLKAGERLMDALDLGIKXXXXXX 762
           LASLEEGN DD FKGD K   N E DEAT V KQT+ESLKAGERLM+A DLG+       
Sbjct: 748 LASLEEGNGDDAFKGDTKGATNVEFDEATDVHKQTMESLKAGERLMEAFDLGMAEIESFE 807

Query: 763 XXXXXMVKYKKKQRIDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFS 822
                +  +++K+  + P+KP GNAIL+A++KTP EYIMDTLI IKPSQLED+LLVLPFS
Sbjct: 808 EYDKNLKLWQRKKTGEPPIKPQGNAILIAIKKTPEEYIMDTLIRIKPSQLEDALLVLPFS 867

Query: 823 YVLKFLKFFDYVMKVPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQL 882
           YVLKFLKF + V+    +LNN LALICKNLFFI+KSN KELVSQKNE LKLQI++VK++L
Sbjct: 868 YVLKFLKFINIVIGNKKMLNNHLALICKNLFFIVKSNHKELVSQKNEVLKLQITKVKNEL 927

Query: 883 RSALQTNEDDLGFNIQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931
           R+AL+ NEDDLGFNIQG+KFIKQQWN++HN EFVD+YDQ++  +K AKK
Sbjct: 928 RNALKANEDDLGFNIQGMKFIKQQWNLRHNLEFVDEYDQKSHEDKMAKK 976

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1374 bits (3556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/936 (69%), Positives = 779/936 (83%), Gaps = 5/936 (0%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXX--XXLGKVITGALENISVWDLKTSELE 58
           MVKSYQRFEQ++ FGVI+SN+NCVW+P           G++IT ALEN+++WD+KT +L 
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSRTNNGSGPGQLITSALENVNIWDIKTGDLV 60

Query: 59  YVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGH 118
             LSDGLPPG+ D K SKPAE +YL+ H +T L+A GYADGVIK+WDLVSKTVLL+FNGH
Sbjct: 61  TTLSDGLPPGASDAKGSKPAECTYLEVHQDTNLLAVGYADGVIKVWDLVSKTVLLNFNGH 120

Query: 119 KSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST 178
           K+ IT+++FD TGT+LISGS+DSNIIVWDLV EVGLYKLRSHK  ITG WC  ++WL+ST
Sbjct: 121 KAAITLMQFDSTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDAITGFWCQGEDWLVST 180

Query: 179 SKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEP-GS 237
           SKDGLIK+WDLKTQQCIETHIAHTGECW L +  D ++T+S DSQ+KIW++++E E  G 
Sbjct: 181 SKDGLIKIWDLKTQQCIETHIAHTGECWGLAVKDDLLITTSTDSQVKIWKLNMENEKMGE 240

Query: 238 KLIEKGAFEKQSKQRGLSIEF-TTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRRE 296
           KL E G FEKQSKQRGL IEF T  SDGV FFY+QNADKT+E +R+RK+ EIA+ +K+RE
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNASDGVSFFYIQNADKTIETYRIRKEEEIARGLKKRE 300

Query: 297 KRLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSN 356
           KRL EKG+T+E+I  +I +SY S ++HPFQ VRS+YKIKS +WT   S+KLE+VVTT++N
Sbjct: 301 KRLREKGLTDEEISKSIKDSYSSLILHPFQTVRSLYKIKSASWTTVTSSKLELVVTTSNN 360

Query: 357 TIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLN 416
           TIEYYS+PYEKRDPTSP P+K HTIELQG RTDVRSID+SDDN LLATASNG LKIWN+ 
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDVSDDNKLLATASNGSLKIWNVK 420

Query: 417 TKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLD 476
           T  CIRTFECGYALTCKFLPGGLLV++GTR G LQLFDLASS LL TIE AH+ AIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRSGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 477 VTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS 536
           +T+DGKRLVTGSADK++KFWDFQV++ L+ GT DK+VP + + HD+TLEL DDILS++IS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVEKTLVPGTKDKFVPMLKLNHDTTLELNDDILSVRIS 540

Query: 537 GDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIW 596
            DD++LAISLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS D+K+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 597 GLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEV 656
           GLDFGDCHKSLFAHQDSIM VKFLP SHNFFS SKD  VKYWDG+KFECIQKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 657 WALAVSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADD 716
           WALA+S +G  VVS SHDHSIRIWEET+DQVFL             DTLL SLEEGN DD
Sbjct: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 717 TFKGDVKNDE-DDEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQ 775
            FKGD   +  +DEA+ V KQT+ESLKAGE+LM+ALDLGI            M  +++K+
Sbjct: 721 AFKGDATGENVEDEASGVHKQTLESLKAGEKLMEALDLGIAEIEGMEMYNKDMKLWQRKK 780

Query: 776 RIDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVM 835
             +AP+KP GN++L+AV+KTP +YIMDTL  I+ SQLED+L+V+PFSYVLKFLKF D VM
Sbjct: 781 LGEAPMKPQGNSVLIAVKKTPEQYIMDTLSRIRASQLEDALMVMPFSYVLKFLKFTDAVM 840

Query: 836 KVPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGF 895
           +   +L+N L LICKNLFFI+K N KEL+SQKNEELKLQI+RVK +LR+AL++ EDDLGF
Sbjct: 841 QNKTLLHNHLPLICKNLFFIIKFNHKELISQKNEELKLQINRVKTELRNALKSTEDDLGF 900

Query: 896 NIQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931
           N+QGLKFI+QQWN+KHN+EFVD+YDQQ +   SA+K
Sbjct: 901 NVQGLKFIRQQWNLKHNYEFVDEYDQQEKENTSARK 936

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 1362 bits (3525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 662/952 (69%), Positives = 775/952 (81%), Gaps = 22/952 (2%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXXXLGKVITGALENISVWDLKTSELEYV 60
           MVKSYQRFEQ SVFGVI+SNSNC+W+P         G++IT ALENI++WD+KT EL   
Sbjct: 1   MVKSYQRFEQESVFGVINSNSNCIWLPSDSNPSTSPGQIITSALENINIWDIKTGELSSH 60

Query: 61  LSDGL--PPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGH 118
           L D L  PPGS+D KS+KPAE +YLQ H +T L+A GY DGVIK+WDL SKTVL + NGH
Sbjct: 61  LIDSLIPPPGSIDAKSTKPAETTYLQHHKDTNLLAVGYNDGVIKVWDLYSKTVLCNLNGH 120

Query: 119 KSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWC--------D 170
            S IT+LKFD TGT+LISGS DSNIIVWDLVSEVGLYKLRSHK  ITG+WC        D
Sbjct: 121 SSAITVLKFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAITGIWCNEMQNNGED 180

Query: 171 SDN---WLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIW 227
            +N   WLISTSKDGLIK+WDLK QQCIETHIAHTGECW++ +  D ++T+S+DSQ+KIW
Sbjct: 181 DENELDWLISTSKDGLIKIWDLKIQQCIETHIAHTGECWSVAVRNDLLITTSSDSQIKIW 240

Query: 228 QMDLEGE---PGSKLIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRK 284
           +++L+ +      KLIEKG +EKQSKQRGLSIEF  T+D   FFY+QNADKTVEIFRLRK
Sbjct: 241 ELNLDNDDDGKNKKLIEKGIYEKQSKQRGLSIEFIDTADETGFFYIQNADKTVEIFRLRK 300

Query: 285 DIEIAKAIKRREKRLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLS 344
             EI KAIK+R KRLTEKGMT EDI+ NI +SY+S +MHPFQ+VRS+YKIK+V WT++  
Sbjct: 301 QDEINKAIKKRTKRLTEKGMTPEDIEQNIKDSYISLIMHPFQIVRSIYKIKAVTWTIATP 360

Query: 345 TKLEVVVTTNSNTIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLAT 404
           +KLE+ +TT++NTIEYYS PYEKR+PT PTP K HTIELQG RTD+RSIDISDDN LLAT
Sbjct: 361 SKLELCLTTSNNTIEYYSTPYEKREPTQPTPNKLHTIELQGQRTDIRSIDISDDNKLLAT 420

Query: 405 ASNGELKIWNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTI 464
           ASNG LKIWN+ TKSCIRTFECGY+LTCKFLPGG LV+VGTR G LQLFDLASS LL TI
Sbjct: 421 ASNGLLKIWNIKTKSCIRTFECGYSLTCKFLPGGTLVIVGTRGGELQLFDLASSTLLETI 480

Query: 465 EAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTL 524
           E AH+ AIWSLD+T+DGKRLVTGSADKS+KFWDFQ++QEL+AGT DKY+P++ + HD+TL
Sbjct: 481 EDAHDAAIWSLDLTSDGKRLVTGSADKSVKFWDFQLEQELVAGTVDKYLPKLKLFHDTTL 540

Query: 525 ELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVI 584
           EL DDILS+KIS +DKFLA+SLLDNTVKVFF+D+MKFFLSLYGHKLPVLS+DIS D+K+I
Sbjct: 541 ELNDDILSVKISPEDKFLAVSLLDNTVKVFFMDTMKFFLSLYGHKLPVLSIDISFDSKLI 600

Query: 585 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFE 644
           ITSSADKNIKIWGLDFGDCHKSLFAHQDSIM VKF+P SHNFFS SKDG +KYWDGDKFE
Sbjct: 601 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFVPESHNFFSCSKDGLIKYWDGDKFE 660

Query: 645 CIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDT 704
           CIQKLA HQSEVW++A++++   +VS SHDHSIRIWEET+D+VFL             DT
Sbjct: 661 CIQKLAGHQSEVWSIAIANDASFIVSSSHDHSIRIWEETEDEVFLEEEREKELEELYEDT 720

Query: 705 LLASLEEGNADDTFKGDVKNDEDDEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXX 764
           LL SLEE N DD FK D   D+ DEAT V KQT+ESLKA ERLM+A DLG+K        
Sbjct: 721 LLTSLEEDNGDDAFKKDGGEDK-DEATDVHKQTMESLKASERLMEAFDLGMKEIEAMEEY 779

Query: 765 XXXMVKYKKKQRID-----APVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVL 819
              +  +++K   +      P+KP GNAILLA++KTP EYIMDTL+ IKPSQLED+LLVL
Sbjct: 780 ERELKNWQRKDSNNKATQTVPIKPQGNAILLAIKKTPEEYIMDTLVRIKPSQLEDALLVL 839

Query: 820 PFSYVLKFLKFFDYVMKVPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVK 879
           PFSY++KFLKF D V+    ILNN L LIC+ LFFI+KSN KELVSQKNEELK QI+RVK
Sbjct: 840 PFSYIIKFLKFIDIVINSKKILNNHLPLICRILFFIVKSNHKELVSQKNEELKSQITRVK 899

Query: 880 HQLRSALQTNEDDLGFNIQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931
             LR+AL+ NEDDLGFNIQGLKFIKQQW +KHN+E+VDD DQ+AQ  K AKK
Sbjct: 900 DNLRNALKNNEDDLGFNIQGLKFIKQQWKLKHNYEYVDDQDQKAQEAKFAKK 951

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1360 bits (3520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 646/938 (68%), Positives = 778/938 (82%), Gaps = 5/938 (0%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXXX--LGKVITGALENISVWDLKTSELE 58
           MVKSYQRFEQS+ FGVI+SN+NCVW+P           G++IT ALEN++VWD+KT +L 
Sbjct: 1   MVKSYQRFEQSASFGVIASNANCVWLPASSRTKSGSGPGQLITSALENVNVWDIKTGDLM 60

Query: 59  YVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGH 118
             LSDGLPPG+ D + +KPAE +YL+ H +T L+A GYADGVIK+WDL+SKTVLL+FNGH
Sbjct: 61  STLSDGLPPGASDARGAKPAECTYLEVHQDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 119 KSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST 178
           K+ IT+L+FD TGT+LISGS+DSNIIVWDLV EVGLYKLRSHK +ITG WC  ++WLIST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 179 SKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEP-GS 237
           SKDG+IK+WDLKTQQCIETHIAHTGECW L +  D ++T+  DSQ+K+W++++E +  G 
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWGLSVKDDLLITTGTDSQVKLWKLNIENDKLGG 240

Query: 238 KLIEKGAFEKQSKQRGLSIEF-TTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRRE 296
           KL E G FEKQSKQRGL IEF T TSDG  FFY+QNADKT+EIFR+RK+ EIA+ +K+RE
Sbjct: 241 KLTEMGTFEKQSKQRGLKIEFITNTSDGNSFFYIQNADKTIEIFRIRKEEEIARGLKKRE 300

Query: 297 KRLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSN 356
           KRL EKG+T+E+I  +I +SY S ++HPFQ VRS+YKIKS +WT   S+KLE+V+TT++N
Sbjct: 301 KRLREKGLTDEEITKSIKDSYSSLILHPFQTVRSLYKIKSASWTTITSSKLELVLTTSNN 360

Query: 357 TIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLN 416
           TIEYYS+PYEKR+PTSP P+K HTIELQG RTD+RSIDISDDN LLATASNG LKIWN+ 
Sbjct: 361 TIEYYSIPYEKREPTSPAPLKTHTIELQGQRTDMRSIDISDDNRLLATASNGSLKIWNVK 420

Query: 417 TKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLD 476
           T  CIRTFECGYALTCKFLPGGLLV++GTR G LQLFDLASS LL TIE AH+ AIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 477 VTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS 536
           +T+DGKRLVTGSADK++KFWDFQV+  L+ GT DK++P + + HD+TLEL DDILS++IS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKFLPILKLNHDTTLELNDDILSLRIS 540

Query: 537 GDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIW 596
            DD++LAISLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS D+K+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 597 GLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEV 656
           GLDFGDCHKSLFAHQDSIM VKFLP SHNFFS SKD  VKYWDG+KFECIQKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 657 WALAVSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADD 716
           WALA+S +G  VVS SHDHSIRIWEET+DQVFL             DTLL SLEEGN DD
Sbjct: 661 WALAISTDGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 717 TFKGDVKNDE-DDEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQ 775
            FKGD   +  DDE + V KQT+ESLKAGERLM+ALDLGI            M  +++K+
Sbjct: 721 AFKGDATGESVDDEVSGVHKQTLESLKAGERLMEALDLGIAEIEGIEAYSRDMKLWQRKK 780

Query: 776 RIDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVM 835
             +AP+KP GN++L+AV KTP +YIMDTL+ I+ SQLED+L+V+PFSYVLKFLKF D +M
Sbjct: 781 LGEAPIKPQGNSVLIAVNKTPEQYIMDTLLRIRSSQLEDALMVMPFSYVLKFLKFIDSIM 840

Query: 836 KVPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGF 895
           +  ++L++ L LICKNLFFI+K N KELVSQKNEELK Q+SRVK +LR+AL++ EDDLGF
Sbjct: 841 QNKSLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKCQVSRVKTELRNALKSTEDDLGF 900

Query: 896 NIQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKKEY 933
           N+QGLKFIKQQWN++HN+EFVD+YDQQ +    A+K +
Sbjct: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKESNGARKRF 938

>SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 941

 Score = 1359 bits (3517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/936 (68%), Positives = 780/936 (83%), Gaps = 7/936 (0%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXXXLGKVITGALENISVWDLKTSELEYV 60
           MVKSYQRFEQ S FGVISSN+NCVW+          G+++TGALEN++ WD+KT EL  +
Sbjct: 1   MVKSYQRFEQGSAFGVISSNTNCVWIASRNRGSA--GQILTGALENVNCWDIKTGELSKI 58

Query: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120
           L+DGLPPG+VD KS+K AE +YLQ+H ET L+A GYADGVIK+WDL+SKTVL++FNGHKS
Sbjct: 59  LTDGLPPGAVDAKSTKLAESTYLQYHPETNLLAVGYADGVIKIWDLISKTVLINFNGHKS 118

Query: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK 180
            IT+L+FD TGT+LISGS+DS+II+WDLV EVGLYKLRSHK +ITG+WC++++WLISTSK
Sbjct: 119 AITVLRFDPTGTRLISGSKDSDIIIWDLVGEVGLYKLRSHKDSITGIWCENEDWLISTSK 178

Query: 181 DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240
           DGLIK+WDLKTQQC+ETH+AHT ECW L I  D V+T+S +SQ+KIW +DL+ + GSKLI
Sbjct: 179 DGLIKIWDLKTQQCVETHMAHTSECWGLAIHNDLVITTSTESQIKIWNLDLDKDMGSKLI 238

Query: 241 EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT 300
           EKG +EKQSKQRG+S+EF TTSDGV+FFY+QNADKTVEIFR+R   EI+KA+++REKRL 
Sbjct: 239 EKGIYEKQSKQRGVSVEFITTSDGVNFFYIQNADKTVEIFRVRTQEEISKALRKREKRLR 298

Query: 301 EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY 360
           +KGM +E I+ NI +SYVS +MHPFQ +RS +KIK+  W ++ ++KLE+V+TT++NT+EY
Sbjct: 299 DKGMADEKIQQNIKDSYVSVIMHPFQTIRSPFKIKAATWAVTTTSKLEMVLTTSNNTVEY 358

Query: 361 YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC 420
           YS+PY+KR+PT P P K +TIELQG RTDVRSIDISDDN LLATASNG LKIWN+ T +C
Sbjct: 359 YSIPYQKREPTRPAPNKLYTIELQGHRTDVRSIDISDDNKLLATASNGTLKIWNIKTHAC 418

Query: 421 IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480
           IRTFECGYALTCKFLPGG LVVVG R G+LQLFDLASS LL   E AH  AIWSLD+T+D
Sbjct: 419 IRTFECGYALTCKFLPGGALVVVGNRGGDLQLFDLASSTLLENKEDAHGAAIWSLDLTSD 478

Query: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540
           GKRLVTGSADK++KFWDF+V QELI GT DK+VP++ I HD+TLEL DDIL++KIS D+K
Sbjct: 479 GKRLVTGSADKTVKFWDFKVDQELIPGTVDKFVPKLKIFHDTTLELNDDILAVKISSDNK 538

Query: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF 600
           FLA+SLLDNTVKVFFL+SMKFFLSLYGHKLPVLS+DIS D+K++ITSSADKNIKIWGLDF
Sbjct: 539 FLAVSLLDNTVKVFFLNSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDF 598

Query: 601 GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA 660
           GDCHKSLFAHQDSIM VKF+P SHNFFS SKDG VKYWDGDKFEC+QKLAAHQSEVWALA
Sbjct: 599 GDCHKSLFAHQDSIMSVKFVPESHNFFSCSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 658

Query: 661 VSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADDTFKG 720
           +S++   VVS SHDHSIR+WEET+D+VFL             +TLL SLE G+ DD F+ 
Sbjct: 659 ISNDARFVVSTSHDHSIRVWEETEDEVFLEEEREKEMDEQYENTLLHSLEAGSGDDNFQR 718

Query: 721 DVK-NDED----DEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQ 775
           D++   ED    D+AT V KQTIESLKAGER+++ALDLGI            +  ++KK+
Sbjct: 719 DIEGRGEDGEITDQATDVHKQTIESLKAGERVIEALDLGIAVIEENETYEKNLKDWQKKK 778

Query: 776 RIDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVM 835
             + P KP  NAIL+A++K P +YIM+TL+ I+PSQLED+LLVLPFSYVL FLKF D V+
Sbjct: 779 SGEPPSKPQENAILVALKKAPEQYIMETLVKIRPSQLEDALLVLPFSYVLSFLKFIDVVI 838

Query: 836 KVPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGF 895
           K   + NN L LICK LFFI+KSN +ELV+QKNEELKLQI+RVK +LR+AL+ N DDLGF
Sbjct: 839 KDKKMQNNHLTLICKLLFFIIKSNYRELVAQKNEELKLQINRVKQELRTALKGNADDLGF 898

Query: 896 NIQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931
           N+QGLKFI+QQWN++HN EFVDDYDQ+ Q EK+ KK
Sbjct: 899 NVQGLKFIRQQWNLRHNLEFVDDYDQRKQEEKTVKK 934

>Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 1359 bits (3517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/936 (68%), Positives = 777/936 (83%), Gaps = 5/936 (0%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXX--XXLGKVITGALENISVWDLKTSELE 58
           MVKSYQRFEQS++FGVI+SN+NCVW+PP          G++IT ALEN+++WD+KT +L 
Sbjct: 1   MVKSYQRFEQSAIFGVIASNANCVWLPPSSRTNKGSGPGQLITSALENVNIWDIKTGDLL 60

Query: 59  YVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGH 118
             LSDGLPPG+ D + SKPAE +YL+ H +T L+A GYADGVIK+WDL+SKTVLL+FNGH
Sbjct: 61  ATLSDGLPPGASDARGSKPAECTYLEVHEDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 119 KSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST 178
           K+ IT+L+FD TGT+LISGS DSNIIVWDLV EVGLYKLRSHK  ITG+WC  ++WLIST
Sbjct: 121 KAAITLLQFDSTGTRLISGSRDSNIIVWDLVGEVGLYKLRSHKDCITGIWCQGEDWLIST 180

Query: 179 SKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEP-GS 237
           SKDG+IK+WDLKTQQCIETHIAHTGECW+L +  D ++T+  DSQ+KIW++++E +  G 
Sbjct: 181 SKDGMIKLWDLKTQQCIETHIAHTGECWSLSVKDDLLITTGTDSQVKIWKLNMENDKMGE 240

Query: 238 KLIEKGAFEKQSKQRGLSIEF-TTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRRE 296
           KL E G FEKQSKQRGL +EF T  SDGV FFY+QNADKT+E FR+RK+ EIA+ +K+RE
Sbjct: 241 KLTEVGVFEKQSKQRGLKVEFITNASDGVSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 297 KRLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSN 356
           KRL EKG+T+E+I  +I  SY S V+HPFQ +RS YK+KS +WT   S+KLE+V+TT++N
Sbjct: 301 KRLREKGLTDEEIARSIKGSYSSLVLHPFQTIRSFYKVKSASWTTVTSSKLELVLTTSNN 360

Query: 357 TIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLN 416
           TIEYYS+PYEKR+ TSP P+K HTIELQG RTDVRSIDISDDN LLATASNG LKIWN+ 
Sbjct: 361 TIEYYSIPYEKREATSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNVK 420

Query: 417 TKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLD 476
           T  CIRTFECGYAL+CKFLPGGLLV++GTR G LQLFDLASS LL T+E AH+ AIWSLD
Sbjct: 421 THKCIRTFECGYALSCKFLPGGLLVILGTRTGELQLFDLASSSLLDTVEDAHDAAIWSLD 480

Query: 477 VTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS 536
           +T+DGKRLVTGSADK++KFWDFQV+  L+ GT DK +P + + HD+TLEL DDILS++IS
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFQVENTLVPGTKDKLLPMLKLNHDTTLELNDDILSVRIS 540

Query: 537 GDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIW 596
            DD++LAISLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS D+K+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 597 GLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEV 656
           GLDFGDCHKSLFAHQDSIM VKFLP SHNFFS SKD  VKYWDG+KFECIQKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 657 WALAVSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADD 716
           WALA++ NG  VVS SHDHSIRIWEET+DQVFL             DTLLASLEEGNADD
Sbjct: 661 WALAIASNGSFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLASLEEGNADD 720

Query: 717 TFKGDVKN-DEDDEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQ 775
            FKGD    D +DEA+ V KQT+ESLKAGERLM+ALD+GI            M  +++K+
Sbjct: 721 AFKGDAAGEDVEDEASGVHKQTLESLKAGERLMEALDIGIADIEGMETYNKDMELWQRKK 780

Query: 776 RIDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVM 835
             +AP+KP GN++L+AV KTP +YI+DTL  I+ SQLED+L+V+PFSYVLKFLKF D VM
Sbjct: 781 LGEAPMKPQGNSVLIAVNKTPEQYILDTLSRIRTSQLEDALMVMPFSYVLKFLKFIDTVM 840

Query: 836 KVPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGF 895
           +   +L++ L L+C+NLFFI+K N KELVSQKNEELKLQI+RVK +LR+AL++ EDDLGF
Sbjct: 841 QNKTLLHSHLPLVCRNLFFIIKFNHKELVSQKNEELKLQINRVKTELRNALKSTEDDLGF 900

Query: 896 NIQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931
           N+QGLKFIKQQWN++HN+EFVD+YDQQ +   SA+K
Sbjct: 901 NVQGLKFIKQQWNLRHNYEFVDEYDQQEKENSSARK 936

>Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON}
           (189457..192267) [2811 nt, 937 aa]
          Length = 936

 Score = 1350 bits (3494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 649/932 (69%), Positives = 778/932 (83%), Gaps = 4/932 (0%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXXXLGKVITGALENISVWDLKTSELEYV 60
           MVKSYQRFEQ+SVFGVIS+N+NCVW+ P        G VIT ALENI++WD+KT EL  V
Sbjct: 1   MVKSYQRFEQASVFGVISTNANCVWMSPESKKSNSPGSVITSALENINIWDIKTGELISV 60

Query: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120
           LSDGLP GS+D+KSSKPAEVSYL +H ET L+AAGY DG IK+WDL+SK+VLL+FNGHKS
Sbjct: 61  LSDGLPAGSIDVKSSKPAEVSYLHYHDETNLLAAGYMDGTIKVWDLLSKSVLLTFNGHKS 120

Query: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK 180
            IT++KFD TGT+LISGS DSNIIVWDLVSEVGLYKLRSHK  I+G+WC+ ++WL+STSK
Sbjct: 121 AITVMKFDVTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDAISGIWCEGEDWLVSTSK 180

Query: 181 DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240
           DGLIK+WDLK QQCIETHIAHTGECWA+G+  D ++TS AD+QLK+W +D   E GSKLI
Sbjct: 181 DGLIKIWDLKVQQCIETHIAHTGECWAMGVHEDLLITSGADTQLKLWNLDFSKEAGSKLI 240

Query: 241 EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT 300
           EKG ++KQSKQRGL I+F+   +G  FFY+QNADKT E+FR+R++ EI+KA+K+REKRL 
Sbjct: 241 EKGVYDKQSKQRGLDIKFSVAPNGTAFFYIQNADKTTEVFRIRREEEISKALKKREKRLK 300

Query: 301 EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY 360
           EKGMT+E+I+ NI ESY S +MHPFQV++S YKIKSV++T   +TKLE VVTT+SN+IEY
Sbjct: 301 EKGMTDEEIQQNIKESYSSIIMHPFQVIKSQYKIKSVSFTTVSNTKLEFVVTTSSNSIEY 360

Query: 361 YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC 420
           YS+PYEKRDPTSP P + +TIEL G RTD+RS+DISDD+ LLATASNG LK+WNL TK+C
Sbjct: 361 YSIPYEKRDPTSPAPTRLYTIELPGHRTDIRSVDISDDDKLLATASNGLLKVWNLKTKAC 420

Query: 421 IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480
           IR F+CGYALTCKFLPGG LV+VGTREG+LQLFDLASS LL   E AHE AIWSLD+T+D
Sbjct: 421 IRVFDCGYALTCKFLPGGTLVIVGTREGSLQLFDLASSTLLENKEDAHETAIWSLDITSD 480

Query: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540
           G+RLVTGSADK+IKFW+FQV+++L+ GT+DKY+P M ++HD+T+E+ +D+LS++IS +DK
Sbjct: 481 GRRLVTGSADKTIKFWNFQVEEDLVPGTADKYLPVMKLIHDTTMEVNEDVLSVRISPEDK 540

Query: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF 600
           FLAISLLDNTVKVF+LDSMKFFLSLYGHKLPVLS+DIS D+K+IITSSADKNIKIWGLDF
Sbjct: 541 FLAISLLDNTVKVFYLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 601 GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA 660
           GDCHKSLFAHQDSIM VKFLP SHNFFS+SKDG VKYWDGDKFECIQKLAAHQSEVW++A
Sbjct: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSSSKDGLVKYWDGDKFECIQKLAAHQSEVWSIA 660

Query: 661 VSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADDTFKG 720
           ++ +G  V+S SHDHS+R+WEETDDQVFL             DTLLASLEEG+ DD FKG
Sbjct: 661 ITSDGTSVISASHDHSLRVWEETDDQVFLEEEREKELEEQYEDTLLASLEEGSGDDAFKG 720

Query: 721 DVKNDEDDEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKY-KKKQRIDA 779
           D +  E DE+T V  QT+ESLKAGERLM+ALDLG+            M  + KKK   + 
Sbjct: 721 DAEKVE-DESTSVRNQTMESLKAGERLMEALDLGMSEIEANEKYQIDMKAWEKKKSSGEP 779

Query: 780 PVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMKVPN 839
           P+KP GNAIL+A++K P EYIM+TL+ IKPSQLED+LLVLPFSYVLK LKF D VMK   
Sbjct: 780 PIKPQGNAILIAMKKQPHEYIMETLVKIKPSQLEDALLVLPFSYVLKLLKFIDIVMKDKK 839

Query: 840 ILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFNIQG 899
           +  N L LICKNLFF+++SN KEL+SQ+NE LK QI  VK+ LR +LQ N DDLGFNIQG
Sbjct: 840 MTKNYLMLICKNLFFVIRSNHKELISQRNEALKNQILNVKNSLRDSLQENVDDLGFNIQG 899

Query: 900 LKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931
           LKFIKQQWN+KHNF+F DD+D+  + E S KK
Sbjct: 900 LKFIKQQWNLKHNFDFTDDFDK--KEESSGKK 929

>TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.324
           YLR129W
          Length = 938

 Score = 1343 bits (3477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/933 (67%), Positives = 769/933 (82%), Gaps = 4/933 (0%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXXXLGKVITGALENISVWDLKTSELEYV 60
           MVKSYQRFEQS+ FGVISSNSNCV++PP       LG+V+TG LE +++WDLKT +L   
Sbjct: 1   MVKSYQRFEQSASFGVISSNSNCVYIPPANRKG--LGQVLTGGLEKVNLWDLKTGDLVSC 58

Query: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120
           LSDGLPPGS+D KS+KPAE +YL++H+ET L+A GYA+GVIK+WDL+SKTVLL+ NGHKS
Sbjct: 59  LSDGLPPGSIDAKSTKPAETTYLEYHAETNLLAVGYAEGVIKVWDLMSKTVLLTLNGHKS 118

Query: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK 180
            +T+LKFD TGT+LISGS+DSNII+WDL+ EVGLYKLRSHKG I+GLW + D WLISTS+
Sbjct: 119 AVTILKFDITGTRLISGSQDSNIIMWDLIGEVGLYKLRSHKGAISGLWLEKDEWLISTSR 178

Query: 181 DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240
           DGLIKVWDLKTQQC+ETHIAHTGECW+LG+  D  +T+SADSQ+KIW ++ E E GSKLI
Sbjct: 179 DGLIKVWDLKTQQCVETHIAHTGECWSLGVHEDLAITASADSQVKIWHLNFESEAGSKLI 238

Query: 241 EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT 300
           EKG +EKQS QRG SIEF TT+D   FFY+QNADK++EIFR+RK+ EI KA ++REKRL 
Sbjct: 239 EKGIYEKQSNQRGSSIEFVTTTDETTFFYIQNADKSIEIFRIRKEEEILKATRKREKRLK 298

Query: 301 EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY 360
           EKG+++E+IK NI + Y+S +MHPFQ++RS +K+K+ AW  + ++KL++VVTT SNT+EY
Sbjct: 299 EKGLSDEEIKQNIQDGYISMIMHPFQILRSNFKVKAAAWGQATASKLDLVVTTASNTVEY 358

Query: 361 YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC 420
           Y++PYEKR+P  P P + H++ELQG RTDVR++DIS+D++LLATASNG LK+WNL T+ C
Sbjct: 359 YTIPYEKREPKLPAPNRLHSVELQGHRTDVRAMDISNDSSLLATASNGTLKVWNLKTRMC 418

Query: 421 IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480
           +RTF+CGYAL C+FLPGG L+VVGTR G+LQLFDLASS +L   E AH+ AIWSLD+T+D
Sbjct: 419 LRTFDCGYALCCRFLPGGFLIVVGTRNGDLQLFDLASSTMLDNKEGAHDAAIWSLDITSD 478

Query: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540
           GK+LVTGSADKS+KFW FQV+++LIAGT DK+ P M + HD+TLEL DD+LS++IS +DK
Sbjct: 479 GKKLVTGSADKSVKFWKFQVEKDLIAGTVDKFAPVMKLSHDTTLELNDDVLSVRISPEDK 538

Query: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF 600
           + AISLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS D+KVIITSSADKNIKIWGLDF
Sbjct: 539 YFAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKVIITSSADKNIKIWGLDF 598

Query: 601 GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA 660
           GDCHKSLFAHQDSIM VKFLP SHNFFS SKDG VKYWDGDKFECIQKLA HQSEVWALA
Sbjct: 599 GDCHKSLFAHQDSIMSVKFLPESHNFFSCSKDGLVKYWDGDKFECIQKLAGHQSEVWALA 658

Query: 661 VSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADDTFKG 720
           +S+NG+ VVS SHD SIRIWEET+DQVFL               LL+SLEEG+ D  F+ 
Sbjct: 659 ISNNGKYVVSASHDRSIRIWEETEDQVFLEEEREKELEEQNETALLSSLEEGSGDAAFRK 718

Query: 721 DVKNDE--DDEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQRID 778
           DV  DE   DEA  V KQTIESLKAGERLM+ALDLGI            +  + K +   
Sbjct: 719 DVGGDEADQDEAADVRKQTIESLKAGERLMEALDLGIPEIENREHYEKELKAWNKHKGDA 778

Query: 779 APVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMKVP 838
            PVKP GNAIL A+ KTP EYI++TL  IKPSQLED+LLVLPFSYVLKF +F D  +   
Sbjct: 779 KPVKPPGNAILTAISKTPEEYILETLARIKPSQLEDALLVLPFSYVLKFFRFIDAALLDN 838

Query: 839 NILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFNIQ 898
            IL + L LICKNLFFI+KSN +ELVSQKNEELKL+I++VK  LR AL++NEDDLGFNI+
Sbjct: 839 RILQHNLPLICKNLFFIVKSNHRELVSQKNEELKLRIAKVKDLLRGALKSNEDDLGFNIE 898

Query: 899 GLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931
           GLKFI++QW+++H  EFVDDY Q+ Q +K+AKK
Sbjct: 899 GLKFIRRQWDLRHKLEFVDDYSQREQEDKTAKK 931

>TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {ON}
           Anc_8.324 YLR129W
          Length = 937

 Score = 1339 bits (3465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/932 (68%), Positives = 782/932 (83%), Gaps = 1/932 (0%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXXXLGKVITGALENISVWDLKTSELEYV 60
           MVKSYQRFEQ SVFGVI++N+NCVW+P        +G+V+TGALENI++WD+KT EL  V
Sbjct: 1   MVKSYQRFEQDSVFGVITTNANCVWLPSSDSRKSNVGQVLTGALENINLWDIKTGELLSV 60

Query: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120
           LSDGLPPGS+D+KSSKPAEV+YL++H ET L+AAGYADGVIK+WDL+SKTVLLSF+GHKS
Sbjct: 61  LSDGLPPGSIDVKSSKPAEVTYLEYHDETNLLAAGYADGVIKIWDLMSKTVLLSFSGHKS 120

Query: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK 180
            +T+LKFD TGT+L+SGS DS+II+WDLVSEVG++KLRSHK  ITG+WC+ ++WL+ST+K
Sbjct: 121 GVTILKFDSTGTRLMSGSRDSDIIIWDLVSEVGVFKLRSHKDAITGIWCEGEDWLVSTAK 180

Query: 181 DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240
           DGLIK+WDLKTQQC+ETHIA TGECWALG+  D VVT+  DSQ+KIW +D   E GSK++
Sbjct: 181 DGLIKLWDLKTQQCVETHIAQTGECWALGVHGDLVVTTGTDSQIKIWNLDTSKENGSKIV 240

Query: 241 EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT 300
           EKG +EKQSKQRGLS+ F TT+D   F Y+QN+DKTVEIFR+RK  EI++A+K+REKR+ 
Sbjct: 241 EKGTYEKQSKQRGLSVNFKTTADETTFLYIQNSDKTVEIFRIRKQDEISRALKKREKRMK 300

Query: 301 EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY 360
           EKG T+E I+    ++YVS ++ PFQ+++S YKIK+V+WT++ ++K+E+VVTT+SNTIEY
Sbjct: 301 EKGSTDEQIQQYFIDTYVSLMLQPFQIIKSTYKIKAVSWTVAANSKIELVVTTSSNTIEY 360

Query: 361 YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC 420
           YS+PYEKR P +P+P K +TIE +G RTD+RSIDISDDN LLA+ASNG LKIWNL TKSC
Sbjct: 361 YSIPYEKRLPKNPSPSKLYTIEQKGHRTDIRSIDISDDNKLLASASNGLLKIWNLKTKSC 420

Query: 421 IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480
           IRTF+CGYALTCKFLP G L V+GTREG +QLFDL +S L+ +I+ AH  AIWSLD+T D
Sbjct: 421 IRTFDCGYALTCKFLPSGTLCVIGTREGQIQLFDLVTSTLIESIDVAHNAAIWSLDITQD 480

Query: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540
           GKRLVTGSADKSIKFW+F ++Q+L+ GT+DK+VP M ++HD+TLEL DDILS+KIS +DK
Sbjct: 481 GKRLVTGSADKSIKFWNFSIEQDLVPGTTDKFVPVMKLIHDTTLELNDDILSVKISPEDK 540

Query: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF 600
           +LA+SLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS D+K+IITSSADKNIKIWGLDF
Sbjct: 541 YLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 601 GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA 660
           GDCHKSLFAHQDSIM V FLP SHNFFS+SKDG VKYWDGDKFEC+QKLAAHQSEVWALA
Sbjct: 601 GDCHKSLFAHQDSIMNVCFLPESHNFFSSSKDGLVKYWDGDKFECVQKLAAHQSEVWALA 660

Query: 661 VSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADDTFKG 720
           ++ +G  VVS SHDHS+R+W+ETDDQVFL             DTLL SLEEG+ D  FK 
Sbjct: 661 ITSDGSTVVSSSHDHSMRVWKETDDQVFLEEEREKELEEQYEDTLLTSLEEGSGDSAFKA 720

Query: 721 DVKNDEDDEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQRIDAP 780
           D++ D  DE+T V  QT+ESLK+GERLM+AL+LG               +++KK+  + P
Sbjct: 721 DIE-DGMDESTSVRNQTMESLKSGERLMEALELGFSEIEALEKYNKDYKQWEKKKAGEPP 779

Query: 781 VKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMKVPNI 840
           VKP GNAILLA+ + P +YIMDTLI IKPSQLED+LLVLPFSYVL+FLKF D VM  P I
Sbjct: 780 VKPQGNAILLAINRRPDQYIMDTLIKIKPSQLEDALLVLPFSYVLQFLKFIDIVMDDPEI 839

Query: 841 LNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFNIQGL 900
           L NRLALICKNLF I+K+N KEL+SQ+N+ LK QI+ VK++LR++LQ N DDLGFNIQGL
Sbjct: 840 LKNRLALICKNLFIIVKANHKELISQRNDVLKKQITSVKNKLRTSLQANVDDLGFNIQGL 899

Query: 901 KFIKQQWNMKHNFEFVDDYDQQAQAEKSAKKE 932
           KFIKQQWN+KHN+EF+D+ DQ+ Q EK++KK 
Sbjct: 900 KFIKQQWNLKHNYEFIDEEDQKKQEEKNSKKR 931

>YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}
           DIP2Nucleolar protein, specifically associated with the
           U3 snoRNA, part of the large ribonucleoprotein complex
           known as the small subunit (SSU) processome, required
           for 18S rRNA biogenesis, part of the active pre-rRNA
           processing complex
          Length = 943

 Score = 1332 bits (3447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/936 (68%), Positives = 775/936 (82%), Gaps = 5/936 (0%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXX--XXLGKVITGALENISVWDLKTSELE 58
           MVKSYQRFEQ++ FGVI+SN+NCVW+P           G++IT ALE++++WD+KT +L 
Sbjct: 1   MVKSYQRFEQAAAFGVIASNANCVWIPASSGNSNGSGPGQLITSALEDVNIWDIKTGDLV 60

Query: 59  YVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGH 118
             LSDGLPPG+ D + +KPAE +YL+ H +T L+A GYADGVIK+WDL+SKTVLL+FNGH
Sbjct: 61  SKLSDGLPPGASDARGAKPAECTYLEAHKDTDLLAVGYADGVIKVWDLMSKTVLLNFNGH 120

Query: 119 KSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST 178
           K+ IT+L+FD TGT+LISGS+DSNIIVWDLV EVGLYKLRSHK +ITG WC  ++WLIST
Sbjct: 121 KAAITLLQFDGTGTRLISGSKDSNIIVWDLVGEVGLYKLRSHKDSITGFWCQGEDWLIST 180

Query: 179 SKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEP-GS 237
           SKDG+IK+WDLKT QCIETHIAHTGECW L +  D ++T+  DSQ+KIW++D+E +  G 
Sbjct: 181 SKDGMIKLWDLKTHQCIETHIAHTGECWGLAVKDDLLITTGTDSQVKIWKLDIENDKMGG 240

Query: 238 KLIEKGAFEKQSKQRGLSIEF-TTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRRE 296
           KL E G FEKQSKQRGL IEF T +SD   FFY+QNADKT+E FR+RK+ EIA+ +K+RE
Sbjct: 241 KLTEMGIFEKQSKQRGLKIEFITNSSDKTSFFYIQNADKTIETFRIRKEEEIARGLKKRE 300

Query: 297 KRLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSN 356
           KRL EKG+TEE+I  +I ESY SF++HPFQ +RS+YKIKS +WT   S+KLE+V+TT+SN
Sbjct: 301 KRLKEKGLTEEEIAKSIKESYSSFILHPFQTIRSLYKIKSASWTTVSSSKLELVLTTSSN 360

Query: 357 TIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLN 416
           TIEYYS+PYEKRDPTSP P+K HTIELQG RTDVRSIDISDDN LLATASNG LKIWN+ 
Sbjct: 361 TIEYYSIPYEKRDPTSPAPLKTHTIELQGQRTDVRSIDISDDNKLLATASNGSLKIWNIK 420

Query: 417 TKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLD 476
           T  CIRTFECGYALTCKFLPGGLLV++GTR G LQLFDLASS LL TIE AH+ AIWSLD
Sbjct: 421 THKCIRTFECGYALTCKFLPGGLLVILGTRNGELQLFDLASSSLLDTIEDAHDAAIWSLD 480

Query: 477 VTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS 536
           +T+DGKRLVTGSADK++KFWDF+V+  L+ GT +K++P + + HD+TLEL DDIL +++S
Sbjct: 481 LTSDGKRLVTGSADKTVKFWDFKVENSLVPGTKNKFLPVLKLHHDTTLELTDDILCVRVS 540

Query: 537 GDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIW 596
            DD++LAISLLDNTVKVFFLDSMKF+LSLYGHKLPVLS+DIS D+K+IITSSADKNIKIW
Sbjct: 541 PDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDISFDSKMIITSSADKNIKIW 600

Query: 597 GLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEV 656
           GLDFGDCHKSLFAHQDSIM VKFLP SHNFFS SKD  VKYWDG+KFECIQKL AHQSEV
Sbjct: 601 GLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEV 660

Query: 657 WALAVSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADD 716
           WALAV+ +G  VVS SHDHSIRIWEET+DQVFL             DTLL SLEEGN DD
Sbjct: 661 WALAVATDGGFVVSSSHDHSIRIWEETEDQVFLEEEKEKELEEQYEDTLLTSLEEGNGDD 720

Query: 717 TFKGDVKNDE-DDEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQ 775
            FK D   +  +DEA+ V KQT+ESLKAGERLM+ALDLGI            M  +++K+
Sbjct: 721 AFKADASGEGVEDEASGVHKQTLESLKAGERLMEALDLGIAEIEGLEAYNRDMKLWQRKK 780

Query: 776 RIDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVM 835
             +AP+KP GNA+L+AV KTP +YIMDTL+ I+ SQLED+L+V+PFSYVLKFLKF D VM
Sbjct: 781 LGEAPIKPQGNAVLIAVNKTPEQYIMDTLLRIRMSQLEDALMVMPFSYVLKFLKFIDTVM 840

Query: 836 KVPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGF 895
           +   +L++ L LICKNLFFI+K N KELVSQKNEELKLQI+RVK +LRSAL++ EDDLGF
Sbjct: 841 QNKTLLHSHLPLICKNLFFIIKFNHKELVSQKNEELKLQINRVKTELRSALKSTEDDLGF 900

Query: 896 NIQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931
           N+QGLKF+KQQWN++HN+EFVD+YDQQ +   SA+K
Sbjct: 901 NVQGLKFVKQQWNLRHNYEFVDEYDQQEKESNSARK 936

>ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 938

 Score = 1306 bits (3381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/931 (67%), Positives = 772/931 (82%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXXXLGKVITGALENISVWDLKTSELEYV 60
           MVKSYQRFEQSSVFGV+SS  N +W+P         G++ITGALEN+++WD+KT EL   
Sbjct: 1   MVKSYQRFEQSSVFGVVSSGDNSIWIPAENKRTNGPGQIITGALENVNIWDIKTGELVSH 60

Query: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120
           LSDGLPPG++D +++KPAEV+Y+Q++S+T L+A GYADGVIK+WD+ SKTVLLSFNGH+S
Sbjct: 61  LSDGLPPGAIDARTTKPAEVTYMQYYSDTSLLAVGYADGVIKIWDMFSKTVLLSFNGHRS 120

Query: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK 180
            +T L FD TGT+LISGS DSNIIVWDLVSEVGLYKLRSHK +ITGL    +NWL+S SK
Sbjct: 121 AVTQLLFDSTGTRLISGSRDSNIIVWDLVSEVGLYKLRSHKDSITGLSLPDENWLMSVSK 180

Query: 181 DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240
           DGLIK+WDLK QQC+ETHIAH GECWALG+  D VVT+S+DSQ+KIW +DL+ + G K+ 
Sbjct: 181 DGLIKLWDLKIQQCVETHIAHPGECWALGVDEDVVVTTSSDSQIKIWHLDLDADAGVKVT 240

Query: 241 EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT 300
           EKG FEKQSKQRG+++ F T SDG  FFYVQNADKT+EI RLRK+ EI++A+K+REKR  
Sbjct: 241 EKGIFEKQSKQRGVAVSFITVSDGTKFFYVQNADKTLEIIRLRKEEEISRALKKREKRFK 300

Query: 301 EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY 360
           EKGMT+E+I+ N  ESY+S +MH FQV+RS +KI++ +W ++ S+KLE+ VTT+ NTIEY
Sbjct: 301 EKGMTDEEIQQNFKESYISIIMHSFQVLRSAFKIRAASWAVTTSSKLELTVTTSGNTIEY 360

Query: 361 YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC 420
           YS+PYEKR+P  PTPI+ H+IELQG RTDVR+IDISDD  LLATASNG LKIWN+ TK+C
Sbjct: 361 YSIPYEKREPKHPTPIRVHSIELQGHRTDVRAIDISDDGKLLATASNGLLKIWNIRTKTC 420

Query: 421 IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480
           +RTFECGYALTCKFLPGG+LV+VGTR G LQLFDLASS +L   E AH+ AIWSLD+T+D
Sbjct: 421 LRTFECGYALTCKFLPGGVLVIVGTRSGQLQLFDLASSTILENNEEAHDAAIWSLDITSD 480

Query: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540
           G+RLVTGSADK++KFW+F V+++ + GT+DK +P M++ HD+TLE+ DDILS+KIS ++K
Sbjct: 481 GRRLVTGSADKTVKFWNFIVEEKKVPGTTDKLIPTMSLHHDTTLEMSDDILSVKISPENK 540

Query: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF 600
            LA+SLLDNTVKVF+L++MKFFLSLYGHKLPVLS+DIS D+K+IITSSADKNIKIWGLDF
Sbjct: 541 LLAVSLLDNTVKVFYLETMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIWGLDF 600

Query: 601 GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA 660
           GDCHKSLFAHQDSIM VKFLP SHNFFS SKD  VKYWDGDKFE IQKLA HQSEVWALA
Sbjct: 601 GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDATVKYWDGDKFETIQKLAGHQSEVWALA 660

Query: 661 VSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADDTFKG 720
           V+ +G  V+SVSHD SIR+WEETDDQVFL             + LL SLEEG+ D  FK 
Sbjct: 661 VARSGTCVISVSHDSSIRVWEETDDQVFLEEERERELEEQNEEGLLTSLEEGSGDSAFKQ 720

Query: 721 DVKNDEDDEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQRIDAP 780
           D K+D+ D+A  V KQT+ESLKAGERLM+A+DLGI            +  +KKK++   P
Sbjct: 721 DEKDDDHDDAVDVHKQTVESLKAGERLMEAIDLGIPEIEAWEIYEKELQLWKKKKQGVEP 780

Query: 781 VKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMKVPNI 840
            +P  NAILLA+ K P EYIMDTL+ IKPSQLED+LL LPFSYVLKFLKF D V++   +
Sbjct: 781 ERPQDNAILLAINKRPEEYIMDTLVRIKPSQLEDALLTLPFSYVLKFLKFLDTVLQDKKL 840

Query: 841 LNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFNIQGL 900
           L+N L+LICKNLFFI++SN +ELVSQKNEELK +I+RVK++LR AL+ NEDDLGFNI+GL
Sbjct: 841 LHNHLSLICKNLFFIVQSNHRELVSQKNEELKQRITRVKNELREALKNNEDDLGFNIEGL 900

Query: 901 KFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931
           KFIKQQWN+KHN+EFVD++DQ+ QAEK+AKK
Sbjct: 901 KFIKQQWNLKHNYEFVDEFDQRKQAEKTAKK 931

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 1306 bits (3379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 654/937 (69%), Positives = 765/937 (81%), Gaps = 12/937 (1%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXXXLGKVITGALENISVWDLKTSELEYV 60
           MVKSYQRFEQ+SVFGVISSNSN VW+P         G +IT ALENI++WD+KT EL   
Sbjct: 1   MVKSYQRFEQTSVFGVISSNSNSVWIPNGNGP----GNIITSALENINIWDIKTGELVNQ 56

Query: 61  LSDGLPP-GSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHK 119
           L+DGLPP GS+D K SKPA V+Y ++H +T L+AAGY+DGVIK+WDL+SKT+LL+FNGHK
Sbjct: 57  LTDGLPPPGSIDSKLSKPASVTYFKYHEDTNLLAAGYSDGVIKVWDLISKTILLTFNGHK 116

Query: 120 SRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWC-DSDNWLIST 178
           S IT+L FD TGT+LISGS DS+IIVWDLVSEVGLYKLRSHK  ITG+WC D +NWLIST
Sbjct: 117 SAITILTFDSTGTRLISGSNDSDIIVWDLVSEVGLYKLRSHKDNITGIWCSDDENWLIST 176

Query: 179 SKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEP-GS 237
           SKDGLIKVWDLK QQC+ETHIAHTGECW+LGI  D VVT+SA+SQ+K W++DLE +P GS
Sbjct: 177 SKDGLIKVWDLKIQQCVETHIAHTGECWSLGIHNDLVVTTSAESQVKFWKLDLENQPNGS 236

Query: 238 KLIEKGAFEKQSKQRGLSIEFTTT-SDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRRE 296
           KL+EKG FEKQSKQRGLS+EF T+  D V FF++QNADKTVEIFR+RK  EI KA+K+RE
Sbjct: 237 KLVEKGIFEKQSKQRGLSVEFITSKGDDVSFFHIQNADKTVEIFRIRKKDEIEKALKKRE 296

Query: 297 KRLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSN 356
           KRL EKGMT+++I  N+ E++VSF+MHPFQ VRS YKIKSV WT + S+KLE+VVTT+SN
Sbjct: 297 KRLKEKGMTDDEIAQNVDEAFVSFLMHPFQTVRSTYKIKSVCWTHATSSKLELVVTTSSN 356

Query: 357 TIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLN 416
           TIEYYSV Y KR P  P+ I  HTIEL G RTD+RSI ISDDN LLATASNG LKIWNL 
Sbjct: 357 TIEYYSVTYAKRIPQPPSKI--HTIELHGQRTDIRSIAISDDNKLLATASNGLLKIWNLK 414

Query: 417 TKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLD 476
           T  CIRTFECGYAL CKFLPGGLLV+VGTR G LQLFDLASS  L  IE AH+ AIWSLD
Sbjct: 415 THKCIRTFECGYALCCKFLPGGLLVIVGTRNGELQLFDLASSTQLENIEDAHDAAIWSLD 474

Query: 477 VTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS 536
           +T+DGKRL+TGSADK++KFWDF++ Q+ + GT D Y+P + + HD+TLE+G+DIL +++S
Sbjct: 475 ITSDGKRLITGSADKTVKFWDFKLDQQKVEGTRDSYIPVLKLFHDTTLEIGEDILCVRLS 534

Query: 537 GDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIW 596
            DDKFLA+SLLD TVK+FFLDSMKFFLSLYGHKLPVLS+DIS D+K+IITSSADKNIKIW
Sbjct: 535 PDDKFLAVSLLDYTVKIFFLDSMKFFLSLYGHKLPVLSIDISFDSKLIITSSADKNIKIW 594

Query: 597 GLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEV 656
           GLDFGDCHKSLFAH DSIM VKFL  SHNFFS SKDG +KYWDGDKFECIQKL AHQ+EV
Sbjct: 595 GLDFGDCHKSLFAHADSIMNVKFLNNSHNFFSCSKDGTIKYWDGDKFECIQKLVAHQNEV 654

Query: 657 WALAVSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADD 716
           W++A++D+   VVS SHDHS+RIWEET+DQVFL             +TLL SLEEG  D 
Sbjct: 655 WSIAIADDSSFVVSSSHDHSLRIWEETEDQVFLEEEREREMEEQYENTLLNSLEEGTGDS 714

Query: 717 TFKGDVKNDED-DEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQ 775
            FK D K  ED DEAT V KQT ESLKAGERLM+ALDLGI+           +  +KKK+
Sbjct: 715 AFKSDTKGSEDEDEATDVHKQTAESLKAGERLMEALDLGIEEIEKNETYLKDLELWKKKK 774

Query: 776 -RIDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYV 834
              DAP+KP GNAIL A+ KTP +YI++TLI IKPSQLED++LV PFSYVLKFLKF D V
Sbjct: 775 IGGDAPIKPQGNAILTAINKTPEQYILETLIKIKPSQLEDAILVFPFSYVLKFLKFIDIV 834

Query: 835 MKVPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLG 894
           +  P +LNN L LICKNLFF++KSN KEL+SQKNE+LKLQ+ RVK +LR AL+ NEDDLG
Sbjct: 835 LNDPKVLNNHLTLICKNLFFVIKSNHKELISQKNEDLKLQVDRVKDRLRGALRKNEDDLG 894

Query: 895 FNIQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931
           +NIQGLKFIKQQWN+ HNFEF D+ DQ  Q  KS KK
Sbjct: 895 YNIQGLKFIKQQWNLTHNFEFNDELDQNVQESKSGKK 931

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 1303 bits (3372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/935 (65%), Positives = 760/935 (81%), Gaps = 4/935 (0%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXXXLGKVITGALENISVWDLKTSELEYV 60
           MVKSYQRFEQ+SV GVISSNSNC+W+P         G+V+TGALEN++ W +K+ +L   
Sbjct: 1   MVKSYQRFEQASVLGVISSNSNCIWIPAETRNAS--GQVLTGALENVNCWSMKSGDLLST 58

Query: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120
           LSDGLPPG+VD KSSKPAE ++LQ+H ET L+AAGY DGV+K+WDL+SK+VL++FNGHKS
Sbjct: 59  LSDGLPPGAVDAKSSKPAETTFLQYHPETKLLAAGYNDGVVKIWDLLSKSVLINFNGHKS 118

Query: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK 180
            IT+LKFD TGT+LISGS+DS+IIVWDLV EVGL+KLRSHK +ITGLWC+ ++WL+STSK
Sbjct: 119 AITVLKFDSTGTRLISGSKDSDIIVWDLVGEVGLFKLRSHKDSITGLWCEGEDWLVSTSK 178

Query: 181 DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240
           DGLIKVWDLKTQQC+ETH+AH GECW++G+  D VVT   D+Q+K+W +D E   GS L 
Sbjct: 179 DGLIKVWDLKTQQCVETHVAHVGECWSMGVHEDLVVTCGGDNQIKLWSVDYEKPVGSMLT 238

Query: 241 EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT 300
           E+G  EKQSKQRG+S+EFTT SDGV FF+VQNAD+TVE FRLR + EI+KA+K+REKRL+
Sbjct: 239 ERGTHEKQSKQRGVSVEFTTISDGVTFFFVQNADRTVETFRLRTEDEISKALKKREKRLS 298

Query: 301 EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY 360
           +KG+T E+I+ N+ ESY SF+MHPFQ++RS YKIKS  W ++ ++KLE+VV+T++NT++Y
Sbjct: 299 DKGLTGEEIQANLKESYTSFIMHPFQILRSPYKIKSACWAVTTTSKLEIVVSTSNNTVDY 358

Query: 361 YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC 420
           YS+PY K++P  P+P K ++I+++G RTDVR+IDISDDN LLATASNG LKIWN+ TKSC
Sbjct: 359 YSIPYNKKEPKLPSPPKIYSIDIKGHRTDVRAIDISDDNKLLATASNGSLKIWNIKTKSC 418

Query: 421 IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480
           IRTFECGYAL CKFLPGG LVV+GT+ G+L LFDLASS LL++IEAAH GAIWSLD+T D
Sbjct: 419 IRTFECGYALACKFLPGGALVVIGTKTGDLNLFDLASSTLLSSIEAAHSGAIWSLDLTAD 478

Query: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540
           GKRLVTGSADKS++FWDFQV+QEL+ GT+DK+VP++ + HD+TLEL DD+L++KIS D++
Sbjct: 479 GKRLVTGSADKSVRFWDFQVEQELVPGTTDKFVPKLKMFHDTTLELNDDVLAVKISPDNR 538

Query: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF 600
            LAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS D+K++ITSSADKNIK+WGLDF
Sbjct: 539 LLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKVWGLDF 598

Query: 601 GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA 660
           GDCHKSLFAH DSIM V FLP SHNFFS  KDG VKYWDGDKFECIQKLAAHQ EVW +A
Sbjct: 599 GDCHKSLFAHSDSIMKVAFLPESHNFFSCGKDGLVKYWDGDKFECIQKLAAHQKEVWTIA 658

Query: 661 VSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADDTFKG 720
           +S +G  VVS SHD SIR+W ETDDQVFL              TLL SLE+G  D  F G
Sbjct: 659 ISHDGTFVVSASHDQSIRVWVETDDQVFLEEEREKEMDEQYEKTLLNSLEDGAGDAMFHG 718

Query: 721 DVKNDED--DEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQRID 778
           D     +  DEAT V KQT ESLKA ERLM+A+D+G+            + +++KK+   
Sbjct: 719 DGNGGAEIGDEATDVHKQTTESLKASERLMEAMDMGMAEISNHLEYEQALKEWQKKKSGP 778

Query: 779 APVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMKVP 838
            P +P  N+IL+A+ KTP+EYIMD L  IKPSQLED+LLVLPFSYVL+FL F + V++  
Sbjct: 779 HPGRPQPNSILIAINKTPLEYIMDVLARIKPSQLEDALLVLPFSYVLEFLHFIELVIEDK 838

Query: 839 NILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFNIQ 898
           +++   L L+CKNLFFI+K+N +EL SQKNE+LK+QI R+K+ LR++++   DDLGFNIQ
Sbjct: 839 SLVRRHLPLLCKNLFFIIKANHRELFSQKNEKLKIQIDRIKYGLRNSIKAKADDLGFNIQ 898

Query: 899 GLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKKEY 933
           GLKFIKQQWN+KHNFEF DD     Q +K  K+ +
Sbjct: 899 GLKFIKQQWNLKHNFEFSDDVIISKQDKKVKKRVF 933

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 1295 bits (3350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/935 (64%), Positives = 749/935 (80%), Gaps = 4/935 (0%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXXXLGKVITGALENISVWDLKTSELEYV 60
           MVKSYQRFEQ SVFGVISSNSNC+W+P         G+V+TGALEN++ W +K+ EL   
Sbjct: 1   MVKSYQRFEQESVFGVISSNSNCLWLPAENRNST--GQVLTGALENVNCWSMKSGELIGT 58

Query: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120
           L+DGLPPG+VD KS+KPAE SYLQ+H ET L+A GY DG IK+WDL+SK+VL+SFNGHKS
Sbjct: 59  LTDGLPPGAVDAKSTKPAETSYLQYHPETRLLAVGYNDGAIKIWDLLSKSVLISFNGHKS 118

Query: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK 180
            IT+L FD+TGT+LISGS DS+IIVWDLV EVGLYKLRSHK +ITGLWC+ + WLISTSK
Sbjct: 119 AITILTFDQTGTRLISGSRDSDIIVWDLVGEVGLYKLRSHKDSITGLWCEGEEWLISTSK 178

Query: 181 DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240
           DGLIKVWDLK QQC+ETH+AH GECW++G+  D V+T+ AD+Q+K+W ++ E   GS LI
Sbjct: 179 DGLIKVWDLKVQQCVETHVAHVGECWSMGVHEDLVITAGADNQIKLWNLNFEESAGSMLI 238

Query: 241 EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT 300
           EKG  EKQS+QRG++I+FTT SD   FF++QNAD++VE FRLRK  EIAKA+K+REKRLT
Sbjct: 239 EKGTHEKQSRQRGVAIQFTTVSDETTFFFIQNADRSVETFRLRKQDEIAKALKKREKRLT 298

Query: 301 EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY 360
           EKG++E++I+ N+ +S+ SF+MHPFQ+VRS+YK++SV W  + ++KL++VVTT +NT++Y
Sbjct: 299 EKGLSEDEIQQNLKDSFTSFIMHPFQIVRSIYKVRSVCWATTTTSKLDLVVTTANNTVDY 358

Query: 361 YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC 420
           YS+ Y+KR+PT P+P K H+I+++G R+DVR+IDIS DN LLATASNG LKIWN+ T SC
Sbjct: 359 YSIKYQKREPTMPSPPKLHSIDIRGHRSDVRAIDISGDNKLLATASNGTLKIWNIKTNSC 418

Query: 421 IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480
           IRTFECGYAL CKFLPGG LVV+GT+ G+L L+DLASS LL TIE AH GAIWSLD+T D
Sbjct: 419 IRTFECGYALACKFLPGGALVVLGTKTGDLHLYDLASSTLLNTIEGAHSGAIWSLDMTTD 478

Query: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540
           GKRLVTGSADK++ FWDFQV+QE + GT+DK+ P++ + HD+TLEL DD+L++KIS D++
Sbjct: 479 GKRLVTGSADKTVCFWDFQVEQEPVPGTTDKFNPKLKMFHDTTLELNDDVLAVKISPDNR 538

Query: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF 600
            LA+SLLDNTVKVFF+DSMKFFLSLYGHKLPVLS+DIS D+K++ITSSADKNIKIWGLDF
Sbjct: 539 LLAVSLLDNTVKVFFMDSMKFFLSLYGHKLPVLSIDISFDSKLLITSSADKNIKIWGLDF 598

Query: 601 GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA 660
           GDCH+SLFAH DSIM V F+P SHNFFS SKD  VKYWDGDKFECIQKLAAHQ EVW LA
Sbjct: 599 GDCHRSLFAHNDSIMKVVFVPESHNFFSCSKDALVKYWDGDKFECIQKLAAHQKEVWTLA 658

Query: 661 VSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADDTFKG 720
           +S +G  VVS SHD SIR+W ETDDQVFL              TLL SLE G  DD F+ 
Sbjct: 659 ISSDGRFVVSASHDQSIRVWSETDDQVFLEEERERESDEQYEKTLLNSLENGAGDDMFEK 718

Query: 721 DVKNDED--DEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQRID 778
           D   D +  D+AT V KQT ESLKA E+LM+ALDLG+            + +++KK+   
Sbjct: 719 DGNGDGEITDQATDVHKQTTESLKASEKLMEALDLGMSEINNLLEYEKALKQWEKKRSGP 778

Query: 779 APVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMKVP 838
            P KP  N+IL+A+ KTP+EYIMD L+ IKPSQLED+LLVLPF+YVL FL F D V+K  
Sbjct: 779 HPGKPLPNSILVAINKTPLEYIMDVLVKIKPSQLEDALLVLPFTYVLTFLHFIDLVLKEK 838

Query: 839 NILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFNIQ 898
            +   RL LIC+NLFFI+KSN +EL SQKNEELK+Q++R+K  LR +++   DDLGFNIQ
Sbjct: 839 ELARRRLPLICRNLFFIIKSNHRELFSQKNEELKIQMNRIKDGLRKSIKAKSDDLGFNIQ 898

Query: 899 GLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKKEY 933
           GL FIKQQWNMKHNFEF DD       EK+ K+ +
Sbjct: 899 GLTFIKQQWNMKHNFEFSDDITVNKTNEKAKKRVF 933

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 1280 bits (3312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/935 (67%), Positives = 758/935 (81%), Gaps = 4/935 (0%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXX-XLGKVITGALENISVWDLKTSELEY 59
           MVKSYQRFEQS+VFGVISS +N VW+PP         G++IT ALEN+++WD+KT EL  
Sbjct: 1   MVKSYQRFEQSAVFGVISSEANNVWLPPLKGRSSGSPGQIITSALENVNIWDIKTGELIA 60

Query: 60  VLSDGLPPGSVDLK-SSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGH 118
            L DG+ PGS D K ++KPAEV++LQ+H ++ L+A GY DG IK+WDLVSKTVL++ NGH
Sbjct: 61  QLQDGITPGSADSKVNTKPAEVTFLQYHPDSSLLAVGYRDGNIKVWDLVSKTVLINLNGH 120

Query: 119 KSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSD-NWLIS 177
           KS IT+LKFD   T+L+SGS DSNII+WDLVSEVG+ KLRSHK  I+ L+ D D NWL+S
Sbjct: 121 KSSITVLKFDVNCTRLVSGSSDSNIIIWDLVSEVGICKLRSHKDRISDLYVDDDFNWLLS 180

Query: 178 TSKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGS 237
            SKDGLIKVWDLKT QC+ETHIAHTGECW+LGI  D V+T+S  SQ+K+W +DL+GE GS
Sbjct: 181 VSKDGLIKVWDLKTNQCVETHIAHTGECWSLGIKDDVVITTSNTSQIKLWSLDLDGEVGS 240

Query: 238 KLIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREK 297
           KLIEKG +EKQSKQRG S++F   S GV FF + NADKT+EIFR+R   EI +A+K+REK
Sbjct: 241 KLIEKGVYEKQSKQRGTSVKFIENSSGVAFFAIGNADKTIEIFRIRPQEEITRALKKREK 300

Query: 298 RLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNT 357
           RL EKGM +EDI+ NI ES+VS +MH FQ VRS +K+KS +WT + ++KLE+V TT+SNT
Sbjct: 301 RLKEKGMEDEDIQQNIKESFVSTMMHSFQTVRSAFKLKSFSWTFATNSKLELVATTSSNT 360

Query: 358 IEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNT 417
           IEYY++ YEKR+PT P P + +TIELQG RTD+R+ DISDDN LLATASNG LKIWNL T
Sbjct: 361 IEYYTIAYEKREPTQPAPNRLYTIELQGLRTDIRATDISDDNMLLATASNGLLKIWNLRT 420

Query: 418 KSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDV 477
           K CIRTF+CGYALTCKFLPGGLLV++GTR G LQLFDLASS  +  IE AH+ AIWSLD+
Sbjct: 421 KQCIRTFDCGYALTCKFLPGGLLVILGTRNGELQLFDLASSTQIENIEGAHDAAIWSLDL 480

Query: 478 TNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISG 537
           T++GKRLVTGSADK++KFWDFQ++Q  I GTS K   ++ + HD+TLEL DD+L +KIS 
Sbjct: 481 TSNGKRLVTGSADKTVKFWDFQLEQLPIEGTSGKSESKLTLNHDTTLELNDDVLCVKISP 540

Query: 538 DDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWG 597
           +DK LA+SLLDNTVK+FFLD+MKFFLSLYGHKLPVLS+DIS D+K++ITSSADKNIKIWG
Sbjct: 541 EDKHLAVSLLDNTVKIFFLDTMKFFLSLYGHKLPVLSIDISFDSKMVITSSADKNIKIWG 600

Query: 598 LDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVW 657
           LDFGDCHKSLFAHQDSIM VKFLP SHNFFS SKDG VKYWDGDKFEC+QKL +HQSEVW
Sbjct: 601 LDFGDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGQVKYWDGDKFECVQKLVSHQSEVW 660

Query: 658 ALAVSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADDT 717
            LA+  +G  VVS SHDHSIRIW+ET+DQVFL             +TLL SLEEG  DD 
Sbjct: 661 CLAMGLDGSFVVSTSHDHSIRIWQETEDQVFLEEEREKEMEEQYEETLLNSLEEGTGDDA 720

Query: 718 FKGDVKNDEDDEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQ-R 776
           FK D  + E DEAT V KQTIESLKA E+LMDALDLG+            M  +KKK+  
Sbjct: 721 FKKDSVDGEGDEATDVHKQTIESLKANEKLMDALDLGLTEIEAMERYNSDMALWKKKKIG 780

Query: 777 IDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMK 836
            + PVKP+GNA+LLAV+K+P +YIM+TL  IKPSQLED+LL+LPFSYVLKFLKF D V+K
Sbjct: 781 SEMPVKPSGNAVLLAVKKSPEQYIMETLARIKPSQLEDALLILPFSYVLKFLKFIDIVLK 840

Query: 837 VPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFN 896
              +L+N LALICKNLFFI+++N KEL+SQKNEELKLQI+RVK +LR+ L+ NED LGFN
Sbjct: 841 NKKMLHNYLALICKNLFFIVRTNHKELISQKNEELKLQITRVKQELRNTLKQNEDALGFN 900

Query: 897 IQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931
           IQGLKFIKQQW++KHNFEFVD+YDQ+ Q EK AKK
Sbjct: 901 IQGLKFIKQQWDLKHNFEFVDEYDQRIQEEKKAKK 935

>CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highly
           similar to uniprot|Q12220 Saccharomyces cerevisiae
           YLR129w DIP2 DOM34P-interacting protein
          Length = 940

 Score = 1268 bits (3282), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/936 (64%), Positives = 747/936 (79%), Gaps = 8/936 (0%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXXX--LGKVITGALENISVWDLKTSELE 58
           MVKSYQRFEQ++VFGVISSNSN VW+ P         LG+VI G LENI VWD+KT E  
Sbjct: 1   MVKSYQRFEQANVFGVISSNSNSVWIEPEASKRKTGNLGQVIVGGLENILVWDIKTGEQI 60

Query: 59  YVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGH 118
             L+DGLPPG+ D K SKPAE ++L++H ET L+AAGYADGVIK+WDL+SKTVL+SFNGH
Sbjct: 61  AQLTDGLPPGASDAKLSKPAETTFLKYHPETNLLAAGYADGVIKIWDLISKTVLISFNGH 120

Query: 119 KSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST 178
           KS IT+L FD TGT+LIS S+DS+IIVWDLV E GLYKLRSHK  ITGLWC+ +NWLIST
Sbjct: 121 KSAITVLAFDTTGTRLISASKDSDIIVWDLVGESGLYKLRSHKDAITGLWCEDENWLIST 180

Query: 179 SKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSK 238
           SKDGL+K+WDLK+QQC+ETH+AHTGECW+LGI+ D  VT SADSQ+K+W++DL+ E GSK
Sbjct: 181 SKDGLVKIWDLKSQQCVETHLAHTGECWSLGIIEDMAVTCSADSQVKLWKLDLQAENGSK 240

Query: 239 LIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKR 298
           L EKG  EKQSKQRG+ I+F    DGV FFY+QNADKT+EI+RLRK+ EI++A+K+REKR
Sbjct: 241 LTEKGIIEKQSKQRGVEIDFAVAPDGVKFFYIQNADKTIEIYRLRKEEEISRALKKREKR 300

Query: 299 LTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTI 358
           L +KGM+EE+IK  +  S VS + H FQVVRS YKIKS  WT+  ++KLE+VVTT++N+I
Sbjct: 301 LQDKGMSEEEIKEAMG-SPVSLMYHLFQVVRSPYKIKSAQWTVCSNSKLELVVTTSNNSI 359

Query: 359 EYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTK 418
           EYYS+PY KR+PT P P+K HTI+L G RTD+RS  ISDDN LLATASNG LKIWN+ TK
Sbjct: 360 EYYSIPYSKREPTQPAPLKLHTIDLHGQRTDIRSTSISDDNKLLATASNGSLKIWNIKTK 419

Query: 419 SCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVT 478
            CIR+FECGYALTCKFLPGG LVVVGTR G LQLFD+ASS +L   E AH+ AIWSLD+T
Sbjct: 420 RCIRSFECGYALTCKFLPGGALVVVGTRNGELQLFDIASSTMLDNKEGAHDAAIWSLDLT 479

Query: 479 NDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGD 538
           +DG++LVTGSADK+++FW F+V +  ++  S+K +P + + HD+TLEL DDILS+ IS D
Sbjct: 480 SDGRKLVTGSADKTVRFWTFEVSEVPVSDESNKTMPMLQLFHDTTLELDDDILSVVISPD 539

Query: 539 DKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGL 598
           DKF+A+SLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS D+K+I+T SADKNIKIWGL
Sbjct: 540 DKFIAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISYDSKLIVTCSADKNIKIWGL 599

Query: 599 DFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWA 658
           DFGDCHKSLFAHQDSIM VKFLP S+NFFS SKD  VKYWDG KFECIQKLAAHQSEVW+
Sbjct: 600 DFGDCHKSLFAHQDSIMNVKFLPESYNFFSCSKDATVKYWDGQKFECIQKLAAHQSEVWS 659

Query: 659 LAVSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADDTF 718
           ++VS++G  V+S  HDHSIR+WEET+DQVFL             DTLL SLE G  D+  
Sbjct: 660 ISVSNDGTFVISTGHDHSIRVWEETEDQVFLEEEREKEMDEQYEDTLLTSLEGGAGDEML 719

Query: 719 ---KGDVKNDEDDEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQ 775
              KGD  N+E +E   V KQT+ESLKAGERLM+AL++G+            +  +KK +
Sbjct: 720 SVKKGD--NEESEEVEGVHKQTVESLKAGERLMEALEIGVNDIIAMEEFNEQLNAWKKSK 777

Query: 776 RIDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVM 835
           +   P++P  N +L+A++KTP EYI++TL+ IKPSQ+ED+L+V+PFSY+LKFLKF D V 
Sbjct: 778 KGIQPIRPQENTLLVALKKTPEEYIIETLVKIKPSQIEDALMVMPFSYILKFLKFIDVVT 837

Query: 836 KVPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGF 895
               +L   ++L+CK LFF+++ N KELV+QKN  LKLQI+RVK  LR +L++N D+LGF
Sbjct: 838 TKAALLQKHISLVCKTLFFVIRFNYKELVAQKNANLKLQITRVKDNLRKSLKSNVDELGF 897

Query: 896 NIQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931
           NI+G+KFIKQQW + H+ EF D+Y+++   EK +KK
Sbjct: 898 NIEGMKFIKQQWELNHHLEFNDEYEEKNFEEKHSKK 933

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 1247 bits (3227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/932 (64%), Positives = 751/932 (80%), Gaps = 2/932 (0%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXXXLGKVITGALENISVWDLKTSELEYV 60
           MV SYQRFEQ S FGVI+SNSNCVW+P         G++IT +LENI+ WD+KT  L   
Sbjct: 1   MVNSYQRFEQRSFFGVIASNSNCVWIPTEGSRTSP-GQIITSSLENINCWDIKTGNLLKT 59

Query: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120
           LSD +PPGS+D K  KPAEV+YL++H ET L+AAGYADGVIK+WD+ ++TVL+ FN H +
Sbjct: 60  LSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGYADGVIKIWDMQTQTVLIIFNSHTA 119

Query: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK 180
            IT LKFD +GT+LISGS DSNII+WDLV EVGL KLRSHK +ITG+W ++D+WLISTSK
Sbjct: 120 AITFLKFDPSGTRLISGSRDSNIIIWDLVGEVGLCKLRSHKDSITGIWFENDDWLISTSK 179

Query: 181 DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240
           DGLIKVWD+K+QQC+ETH+AHT ECW+L I  D VVT++ADS+LKIW++DLE E GSKL 
Sbjct: 180 DGLIKVWDIKSQQCVETHMAHTTECWSLAISDDLVVTANADSELKIWELDLERENGSKLK 239

Query: 241 EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT 300
           EKG +EKQS+QR + ++  T  D V FFYVQNADKT E+FR+R   E++KA+K+REKRL 
Sbjct: 240 EKGIYEKQSRQRSVDVKIVTNPDEVKFFYVQNADKTTEVFRIRTSSELSKALKKREKRLK 299

Query: 301 EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY 360
           EKG++E++I+  I  S+V+ ++ PFQVVRS +K KS AWT    +KLE+V TT++NTIEY
Sbjct: 300 EKGISEDEIQEKIKSSFVNDIIQPFQVVRSSFKFKSAAWTRCSLSKLELVFTTSNNTIEY 359

Query: 361 YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC 420
           YS+PY+ + PT     K +TIELQG RTDVRSIDIS+DN LLA ASNG LKIWN+ T+SC
Sbjct: 360 YSIPYKNQKPTQVAASKLYTIELQGHRTDVRSIDISEDNKLLAAASNGMLKIWNITTQSC 419

Query: 421 IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480
           IRTF+CGYAL CKFLPGG LVVVGTR G LQLFDLASS++L   EAAH+ AIWSLD+T+D
Sbjct: 420 IRTFDCGYALCCKFLPGGTLVVVGTRGGELQLFDLASSIVLENKEAAHDAAIWSLDLTSD 479

Query: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540
           G+RL+TGSADK++KFW+FQV++ELI+ ++DKY  ++ +VHD+TLELG+DILS+KIS +D+
Sbjct: 480 GRRLITGSADKTVKFWNFQVEKELISSSTDKYNSRLQMVHDTTLELGEDILSVKISPEDR 539

Query: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF 600
           FLA+SLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS D+K+IITSSADKNIKIWGLDF
Sbjct: 540 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSIDISYDSKLIITSSADKNIKIWGLDF 599

Query: 601 GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA 660
           GDCH+SLFAHQD+IM VKF+P SHNFFS  KDG +KYWDG KF+CIQKL AH+SEVWALA
Sbjct: 600 GDCHRSLFAHQDAIMNVKFVPQSHNFFSCGKDGVIKYWDGVKFDCIQKLIAHKSEVWALA 659

Query: 661 VSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADDTFKG 720
           +S +G+  VSVSHD SIR+WEET+DQVFL             + LL++LE   +D+ F  
Sbjct: 660 LSSDGQFFVSVSHDRSIRVWEETEDQVFLEEEREKEMDEQYEEKLLSTLENDASDEKFAR 719

Query: 721 DVKNDED-DEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQRIDA 779
           + + D D  E T V KQTIESLKAGERLM+ALDLGI            ++ + K +  D 
Sbjct: 720 NSEEDTDVTEVTDVHKQTIESLKAGERLMEALDLGISELEAQEEYHRNLLLWNKNKSGDQ 779

Query: 780 PVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMKVPN 839
           P+KP  N+IL+AV K P EYIMDTL+ IKP+QLED+LLVLPFSYVLKFLKF D  ++   
Sbjct: 780 PMKPQSNSILIAVNKLPEEYIMDTLVRIKPAQLEDALLVLPFSYVLKFLKFIDASIEKKQ 839

Query: 840 ILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFNIQG 899
           ++NN L LIC+NL +++K N KEL++QKNEELKLQI++VK +LR+AL+ N DDLGFNI+G
Sbjct: 840 LVNNHLPLICRNLLYVVKINHKELIAQKNEELKLQINKVKDKLRAALKGNIDDLGFNIEG 899

Query: 900 LKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931
           LKFIKQQWN+KHNFEFVD+YDQ+    KS+KK
Sbjct: 900 LKFIKQQWNVKHNFEFVDEYDQRDAETKSSKK 931

>AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR129W
           (DIP2)
          Length = 935

 Score = 1229 bits (3180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/935 (62%), Positives = 744/935 (79%), Gaps = 10/935 (1%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXXXLGKVITGALENISVWDLKTSELEYV 60
           MVKSYQRFEQ+ VFGV+++NSNCVW+P         G+VITGALE +  W++KT EL   
Sbjct: 1   MVKSYQRFEQADVFGVVTANSNCVWLPSQAKNSP--GQVITGALEEVKCWEIKTGELLKT 58

Query: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120
           + DGLPPG++D K+ KPAE +YLQ+H ET ++A GYADG IK+WD+ ++TVL+ F+ H S
Sbjct: 59  MRDGLPPGAIDTKAEKPAEATYLQYHEETFILAVGYADGTIKIWDMQTQTVLIVFHSHSS 118

Query: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK 180
            IT+L+FD+TGT+LISGS D+ II+WDLV+E GL KLRSHK  ITG+WC++D+WLIS SK
Sbjct: 119 AITILRFDQTGTRLISGSRDATIILWDLVAETGLCKLRSHKDAITGIWCENDDWLISVSK 178

Query: 181 DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240
           DGLIK+WD+K  QC+ETH+AHTGECW+L +  + V+T++A+S++K+W++DLE   GS L+
Sbjct: 179 DGLIKLWDMKVHQCVETHMAHTGECWSLAVKDNMVITANAESEIKLWELDLERPNGSMLL 238

Query: 241 EKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLT 300
           EKG++EKQSKQR   + FTT +DG  FFY  N+DKT+EIFR+R + EIAKA+K+REKR  
Sbjct: 239 EKGSYEKQSKQRCTELSFTTVADGTTFFYSLNSDKTMEIFRIRSETEIAKALKKREKRFK 298

Query: 301 EKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEY 360
           EKGM++E+I+ +   SY + ++HPFQ+VRS++K+K+ +WT+   +KLE+V+TT +NTIEY
Sbjct: 299 EKGMSDEEIQESFRNSYANLLLHPFQLVRSLFKLKASSWTVCTPSKLELVITTANNTIEY 358

Query: 361 YSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC 420
           YS+PY+K++P  PT IK H+IE  G RTD+R+ DIS D+ LLATASNG LK+WN+ TK+C
Sbjct: 359 YSIPYKKKEPLQPTAIKLHSIESPGHRTDLRAADISSDDKLLATASNGNLKVWNIKTKTC 418

Query: 421 IRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480
           IR  +CGYAL CKFLPGG LV++GTR G LQLFDLASS +L  IE AH  AIWSLD+T+D
Sbjct: 419 IRNLDCGYALCCKFLPGGALVILGTRAGQLQLFDLASSTMLENIEEAHTAAIWSLDLTSD 478

Query: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540
           GKRLVT SADK++KFWDF+V+QEL+AGT DK+VP+M ++HD+TL+LG+D+  +KIS +D+
Sbjct: 479 GKRLVTASADKTVKFWDFKVEQELVAGTLDKFVPKMKLIHDTTLDLGEDLWCVKISPEDR 538

Query: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF 600
           FLA+SLLDNTVKVFFLDSMKFFLSLYGHKLPVLS+DIS D+K+IITSSADKNIKIWGLDF
Sbjct: 539 FLAVSLLDNTVKVFFLDSMKFFLSLYGHKLPVLSMDISHDSKLIITSSADKNIKIWGLDF 598

Query: 601 GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALA 660
           GDCHKSLFAHQDSIM VKFLP SHNFFS SKDG VKYWDG+ F+CIQKL  HQ EVWALA
Sbjct: 599 GDCHKSLFAHQDSIMNVKFLPESHNFFSCSKDGTVKYWDGNSFDCIQKLYGHQGEVWALA 658

Query: 661 VSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADDTFKG 720
           VS +G+ VVSVSHD SIR+WEET+DQVFL              TLL SLE G+ DD F  
Sbjct: 659 VSSDGQAVVSVSHDRSIRVWEETEDQVFLEEEREKELEEQYEKTLLTSLEGGSGDDAF-- 716

Query: 721 DVKNDEDD----EATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQR 776
            + N+ D+    E+T V KQTIESLKAGERLM+ALDLGI            M  + KK  
Sbjct: 717 -ISNNGDETAGVESTEVHKQTIESLKAGERLMEALDLGITEIDAWEKYEQQMKLWNKKLG 775

Query: 777 IDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVMK 836
            D P KP  NAIL A+ KTP  Y+M+TL  IKPSQLED+LLVLPFSYVLKFLKF D  +K
Sbjct: 776 -DQPTKPQTNAILAALDKTPEAYVMETLSKIKPSQLEDALLVLPFSYVLKFLKFIDIAIK 834

Query: 837 VPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGFN 896
              IL+ +L L+CK L F+++SN KELVSQKNEELK+QI+RVK QLR+AL+++ DDLGFN
Sbjct: 835 NDVILHKQLPLLCKILIFVVRSNHKELVSQKNEELKMQINRVKDQLRAALRSHVDDLGFN 894

Query: 897 IQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931
           IQGLKF++  WN+ HN++F D+YDQ A+ +  +KK
Sbjct: 895 IQGLKFVRNHWNVNHNYDFNDEYDQLAKEKVHSKK 929

>KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 936

 Score = 1175 bits (3040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/936 (61%), Positives = 727/936 (77%), Gaps = 12/936 (1%)

Query: 1   MVKSYQRFEQSSVFGVISSNSNCVWVPPXXXXXXXLGKVITGALENISVWDLKTSELEYV 60
           MVKSYQRFEQS +FG+IS+++  +++P         GK+ITGALENI +W LKT+E+E V
Sbjct: 1   MVKSYQRFEQSGLFGLISTSNQSIYLPATNSTS---GKLITGALENIQIWTLKTNEVE-V 56

Query: 61  LSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS 120
           L+DGLP G+V+   SKP+ V+ + FH ET L+  GY DGVIK+WDL+SK+VL+ FNGHKS
Sbjct: 57  LTDGLPIGAVETNISKPSVVTAMCFHKETELLCVGYEDGVIKVWDLLSKSVLMQFNGHKS 116

Query: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSD-NWLISTS 179
            +T+L+ D  GT+L+SGS+DS++I+WDLV EVGL KLRSHK  ITG+W D + +WLIS +
Sbjct: 117 GVTVLRLDSEGTRLVSGSKDSDLIIWDLVGEVGLMKLRSHKDAITGIWIDHNMDWLISVA 176

Query: 180 KDGLIKVWDLKTQ-QCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSK 238
           KDGLIKVWDLK   QC+ETH+AHTG+CW++ I  + ++T+S DSQ KIW++DLE   G K
Sbjct: 177 KDGLIKVWDLKAGGQCVETHMAHTGQCWSMAIDEEVIITTSMDSQAKIWELDLEKSNGEK 236

Query: 239 LIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKR 298
           + E+G FE +SKQRG+S EF T  +G  FFY+QN DKT+EIFR+R + EI KA+ RREKR
Sbjct: 237 ISERGTFETESKQRGVSTEFITAPNGTRFFYIQNNDKTIEIFRIRPEEEIRKALNRREKR 296

Query: 299 LTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTI 358
           L +KG +EE+I+  ++ + +S + H F  VRS YKIKS  W  + ++KLEVV+TT++NTI
Sbjct: 297 LRDKGASEEEIQEAVNPNDISVLFHSFSTVRSSYKIKSSNWIQASNSKLEVVLTTSNNTI 356

Query: 359 EYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTK 418
           E Y +PY KRD  +  P++ + +ELQG RTD+RS+DISDD  LL+TASNGELK+WNL TK
Sbjct: 357 ESYQIPYSKRD--AEPPVRRYNVELQGHRTDIRSMDISDDGKLLSTASNGELKVWNLTTK 414

Query: 419 SCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVT 478
            CIRTF CGYAL  + LPGGLLVVVGTR+G LQLFDLASS LL+T EA H  AIWSLD+T
Sbjct: 415 KCIRTFSCGYALCSQMLPGGLLVVVGTRQGELQLFDLASSTLLSTTEA-HTAAIWSLDLT 473

Query: 479 NDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGD 538
           ++GKRLVTGSADKS KFWDF+V ++L+ GT DKY+PQ+ +VHD+TLEL DDIL++KIS +
Sbjct: 474 SNGKRLVTGSADKSCKFWDFEVVEQLVPGTKDKYIPQLKLVHDTTLELTDDILAVKISSE 533

Query: 539 DKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGL 598
           D++LA+SLLDNTVKVFF DS+KF+LSLYGHKLPVLS+D S D+K++ITSSADKNIKIWG+
Sbjct: 534 DRYLAVSLLDNTVKVFFFDSLKFYLSLYGHKLPVLSIDFSVDSKMLITSSADKNIKIWGV 593

Query: 599 DFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWA 658
           DFGDCHKS+FAHQDSIM V+F   +HNFFS  KDG VK WDGDKF+CIQKL  HQSEVW 
Sbjct: 594 DFGDCHKSIFAHQDSIMSVRFEADTHNFFSCGKDGAVKRWDGDKFDCIQKLNGHQSEVWC 653

Query: 659 LAVSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLASLEEGNADDTF 718
           +AVS +G  VVS SHDHSIR+W+ETDDQVFL             +TLL SLE G+ DD F
Sbjct: 654 IAVSPDGRTVVSTSHDHSIRVWQETDDQVFLEEEKEREMEEEYEETLLKSLEGGSGDDQF 713

Query: 719 KGDVKNDED---DEATRVSKQTIESLKAGERLMDALDLGIKXXXXXXXXXXXMVKYKKKQ 775
             D  + +D   DE + V+KQT+ESLKAGE+LM+ALDLG+            +  +KKK+
Sbjct: 714 LRDKNSGDDGVIDEVSGVNKQTLESLKAGEKLMEALDLGVAEIESWENYEKSLKSWKKKK 773

Query: 776 RIDAPVKPTGNAILLAVRKTPVEYIMDTLIGIKPSQLEDSLLVLPFSYVLKFLKFFDYVM 835
             + P+KP  NAIL+A++  P +YIMDTL  IKPSQLEDSLLVLPFSYV+KF KFFD +M
Sbjct: 774 SGEPPMKPQSNAILIAMKIKPEKYIMDTLGKIKPSQLEDSLLVLPFSYVIKFFKFFDVIM 833

Query: 836 KVPNILNNRLALICKNLFFILKSNSKELVSQKNEELKLQISRVKHQLRSALQTNEDDLGF 895
           K  +++   L+LICK LFFI+++N+KELV+QKNEELK +I RVK  +R+ LQ N DDLGF
Sbjct: 834 KQKDLVLLHLSLICKILFFIVRTNNKELVAQKNEELKQRIERVKTNIRTMLQKNADDLGF 893

Query: 896 NIQGLKFIKQQWNMKHNFEFVDDYDQQAQAEKSAKK 931
           NI GL FIKQQWN++HN EF DDY Q    +K AKK
Sbjct: 894 NIAGLNFIKQQWNLRHNLEFTDDYSQLEHEKKVAKK 929

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  132 bits (331), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 132/597 (22%), Positives = 244/597 (40%), Gaps = 95/597 (15%)

Query: 124 MLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL----WCDSDNWLISTS 179
           +L  D T T L  G  D +I++ D+ +    + L+ H GTI+ L      DS+ WL+++ 
Sbjct: 107 ILDTDPTSTLLAVGGTDGSIVIVDIENGYITHSLKGHGGTISSLKFYGQLDSETWLLASG 166

Query: 180 -KDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDF--------VVTSSADSQLKIWQMD 230
             +G++KVWDL  ++C+ T   H+     L I+           +++   D  + +W  D
Sbjct: 167 DTNGMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVNVWDFD 226

Query: 231 LEGEPGSKLIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAK 290
           ++ +   KL++     +Q +  G    F    DG    Y    D    IF+L  D+E   
Sbjct: 227 MKKK--CKLVKTLPVNQQVESCG----FLKNHDGKRIIYTAGGDA---IFQL-IDLESGT 276

Query: 291 AIKRREKRLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKL--- 347
            +KR  K + E  +       N SE ++       Q++     +++   T++  + +   
Sbjct: 277 VLKRTNKPIEELFIIGVLPIMNDSEMFLVMSDQTLQLINIEEVLENENDTINARSTIAGN 336

Query: 348 ---------------EVVVTTNSNTIEYYSVP-YEKRDPTSPTPIKAHTIELQGSRTDVR 391
                          ++ + TNS ++    +P     D + P  ++ +    +G    + 
Sbjct: 337 NGIIADMRFVGPELNKLALATNSPSLRIIPIPDLSGADASLPLDVEIY----EGHEDLLN 392

Query: 392 SIDISDDNALLATASNGELKI-WNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNL 450
           S+D ++D   +ATAS     I W  N ++                               
Sbjct: 393 SLDATEDGLWIATASKDNTAILWKYNERT------------------------------- 421

Query: 451 QLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKR-----LVTGSADKSIKFWDFQVKQELI 505
             FD+ +  +       H  A+ ++ + N   +     L+T S D +IK W       ++
Sbjct: 422 SKFDIYAKYI------GHSSAVTAVGLPNVMPKGYPEFLLTASNDLTIKKWKVPKPTSIM 475

Query: 506 AGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSL 565
                K        H+       DI ++ +S +D   A +  D T K++ L++ +   +L
Sbjct: 476 DVQIIKVSEYTRHAHEK------DINALSVSPNDSIFATASYDKTCKIWSLENGELEATL 529

Query: 566 YGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN 625
             HK  +  +      K++ TSS DK +KIW LD     K+L  H +++    F+     
Sbjct: 530 ANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHSNAVQRCSFINKQKQ 589

Query: 626 FFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEE 682
             S   DG +K WD    EC+  L  H + +WAL   ++G+ +VS   D   + W++
Sbjct: 590 LVSCGADGLIKIWDCSSGECLNTLDGHNNRLWALNTMNDGDMIVSADADGVFQFWKD 646

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 68/159 (42%), Gaps = 3/159 (1%)

Query: 73  KSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGT 132
           + +   +++ L       + A    D   K+W L +  +  +   HK  +  + F +   
Sbjct: 487 RHAHEKDINALSVSPNDSIFATASYDKTCKIWSLENGELEATLANHKRGLWDVSFCQYDK 546

Query: 133 QLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGLIKVWDLKT 191
            L + S D  + +W L +   +  L  H   +    + +    L+S   DGLIK+WD  +
Sbjct: 547 LLATSSGDKTVKIWSLDTFSVMKTLEGHSNAVQRCSFINKQKQLVSCGADGLIKIWDCSS 606

Query: 192 QQCIETHIAHTGECWALGIMT--DFVVTSSADSQLKIWQ 228
            +C+ T   H    WAL  M   D +V++ AD   + W+
Sbjct: 607 GECLNTLDGHNNRLWALNTMNDGDMIVSADADGVFQFWK 645

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 40/73 (54%), Gaps = 6/73 (8%)

Query: 82  YLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKF------DKTGTQLI 135
           Y Q  SET L+A+G  +G++K+WDLV +  LL+   H S +  L        D +  +L+
Sbjct: 153 YGQLDSETWLLASGDTNGMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLL 212

Query: 136 SGSEDSNIIVWDL 148
           SG  D  + VWD 
Sbjct: 213 SGGRDDIVNVWDF 225

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 100/239 (41%), Gaps = 25/239 (10%)

Query: 453 FDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKY 512
            DL +S    ++   + G+     V+ DGK L T   D+ I   D  +            
Sbjct: 1   MDLKTSYRGVSLNPIYAGSSAVATVSEDGKILATPILDE-INIIDLTLGCR--------- 50

Query: 513 VPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPV 572
                I+H  + E   +I +++++ D ++LA       +K+F L + +   SL     P 
Sbjct: 51  ----KILHKISNEDEQEITALRLTPDGQYLAYVSQAQLLKIFQLKTGRIVRSLKISS-PS 105

Query: 573 LSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLP--GSHNFFSAS 630
             LD    + ++     D +I I  ++ G    SL  H  +I  +KF     S  +  AS
Sbjct: 106 YILDTDPTSTLLAVGGTDGSIVIVDIENGYITHSLKGHGGTISSLKFYGQLDSETWLLAS 165

Query: 631 KD--GFVKYWDGDKFECIQKLAAHQSEVWALAV----SDNGE--RVVSVSHDHSIRIWE 681
            D  G VK WD  K +C+  L  H S V  L +    S +G   +++S   D  + +W+
Sbjct: 166 GDTNGMVKVWDLVKRKCLLTLQEHSSAVRGLDIIEGESGDGSSLKLLSGGRDDIVNVWD 224

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 152/709 (21%), Positives = 286/709 (40%), Gaps = 98/709 (13%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           +V+ L+   +   +     + +++ +DL +K    S     S   +L  D++ T L  G 
Sbjct: 62  DVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMK-ISSPAYVLDCDESSTLLAVGG 120

Query: 139 EDSNIIVWDLVSEVGLYKLRSHKGTITGL----WCDSDNWLISTS-KDGLIKVWDLKTQQ 193
            D ++ V+D+ +    + L+ H  TI+ +      DS  WL+++   +G++K+WDL  ++
Sbjct: 121 TDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWDLVKRR 180

Query: 194 CIETHIAHTGECWALGIMTD-----FVVTSSADSQLKIWQMDLEGEPGSKLIEKGAFEKQ 248
           CI T   HT     L I         +++   D  + +   D++ +   KL++    ++Q
Sbjct: 181 CIHTVQEHTAAVRGLDIRVQEGAESLLLSGGRDDVVHVHHFDMKKK--CKLLQTIPVKRQ 238

Query: 249 SKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLTEKGMTEED 308
            +  G         D     Y    D   +I  L    E  K+IK+  + + E  +    
Sbjct: 239 IESCGF------IGDNTSLIYTAGGDAVYQIISL----ESGKSIKQTAQPVEELFIVGVL 288

Query: 309 IKTNISESYVSF---------VMHPFQVVRSMYKI-KSVAWTLSLSTKLEVV-------- 350
              N ++ Y+           V         M +I K +A        + +V        
Sbjct: 289 PVQNSTKCYLVLSDQTLFLIDVEKALSQTEKMIEIEKKIAGNHGTIADMRLVGPSLNRLA 348

Query: 351 VTTNSNTIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATAS-NGE 409
           + TNS T+     P    D      ++  T   +G    + S+D + D   LATAS +  
Sbjct: 349 LATNSPTLRIIPTPQASEDKEV---MEIETEMYEGHTDLLNSLDATSDGLWLATASKDHS 405

Query: 410 LKIWNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHE 469
           + +W  N  S   +FE       KFL                                H 
Sbjct: 406 VILWRYNEASS--SFEP----FTKFL-------------------------------GHA 428

Query: 470 GAIWSLDVTNDGKR-----LVTGSADKSIKFWDFQVKQELIAGTSDKY---VPQMNIVHD 521
           G + ++ + N   R     L+T S D +IK W        +   +D+    +P +    +
Sbjct: 429 GPVTAIALPNVMNRNWPEFLLTASNDLTIKRWK-------VPNPNDRKAIELPHIVKASE 481

Query: 522 STLELGD-DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDD 580
            T    + DI +I +S +D   A +  D T K++ +D+ +   +L  HK  +  +   + 
Sbjct: 482 YTRRAHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEY 541

Query: 581 TKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDG 640
             ++ T S D++I +W L+     K+L  H +++  V F+ G+    S   DG VK WD 
Sbjct: 542 DWLLATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDC 601

Query: 641 DKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXX 700
              EC++ L AH + +WALAV+++G+ +++   D   + WE+  ++              
Sbjct: 602 STGECVRTLDAHNNRIWALAVANDGQLIITADADGVFQFWEDNSEEEHERNIEQEKLRVE 661

Query: 701 XXDTLLASLEEGNADDTFKGDVKNDEDDEATRVSKQTIESLKAGERLMD 749
              +L   + EG+ ++ F   +  D       V ++ I   + GE + +
Sbjct: 662 QEQSLQNYISEGDWNNAFLLAMTLDHPMRLYHVLERAIAKAQGGEAIFN 710

 Score = 71.6 bits (174), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 77/165 (46%), Gaps = 3/165 (1%)

Query: 73  KSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGT 132
           + +   +++ +       + A    D   K+W++ +  V  +   HK  +  + F +   
Sbjct: 484 RRAHEKDINAISMSPNDSIFATASYDKTCKIWNVDTGEVEATLANHKRGLWGVAFCEYDW 543

Query: 133 QLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGLIKVWDLKT 191
            L + S D +I +W L S   L  L  H   +  + + + +  L+ST  DGL+K+WD  T
Sbjct: 544 LLATCSGDRSINLWSLESFTVLKTLEGHTNAVQRVSFINGNKQLVSTGADGLVKIWDCST 603

Query: 192 QQCIETHIAHTGECWALGIMTD--FVVTSSADSQLKIWQMDLEGE 234
            +C+ T  AH    WAL +  D   ++T+ AD   + W+ + E E
Sbjct: 604 GECVRTLDAHNNRIWALAVANDGQLIITADADGVFQFWEDNSEEE 648

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 65/148 (43%), Gaps = 5/148 (3%)

Query: 518 IVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDI 577
           I+H    E   D+ +++++ D ++L  +  +  ++ + L++ +   S+     P   LD 
Sbjct: 51  IIHKIENEDEQDVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISS-PAYVLDC 109

Query: 578 SDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFL----PGSHNFFSASKDG 633
            + + ++     D ++ ++ +  G    SL  H  +I  VKF      G     S   +G
Sbjct: 110 DESSTLLAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNG 169

Query: 634 FVKYWDGDKFECIQKLAAHQSEVWALAV 661
            VK WD  K  CI  +  H + V  L +
Sbjct: 170 MVKIWDLVKRRCIHTVQEHTAAVRGLDI 197

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 71/162 (43%), Gaps = 25/162 (15%)

Query: 459 VLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQEL--IAGTSDKYVPQM 516
            ++  IE   E  + +L +T DG+ L   S ++ ++F+D + K+    +  +S  YV  +
Sbjct: 50  AIIHKIENEDEQDVTALRLTPDGRYLCYASQNQLLRFYDLETKRTTRSMKISSPAYV--L 107

Query: 517 NIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLD 576
           +    STL                 LA+   D +V VF + +     SL GH   + S+ 
Sbjct: 108 DCDESSTL-----------------LAVGGTDGSVNVFDIANGYVTHSLKGHGATISSVK 150

Query: 577 ISD--DTKVIITSSADKN--IKIWGLDFGDCHKSLFAHQDSI 614
                D+ + + +S D N  +KIW L    C  ++  H  ++
Sbjct: 151 FYGEVDSGMWLLASGDTNGMVKIWDLVKRRCIHTVQEHTAAV 192

>Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {ON}
           YLR222C (REAL)
          Length = 818

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 141/601 (23%), Positives = 245/601 (40%), Gaps = 102/601 (16%)

Query: 124 MLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL----WCDSDNWLISTS 179
           +L  D T T L  G  D +IIV D+ +    + L+ H GTI+ L      DS  WL+++ 
Sbjct: 107 ILDTDSTSTLLAVGGTDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLASG 166

Query: 180 -KDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDFVVTSSADSQLKI-----------W 227
             +G++KVWDL  ++C+ T   HT     L I    V  +   S LK+           W
Sbjct: 167 DTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDITE--VENNDGPSHLKLISGGRDDIVNFW 224

Query: 228 QMDLEGEPGSKLIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIE 287
             D++ +   KLI+     +Q +  G    F  T DG H  Y    D    IF+L  D+E
Sbjct: 225 DFDMKKK--CKLIKTLPVNQQVESCG----FLNTRDGKHIIYTAGGDA---IFQLI-DLE 274

Query: 288 IAKAIKRREKRLTEKGMTEEDIKTNISESYVSFVM--HPFQVVRSMYKIKSVAWTLSLST 345
               +KR  K + E  +    +   +S+S +  VM     Q++     ++S    +   +
Sbjct: 275 SGSMLKRTNKPIEELYII--GVLPIMSDSKMFLVMSDQTLQLINIEEALESKEEIIQAES 332

Query: 346 KL------------------EVVVTTNSNTIEYYSVPYEKRDPTSPTPIKAHTIELQGSR 387
            +                  ++ + TNS  +    +P +     S  P+     E  G  
Sbjct: 333 SIAGNHGIIADMRFVGPELNKLALATNSPALRIIPIP-DLTSTESSLPLDVEIYE--GHE 389

Query: 388 TDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTR 446
             + S+D ++D   +ATAS +    +W  N  +                           
Sbjct: 390 DLLNSLDATEDGLWIATASKDNSAIVWKYNNDT--------------------------- 422

Query: 447 EGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKR-----LVTGSADKSIKFWDFQVK 501
                 FD+ +  +       H  A+ ++ + N   +     L+T S D +IK W     
Sbjct: 423 ----SKFDIYAKYI------GHSSAVTAVGLPNVMPKGYPEFLLTASNDLTIKKW----- 467

Query: 502 QELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKF 561
            ++   TS   V  + +   +      DI ++ +S +D   A +  D T K++ L++ + 
Sbjct: 468 -KIPKPTSTNDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGEL 526

Query: 562 FLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLP 621
             +L  HK  +  +      K++ T S DK +KIW L+     K+L  H +++    F+ 
Sbjct: 527 EATLANHKRGLWDVSFCQYDKLLATCSGDKTVKIWSLETFSVMKTLEGHTNAVQRCSFIN 586

Query: 622 GSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
                 S   DG +K WD    EC++ L  H + +WAL   ++G+ +VS   D   + W+
Sbjct: 587 KQKQLVSCGADGLIKIWDCYSGECLKTLDGHNNRLWALNTMNDGDTIVSADADGIFQFWK 646

Query: 682 E 682
           +
Sbjct: 647 D 647

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/153 (24%), Positives = 68/153 (44%), Gaps = 3/153 (1%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           +++ L       + A    D   K+W+L +  +  +   HK  +  + F +    L + S
Sbjct: 494 DINALSVSPNDSIFATASYDKTCKIWNLENGELEATLANHKRGLWDVSFCQYDKLLATCS 553

Query: 139 EDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGLIKVWDLKTQQCIET 197
            D  + +W L +   +  L  H   +    + +    L+S   DGLIK+WD  + +C++T
Sbjct: 554 GDKTVKIWSLETFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCYSGECLKT 613

Query: 198 HIAHTGECWALGIMT--DFVVTSSADSQLKIWQ 228
              H    WAL  M   D +V++ AD   + W+
Sbjct: 614 LDGHNNRLWALNTMNDGDTIVSADADGIFQFWK 646

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 58/240 (24%), Positives = 101/240 (42%), Gaps = 26/240 (10%)

Query: 453 FDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKY 512
            DL +S    ++   + G+     V+ DGK L T   D+ I   D          T+D  
Sbjct: 1   MDLKTSYKGVSLNPIYAGSSAVATVSEDGKILATPILDE-INIIDL---------TAD-- 48

Query: 513 VPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPV 572
                I+H  + E   +I +++++ D ++L        +K+F L + K   S+     P 
Sbjct: 49  --SRKILHKISNEDEQEITALQLTPDGQYLTYVSQAQLLKIFQLKTGKVVRSMKISS-PS 105

Query: 573 LSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLP--GSHNFFSAS 630
             LD    + ++     D +I +  ++ G    SL  H  +I  +KF     S  +  AS
Sbjct: 106 YILDTDSTSTLLAVGGTDGSIIVVDIENGYITHSLKGHGGTISSLKFYGQLDSKVWLLAS 165

Query: 631 KD--GFVKYWDGDKFECIQKLAAHQSEVWALAVS--DNGE-----RVVSVSHDHSIRIWE 681
            D  G VK WD  K +C+  L  H S V  L ++  +N +     +++S   D  +  W+
Sbjct: 166 GDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDITEVENNDGPSHLKLISGGRDDIVNFWD 225

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 7/74 (9%)

Query: 82  YLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDK-------TGTQL 134
           Y Q  S+  L+A+G  +G++K+WDLV +  L +   H S +  L   +       +  +L
Sbjct: 153 YGQLDSKVWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDITEVENNDGPSHLKL 212

Query: 135 ISGSEDSNIIVWDL 148
           ISG  D  +  WD 
Sbjct: 213 ISGGRDDIVNFWDF 226

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score =  128 bits (321), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 155/651 (23%), Positives = 266/651 (40%), Gaps = 118/651 (18%)

Query: 72  LKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKF---- 127
           LK S P+ +  +   S + L+A G  DG I + D+ +  +  SF GH   I+ +KF    
Sbjct: 115 LKLSSPSYI--MDCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNN 172

Query: 128 DKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDS-----DN---WLISTS 179
           D     L SG  +  + +WDLV    ++ L+ H   + GL   S     DN    L+S S
Sbjct: 173 DTNCWLLCSGDTNGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGS 232

Query: 180 KDGLIKVWDLKTQQCIE--THIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGS 237
           +D ++ +W+   ++  +    +    +  + G + D       D++L+       GE   
Sbjct: 233 RDNIVNLWEFNLRKLCKLLKTLPVNQQVESCGFIHDH------DNELQDIIYTAGGEAIF 286

Query: 238 KLI--EKGAFEKQSKQRGL------SIEFTTTSDGVHFFYVQNADKTVEIFRLRKDI--- 286
           +LI   KG+  K++ +         ++ FT T++ ++ + V  +D+T+++  L K +   
Sbjct: 287 QLISLSKGSVIKRTVKPTEELFIIGTLPFTATNNDLNSYIVM-SDQTLQMINLTKALSPT 345

Query: 287 EIAKAIKRREKRLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTK 346
           E++  I   E  +     T  D+K         FV                         
Sbjct: 346 ELSNPIIEIESCIAGNHGTIADMK---------FVGQDLN-------------------- 376

Query: 347 LEVVVTTNSNTIEYYSVPYEKRDPTSPT--------PIKAHTIELQGSRTDVRSIDISDD 398
            ++ + TNS T+    VP   ++   P         PI   T E  G    + S+  ++D
Sbjct: 377 -KLALATNSPTLRIIPVPSTMKEAADPNTQDNSADLPINMETYE--GHTDLLNSLAATED 433

Query: 399 NALLATASNGELKI-WNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLAS 457
              LATAS     I W  ++++  R F   YA   KF+                      
Sbjct: 434 GQWLATASKDHTSILWKYSSETS-RFF--AYA---KFI---------------------- 465

Query: 458 SVLLTTIEAAHEGAIWSLDVTNDGKR-----LVTGSADKSIKFWDFQVKQELIAGTSDKY 512
                     H  ++ ++ + N   R     L+T S D +IK W      +  +    K 
Sbjct: 466 ---------GHSSSVTAVGLPNVLLRGYPEFLITASNDLTIKKWKIPTPSKERSDDESKD 516

Query: 513 VPQMNIVHDSTLELGD-DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLP 571
              +  V + T    D DI SI IS +D  +A    D + K++ LDS +   +L  HK  
Sbjct: 517 KTHIIKVSEYTRHAHDKDINSISISPNDSLIATGSYDKSCKLWNLDSGELVATLNNHKRG 576

Query: 572 VLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASK 631
           +  +      K+I T S DK IK+W LD     K+   H +++    F+       S+  
Sbjct: 577 IWDVSFCQFDKLIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGA 636

Query: 632 DGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEE 682
           DG +K WD    +C++ L  H + +WAL   ++GE +VS   D  ++ W +
Sbjct: 637 DGLIKIWDCTTGDCLKTLDGHDNRIWALTTWNDGELIVSADADGVLQFWND 687

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 56/123 (45%), Gaps = 10/123 (8%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           +VS+ QF     LIA    D  IKLW L +  VL +F GH + +    F     QL+S  
Sbjct: 579 DVSFCQFDK---LIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSG 635

Query: 139 EDSNIIVWDLVSEVGLYKLRSHKGTITGL--WCDSDNWLISTSKDGLIKVWDLKTQQCIE 196
            D  I +WD  +   L  L  H   I  L  W D +  ++S   DG+++ W+     C E
Sbjct: 636 ADGLIKIWDCTTGDCLKTLDGHDNRIWALTTWNDGE-LIVSADADGVLQFWN----DCTE 690

Query: 197 THI 199
             I
Sbjct: 691 LEI 693

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 60/108 (55%), Gaps = 4/108 (3%)

Query: 401 LLATASNGE-LKIWNLNTKSCIRTF--ECGYALTCKFLPGGLLVVVGTREGNLQLFDLAS 457
           L+AT S  + +K+W+L+T + ++TF         C F+     +V    +G ++++D  +
Sbjct: 588 LIATCSGDKTIKLWSLDTFAVLKTFAGHTNAVQRCTFINKQKQLVSSGADGLIKIWDCTT 647

Query: 458 SVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELI 505
              L T++  H+  IW+L   NDG+ +V+  AD  ++FW+   + E++
Sbjct: 648 GDCLKTLDG-HDNRIWALTTWNDGELIVSADADGVLQFWNDCTELEIL 694

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 75/177 (42%), Gaps = 24/177 (13%)

Query: 529 DILSIKISGDDKFL-AISLLDNTVKVFFLDSMKFFLSLYGHKL------------PVLSL 575
           +I  +K++ D KFL +I+L    +K++ L +++   ++   +             P   +
Sbjct: 65  EITCLKLTPDGKFLISIALQSQALKIYNLTAIEGETTMNTKQQSLQPIKTLKLSSPSYIM 124

Query: 576 DISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN----FFSASK 631
           D    + ++     D +I +  ++ G    S   H  +I  VKF   +        S   
Sbjct: 125 DCDSTSTLVAVGGTDGSIIVVDIENGFITHSFKGHGGTISSVKFYGNNDTNCWLLCSGDT 184

Query: 632 DGFVKYWDGDKFECIQKLAAHQSEVWAL---AVSDNGERVV----SVSHDHSIRIWE 681
           +G VK WD  K  CI  L  H S V  L   +VS   + VV    S S D+ + +WE
Sbjct: 185 NGMVKIWDLVKRSCIHTLQEHNSAVRGLDVRSVSKENDNVVLQLLSGSRDNIVNLWE 241

>YLR222C Chr12 complement(579318..581771) [2454 bp, 817 aa] {ON}
           UTP13Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 817

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 137/597 (22%), Positives = 243/597 (40%), Gaps = 95/597 (15%)

Query: 124 MLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL----WCDSDNWLISTS 179
           +L  D T T L  G  D +IIV D+ +    +  + H GTI+ L      +S  WL+++ 
Sbjct: 107 ILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLNSKIWLLASG 166

Query: 180 -KDGLIKVWDLKTQQCIETHIAHTGECWALGIM--------TDFVVTSSADSQLKIWQMD 230
             +G++KVWDL  ++C+ T   HT     L I+        +  +++   D  + +W  +
Sbjct: 167 DTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLWDFN 226

Query: 231 LEGEPGSKLIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAK 290
           +      K   K        Q+  S  F    DG    Y    D    IF+L  D E   
Sbjct: 227 M------KKKCKLLKTLPVNQQVESCGFLKDGDGKRIIYTAGGDA---IFQL-IDSESGS 276

Query: 291 AIKRREKRLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKL--- 347
            +KR  K + E  +       + S+ ++       Q++     +K+   T+ +++ +   
Sbjct: 277 VLKRTNKPIEELFIIGVLPILSNSQMFLVLSDQTLQLINVEEDLKNDEDTIQVTSSIAGN 336

Query: 348 ---------------EVVVTTNSNTIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRS 392
                          ++ + TNS ++    VP +   P +  P+     E  G    + S
Sbjct: 337 HGIIADMRYVGPELNKLALATNSPSLRIIPVP-DLSGPEASLPLDVEIYE--GHEDLLNS 393

Query: 393 IDISDDNALLATASNGELKI-WNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQ 451
           +D ++D   +ATAS     I W  N  SC                               
Sbjct: 394 LDATEDGLWIATASKDNTAIVWRYNENSC------------------------------- 422

Query: 452 LFDLASSVLLTTIEAAHEGAIWSLDVTNDGKR-----LVTGSADKSIKFWDFQVKQELIA 506
            FD+ +  +       H  A+ ++ + N   +     L+T S D +IK W       +I 
Sbjct: 423 KFDIYAKYI------GHSAAVTAVGLPNIVSKGYPEFLLTASNDLTIKKW-------IIP 469

Query: 507 GTSDKYVPQMNIVHDSTLELGD-DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSL 565
             +     Q+  V + T    + DI ++ +S +D   A +  D T K++ L++ +   +L
Sbjct: 470 KPTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATL 529

Query: 566 YGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN 625
             HK  +  +      K++ TSS DK +KIW LD     K+L  H +++    F+     
Sbjct: 530 ANHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQ 589

Query: 626 FFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEE 682
             S   DG +K WD    EC++ L  H + +WAL+  ++G+ +VS   D   + W++
Sbjct: 590 LISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWKD 646

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 76/175 (43%), Gaps = 12/175 (6%)

Query: 66  PPGSVDLKSSKPAE---------VSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFN 116
           P  S+D++  K +E         ++ L       + A    D   K+W+L +  +  +  
Sbjct: 471 PTASMDVQIIKVSEYTRHAHEKDINALSVSPNDSIFATASYDKTCKIWNLENGELEATLA 530

Query: 117 GHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWL 175
            HK  +  + F +    L + S D  + +W L +   +  L  H   +    + +    L
Sbjct: 531 NHKRGLWDVSFCQYDKLLATSSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQL 590

Query: 176 ISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGIMT--DFVVTSSADSQLKIWQ 228
           IS   DGLIK+WD  + +C++T   H    WAL  M   D +V++ AD   + W+
Sbjct: 591 ISCGADGLIKIWDCSSGECLKTLDGHNNRLWALSTMNDGDMIVSADADGVFQFWK 645

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 75/175 (42%), Gaps = 13/175 (7%)

Query: 518 IVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDI 577
           I+H  + E   +I ++K++ D ++L        +K+F L + K   S+     P   LD 
Sbjct: 52  ILHKISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISS-PSYILDA 110

Query: 578 SDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN-----FFSASKD 632
              + ++     D +I +  ++ G    S   H  +I  +KF  G  N       S   +
Sbjct: 111 DSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFY-GQLNSKIWLLASGDTN 169

Query: 633 GFVKYWDGDKFECIQKLAAHQSEVWAL---AVSDNGE---RVVSVSHDHSIRIWE 681
           G VK WD  K +C+  L  H S V  L    V DN E    ++S   D  I +W+
Sbjct: 170 GMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLLSGGRDDIINLWD 224

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 6/73 (8%)

Query: 82  YLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKF------DKTGTQLI 135
           Y Q +S+  L+A+G  +G++K+WDLV +  L +   H S +  L        D+    L+
Sbjct: 153 YGQLNSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHTSAVRGLDIIEVPDNDEPSLNLL 212

Query: 136 SGSEDSNIIVWDL 148
           SG  D  I +WD 
Sbjct: 213 SGGRDDIINLWDF 225

>KAFR0H01750 Chr8 complement(322707..325058) [2352 bp, 783 aa] {ON}
           Anc_8.435 YLR222C
          Length = 783

 Score =  127 bits (319), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 147/606 (24%), Positives = 248/606 (40%), Gaps = 101/606 (16%)

Query: 124 MLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL----WCDSDNWLI-ST 178
           ++  DKT T +  G  D +++V D+ +    + L+ H GTI+ L      +S+ WL+ S 
Sbjct: 75  IIDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFFGELNSNIWLLCSG 134

Query: 179 SKDGLIKVWDLKTQQCIETHIAHTGECWALGIM-----TDFV--VTSSADSQLKIWQMDL 231
             +G++K+WDL  ++CI T   HT     + I+     TD +  VT   D+ +  W+ +L
Sbjct: 135 DTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWEFNL 194

Query: 232 EGE-------PGSKLIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRK 284
           + +       P  + IE   F        ++ +F  T+     F V +      I R RK
Sbjct: 195 KKKCTLVKTIPAHQQIESSGF--------INHDFIYTAGSDAVFQVISLKNGQVIKRTRK 246

Query: 285 DIE------IAKAIKRREKRL--TEKGMTEEDIKTNISE------SYVSFVMHPFQVVRS 330
            IE      +   +   E  L  +++ +   D++  + E      S  S +     ++  
Sbjct: 247 PIEELFIIGVLPILNGTEYYLVMSDQSLNLIDVQGALEEEEDELISSKSCIAGNHGIIAD 306

Query: 331 MYKIKSVAWTLSLSTKLEVVVTTNSNTIEYYSVPYEKR----DPTSPTPIKAHTIELQGS 386
           M  +      L+L+T        NS T+    VP   +    +  S  PI     E  G 
Sbjct: 307 MTFVGPDLKHLALAT--------NSPTLRLIPVPNTNKSDGNEDESFLPIDVDMYE--GH 356

Query: 387 RTDVRSIDISDDNALLATASNGELKI-WNLNTKSCIRTFECGYALTCKFLPGGLLVVVGT 445
              + +ID ++D   +ATAS     I W  NT   I+     YA   +F           
Sbjct: 357 EDLLNAIDSTEDGLWIATASKDHSAIVWKYNT---IKQKFTQYA---RF----------- 399

Query: 446 REGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKR-----LVTGSADKSIKFWDFQV 500
                               + H  ++ ++ + N   +     L+T S D +IK W    
Sbjct: 400 --------------------SGHSSSVTAVGLPNVMPKSYPEYLLTASNDLTIKKWKIPK 439

Query: 501 KQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMK 560
                AG  +     + I   +      DI ++ IS +D   A +  D T K++ L++ +
Sbjct: 440 PS---AGDEEVEFHDVKISEYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLETGE 496

Query: 561 FFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFL 620
              +L  HK  +  +      K+I T S DK IKIW LD     K+L  H +++    F+
Sbjct: 497 SVATLSNHKRGLWDVSFCQFDKIIATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFI 556

Query: 621 PGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIW 680
              +   S   DG +K WD    ECI  L  H + +WAL V ++G+ +VS   D   + W
Sbjct: 557 NKQNQLVSTGADGLIKIWDISNGECISTLDGHNNRIWALCVQNDGDLIVSADADGVFQFW 616

Query: 681 EETDDQ 686
            +  D+
Sbjct: 617 RDCTDE 622

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 74/162 (45%), Gaps = 9/162 (5%)

Query: 73  KSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKS---RITMLKFDK 129
           + +   +++ L       + A    D   K+WDL +   + + + HK     ++  +FDK
Sbjct: 459 RRAHEKDINALSISPNDSIFATASYDKTCKIWDLETGESVATLSNHKRGLWDVSFCQFDK 518

Query: 130 TGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGLIKVWD 188
               + + S D  I +W L +   +  L  H   +    + +  N L+ST  DGLIK+WD
Sbjct: 519 I---IATCSGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWD 575

Query: 189 LKTQQCIETHIAHTGECWALGIMT--DFVVTSSADSQLKIWQ 228
           +   +CI T   H    WAL +    D +V++ AD   + W+
Sbjct: 576 ISNGECISTLDGHNNRIWALCVQNDGDLIVSADADGVFQFWR 617

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 100/514 (19%), Positives = 198/514 (38%), Gaps = 109/514 (21%)

Query: 80  VSYLQFHSETG----LIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKF-----DKT 130
           +S L+F  E      L+ +G  +G++K+WDLV +  + +   H S +  +       D  
Sbjct: 115 ISSLKFFGELNSNIWLLCSGDTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTD 174

Query: 131 GTQLISGSEDSNIIVW--DLVSEVGLYK-LRSHKGTITGLWCDSDNWLISTSKDGLIKVW 187
             QL++G  D+ +  W  +L  +  L K + +H+   +  + + D ++ +   D + +V 
Sbjct: 175 VLQLVTGGRDNIVNFWEFNLKKKCTLVKTIPAHQQIESSGFINHD-FIYTAGSDAVFQVI 233

Query: 188 DLKTQQCIETHIAHTGECWALGIMT------DFVVTSSADSQLKIWQMDLEGEPGSKLIE 241
            LK  Q I+       E + +G++        ++V S     L   Q  LE E    +  
Sbjct: 234 SLKNGQVIKRTRKPIEELFIIGVLPILNGTEYYLVMSDQSLNLIDVQGALEEEEDELISS 293

Query: 242 KGAFEKQSKQRGLSIEFT------------TTSDGVHFFYVQNADKT----VEIFRLRKD 285
           K      +   G+  + T            T S  +    V N +K+     E F L  D
Sbjct: 294 KSCI---AGNHGIIADMTFVGPDLKHLALATNSPTLRLIPVPNTNKSDGNEDESF-LPID 349

Query: 286 IEIAKAIKRREKRLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMY-----------KI 334
           +++ +     E  L     TE+ +    +    S ++  +  ++  +            +
Sbjct: 350 VDMYEG---HEDLLNAIDSTEDGLWIATASKDHSAIVWKYNTIKQKFTQYARFSGHSSSV 406

Query: 335 KSVAWTLSLSTKLEVVVTTNSN--TIEYYSVPYEKRDPTSPTPIKAHTIEL-----QGSR 387
            +V     +       + T SN  TI+ + +P   +       ++ H +++     +   
Sbjct: 407 TAVGLPNVMPKSYPEYLLTASNDLTIKKWKIP---KPSAGDEEVEFHDVKISEYTRRAHE 463

Query: 388 TDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFE--------------------C 426
            D+ ++ IS ++++ ATAS +   KIW+L T   + T                      C
Sbjct: 464 KDINALSISPNDSIFATASYDKTCKIWDLETGESVATLSNHKRGLWDVSFCQFDKIIATC 523

Query: 427 GYALTCKFLPGGLLVVVGTREGN------------------------LQLFDLASSVLLT 462
               T K        V+ T EG+                        ++++D+++   ++
Sbjct: 524 SGDKTIKIWSLDTFSVIKTLEGHTNAVQKCSFINKQNQLVSTGADGLIKIWDISNGECIS 583

Query: 463 TIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFW 496
           T++  H   IW+L V NDG  +V+  AD   +FW
Sbjct: 584 TLD-GHNNRIWALCVQNDGDLIVSADADGVFQFW 616

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 75/178 (42%), Gaps = 12/178 (6%)

Query: 514 PQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVL 573
           P   I+H  +     +I ++K++ D K+L        +K+  + + K   S+     P  
Sbjct: 16  PVKKILHTISNNDEQEITALKVTPDGKYLIFVSQAQLLKIVNVSTGKIIKSMKVSS-PSY 74

Query: 574 SLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN-----FFS 628
            +D    + ++     D ++ +  ++ G    SL  H  +I  +KF  G  N       S
Sbjct: 75  IIDCDKTSTLVTIGGTDGSVVVIDIENGYITHSLKGHGGTISSLKFF-GELNSNIWLLCS 133

Query: 629 ASKDGFVKYWDGDKFECIQKLAAHQSEVWALAV--SDNGERV---VSVSHDHSIRIWE 681
              +G VK WD  K +CI  +  H S V  + +  S+N   V   V+   D+ +  WE
Sbjct: 134 GDTNGMVKIWDLVKRKCIHTVQEHTSPVRGVDIVESENDTDVLQLVTGGRDNIVNFWE 191

 Score = 32.3 bits (72), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 55/231 (23%), Positives = 103/231 (44%), Gaps = 34/231 (14%)

Query: 489 ADKSIKFWDFQ-----VKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLA 543
           +D+S+   D Q      + ELI+  S        I+ D T  +G D+  + ++ +   L 
Sbjct: 270 SDQSLNLIDVQGALEEEEDELISSKS-CIAGNHGIIADMTF-VGPDLKHLALATNSPTLR 327

Query: 544 ISLLDNTVKVFFLDSMKFF---LSLY-GHKLPVLSLDISDDTKVIITSSADKNIKIWGLD 599
           +  + NT K    +   F    + +Y GH+  + ++D ++D   I T+S D +  +W  +
Sbjct: 328 LIPVPNTNKSDGNEDESFLPIDVDMYEGHEDLLNAIDSTEDGLWIATASKDHSAIVWKYN 387

Query: 600 FGDCHKSLFA----HQDSIMCV---KFLPGSHN--FFSASKDGFVKYWD------GD--- 641
                 + +A    H  S+  V     +P S+     +AS D  +K W       GD   
Sbjct: 388 TIKQKFTQYARFSGHSSSVTAVGLPNVMPKSYPEYLLTASNDLTIKKWKIPKPSAGDEEV 447

Query: 642 KFECIQ----KLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE-ETDDQV 687
           +F  ++       AH+ ++ AL++S N     + S+D + +IW+ ET + V
Sbjct: 448 EFHDVKISEYTRRAHEKDINALSISPNDSIFATASYDKTCKIWDLETGESV 498

>Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score =  123 bits (308), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 141/598 (23%), Positives = 242/598 (40%), Gaps = 97/598 (16%)

Query: 124 MLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL----WCDSDNWLISTS 179
           +L  D T T L  G  D +IIV D+ +    +  + H GTI+ L      DS  WL+++ 
Sbjct: 107 ILDADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLDSKIWLLASG 166

Query: 180 -KDGLIKVWDLKTQQCIETHIAHTGECWALGIMT------DFV--VTSSADSQLKIWQMD 230
             +G++KVWDL  ++C+ T   H+     L I+        F+  ++   D  + IW  D
Sbjct: 167 DTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGGRDDIINIW--D 224

Query: 231 LEGEPGSKLIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAK 290
              +   KLI+     +Q +  G    F    D  H  Y    D    IF+L  D+E   
Sbjct: 225 FNMKKTCKLIKTLPVNQQVESCG----FLRYHDDKHLIYTAGGDA---IFQLI-DLESGI 276

Query: 291 AIKRREKRLTEKGMTEEDIKTNISESYVSFVM--HPFQVVRSMYKIKSVAWTLSLSTKL- 347
            IK+  K + E  +    +   +S S +  VM     Q++     IKS    + +S+ + 
Sbjct: 277 MIKKTNKPIEELFII--GVLPIVSSSKMFLVMSDQTLQLINVEEVIKSENEIIEVSSTIA 334

Query: 348 -----------------EVVVTTNSNTIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDV 390
                            ++ + TNS ++    +P +    T+  P+     E  G    +
Sbjct: 335 GNHGIIADMRFVGPELNKLALATNSPSLRIIPIP-DLAGTTASLPLDVEIYE--GHEDLL 391

Query: 391 RSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGN 449
            S+D ++D   +ATAS +    +W  N  +  R FE    +  K++              
Sbjct: 392 NSLDATEDGLWIATASKDNSAIVWKYNENT--RKFE----VYSKYI-------------- 431

Query: 450 LQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKR-----LVTGSADKSIKFWDFQVKQEL 504
                             H  A+ ++ +     +     L+T S D +IK W        
Sbjct: 432 -----------------GHSSAVTAVGLPKIMPKGYPEFLLTASNDLTIKKWKIPKPTFP 474

Query: 505 IAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLS 564
               + K        H+       DI ++ IS +D   A +  D T K++ L++ +   +
Sbjct: 475 FDVQTIKVSEYTRHAHEK------DINALSISPNDSIFATASYDKTCKIWNLENGELEAT 528

Query: 565 LYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSH 624
           L  HK  +  +      K++ T S DK +KIW LD     K+L  H +++    F+    
Sbjct: 529 LSNHKRGLWDVTFCQYDKLLATCSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQK 588

Query: 625 NFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEE 682
              S   DG +K WD    EC++ L  H + +WAL   ++G+ +VS   D   + W++
Sbjct: 589 QLVSCGADGLIKIWDCSSGECLKTLDGHNNRLWALNTMNDGDIIVSADADGVFQFWKD 646

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 71/159 (44%), Gaps = 3/159 (1%)

Query: 73  KSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGT 132
           + +   +++ L       + A    D   K+W+L +  +  + + HK  +  + F +   
Sbjct: 487 RHAHEKDINALSISPNDSIFATASYDKTCKIWNLENGELEATLSNHKRGLWDVTFCQYDK 546

Query: 133 QLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGLIKVWDLKT 191
            L + S D  + +W L +   +  L  H   +    + +    L+S   DGLIK+WD  +
Sbjct: 547 LLATCSGDKTVKIWSLDTFSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCSS 606

Query: 192 QQCIETHIAHTGECWALGIMT--DFVVTSSADSQLKIWQ 228
            +C++T   H    WAL  M   D +V++ AD   + W+
Sbjct: 607 GECLKTLDGHNNRLWALNTMNDGDIIVSADADGVFQFWK 645

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 62/140 (44%), Gaps = 13/140 (9%)

Query: 49  VWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVS 108
           +W+L+  ELE  LS+               +V++ Q+     L+A    D  +K+W L +
Sbjct: 517 IWNLENGELEATLSN---------HKRGLWDVTFCQYDK---LLATCSGDKTVKIWSLDT 564

Query: 109 KTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLW 168
            +V+ +  GH + +    F     QL+S   D  I +WD  S   L  L  H   +  L 
Sbjct: 565 FSVMKTLEGHTNAVQRCSFINKQKQLVSCGADGLIKIWDCSSGECLKTLDGHNNRLWALN 624

Query: 169 CDSD-NWLISTSKDGLIKVW 187
             +D + ++S   DG+ + W
Sbjct: 625 TMNDGDIIVSADADGVFQFW 644

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 78/175 (44%), Gaps = 11/175 (6%)

Query: 517 NIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLD 576
           NI+H  + E   +I ++K++ D ++L        +K+F L + K   S+     P   LD
Sbjct: 51  NIIHRISNEDEQEITALKLTPDGQYLTYVSQAQLLKIFHLKTGKVVRSMKISS-PSYILD 109

Query: 577 ISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLP--GSHNFFSASKD-- 632
               + ++     D +I +  ++ G    S   H  +I  +KF     S  +  AS D  
Sbjct: 110 ADSTSTLLAVGGTDGSIIVVDIENGYITHSFKGHGGTISSLKFYGQLDSKIWLLASGDTN 169

Query: 633 GFVKYWDGDKFECIQKLAAHQSEVWAL---AVSDNGE---RVVSVSHDHSIRIWE 681
           G VK WD  K +C+  L  H S V  L    V ++ E   +++S   D  I IW+
Sbjct: 170 GMVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLLSGGRDDIINIWD 224

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 6/73 (8%)

Query: 82  YLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKF------DKTGTQLI 135
           Y Q  S+  L+A+G  +G++K+WDLV +  L +   H S +  L        D+   +L+
Sbjct: 153 YGQLDSKIWLLASGDTNGMVKVWDLVKRKCLHTLQEHSSAVRGLDIVEVQNSDEPFLKLL 212

Query: 136 SGSEDSNIIVWDL 148
           SG  D  I +WD 
Sbjct: 213 SGGRDDIINIWDF 225

>KNAG0A02510 Chr1 complement(253245..255794) [2550 bp, 849 aa] {ON}
           Anc_8.435 YLR222C
          Length = 849

 Score =  122 bits (307), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 130/607 (21%), Positives = 247/607 (40%), Gaps = 101/607 (16%)

Query: 124 MLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL----WCDSDNWLISTS 179
           ++  + T T +  G  D +IIV D+ +    +  + H GTI+ L      +S+ WL+++ 
Sbjct: 136 IMDSEATSTLVAVGGTDGSIIVVDIENGYVTHSFKGHGGTISCLKFFGEANSNVWLLASG 195

Query: 180 -KDGLIKVWDLKTQQCIETHIAHTGECWALGI---------MTDFVVTSSADSQLKIWQM 229
             +G+IKVW+L T++C  T   HT     + I         M   +++   D  +  W++
Sbjct: 196 DTNGMIKVWNLVTRKCTHTVQEHTSAVRGIDIRSISDDTKSMQLQMISGGRDDVVNYWEL 255

Query: 230 DLEGEPGSKLIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIA 289
           D   +   KL++     +Q +Q G    F  +    +  Y    D  ++   L K   + 
Sbjct: 256 D--NKKKCKLLQTIPAHQQVEQCG----FIASPGHKNLIYTSGGDAIMQFISLEKGSIVK 309

Query: 290 KAIKRREKR-----------------LTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMY 332
           K+ K  E+                  ++++ +   D+++N+  +    + +   +  +  
Sbjct: 310 KSKKPIEELFIIGVLPISQGEKLISVMSDQSLHYLDVESNLKATNEEELTYESALAGNHG 369

Query: 333 KIKSVAWTLSLSTKLE-VVVTTNSNTIEYYSVPYEKR--DPTSPTPIKAHTIELQGSRTD 389
            I  + +   +  K + + + TNS T+     P +    D  +  PI     E  G    
Sbjct: 370 TIADMVF---VGPKFQHLALATNSPTLRIIPTPLDDSTVDTNNLLPIDVDMYE--GHEDL 424

Query: 390 VRSIDISDDNALLATASNGELKI-WNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREG 448
           + ++D ++D   LATAS  +  I W  + +            T KF P    +       
Sbjct: 425 LNAVDATEDGLWLATASKDKTAIVWRYDDE------------TAKFKPYAKFI------- 465

Query: 449 NLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKR-----LVTGSADKSIKFWDFQVKQE 503
                              H  ++ ++ + N   R     L+T S D +IK W+     +
Sbjct: 466 ------------------GHSSSVTAVGLPNVMLRHWPEFLLTASNDLTIKKWNIPKPSD 507

Query: 504 LIAGT----SDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSM 559
            + G       +Y  +    H+       DI ++ +S +D   A +  D T K++ L++ 
Sbjct: 508 KMEGIHLIKGSEYTRR---AHEK------DINALSVSPNDSVFATASYDKTSKIWDLETG 558

Query: 560 KFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKF 619
           +   +L  HK  +  +      K++ T S DK IKIW LD     ++L  H +++    F
Sbjct: 559 ELTATLANHKRGLWDVSFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGHTNAVQRCHF 618

Query: 620 LPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRI 679
           +       S+  DG +K WD    EC++ L  H + +WAL +  +GE + S   D   + 
Sbjct: 619 INKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALTIQRDGELIASADADGVFQF 678

Query: 680 WEETDDQ 686
           W +  +Q
Sbjct: 679 WTDCSEQ 685

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 105/245 (42%), Gaps = 22/245 (8%)

Query: 65  LPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITM 124
           L  GS   + +   +++ L       + A    D   K+WDL +  +  +   HK  +  
Sbjct: 514 LIKGSEYTRRAHEKDINALSVSPNDSVFATASYDKTSKIWDLETGELTATLANHKRGLWD 573

Query: 125 LKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGL 183
           + F +    L + S D  I +W L +   +  L  H   +    + +    L+S+  DGL
Sbjct: 574 VSFCQYDKLLATCSGDKTIKIWSLDTFSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGL 633

Query: 184 IKVWDLKTQQCIETHIAHTGECWALGIMTD--FVVTSSADSQLKIW--------QMDLEG 233
           IK+WD  + +C++T   H    WAL I  D   + ++ AD   + W        + DLE 
Sbjct: 634 IKIWDCSSGECVKTLDGHANRIWALTIQRDGELIASADADGVFQFWTDCSEQQREQDLER 693

Query: 234 EPGSKLIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFR-LRKDIEIAKAI 292
           E   +L+E    ++QS Q  L+ E    +    F      D  + +F  LR+ +  +   
Sbjct: 694 E--KELVE----QEQSLQNYLANEDWANA----FLLAITLDHPMRLFNVLRQSLHYSPES 743

Query: 293 KRREK 297
           ++R++
Sbjct: 744 EKRDE 748

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 66/147 (44%), Gaps = 14/147 (9%)

Query: 49  VWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVS 108
           +WDL+T EL   L++               +VS+ Q+     L+A    D  IK+W L +
Sbjct: 552 IWDLETGELTATLAN---------HKRGLWDVSFCQYDK---LLATCSGDKTIKIWSLDT 599

Query: 109 KTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLW 168
            +V+ +  GH + +    F    TQL+S   D  I +WD  S   +  L  H   I  L 
Sbjct: 600 FSVVRTLEGHTNAVQRCHFINKQTQLVSSGADGLIKIWDCSSGECVKTLDGHANRIWALT 659

Query: 169 CDSDNWLISTS-KDGLIKVW-DLKTQQ 193
              D  LI+++  DG+ + W D   QQ
Sbjct: 660 IQRDGELIASADADGVFQFWTDCSEQQ 686

 Score = 39.7 bits (91), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 33/164 (20%), Positives = 72/164 (43%), Gaps = 12/164 (7%)

Query: 529 DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSS 588
           +I ++K++ D K+L  +     +K+  + + K   S+     P   +D    + ++    
Sbjct: 92  EITALKLTADGKYLCFTSQAQLLKIVEVATGKVMRSMKISS-PSYIMDSEATSTLVAVGG 150

Query: 589 ADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN----FFSASKDGFVKYWDGDKFE 644
            D +I +  ++ G    S   H  +I C+KF   +++      S   +G +K W+    +
Sbjct: 151 TDGSIIVVDIENGYVTHSFKGHGGTISCLKFFGEANSNVWLLASGDTNGMIKVWNLVTRK 210

Query: 645 CIQKLAAHQSEVWAL---AVSDNGE----RVVSVSHDHSIRIWE 681
           C   +  H S V  +   ++SD+ +    +++S   D  +  WE
Sbjct: 211 CTHTVQEHTSAVRGIDIRSISDDTKSMQLQMISGGRDDVVNYWE 254

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 159/699 (22%), Positives = 292/699 (41%), Gaps = 94/699 (13%)

Query: 78  AEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISG 137
           A+  YL F S+  L+         K++DL    ++ S     S   ++  D T T L  G
Sbjct: 70  ADGRYLCFASQAQLL---------KIFDLREGKIVRSMK-ISSPSYVVDSDSTSTLLAIG 119

Query: 138 SEDSNIIVWDLVSEVGLYKLRSHKGTITGLWC----DSDNWLISTS-KDGLIKVWDLKTQ 192
             D +I V D+ +    + L+ H GTI+ +      + + WL+++   +G++K+WDL  +
Sbjct: 120 GTDGSITVVDVENGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIWDLVKR 179

Query: 193 QCIETHIAHTGECWALGIMTD--------FVVTSSADSQLKIWQMDLEGEPGSKLIEKGA 244
           +CI T   HT     +             F+++   D  +  WQ +L+ +    L++   
Sbjct: 180 KCIHTVQEHTAAVRGIDFHESKNNDESELFLISGGRDDVINYWQFNLKKK--CTLLKTLP 237

Query: 245 FEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLTEKGM 304
             +Q +  G +             Y   +D  +++  L    E  KA+KR  K + E  +
Sbjct: 238 VSQQVESCGFA--------NSELIYTAGSDAFLQLISL----ESGKAVKRTHKPVEE--L 283

Query: 305 TEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEYYSVP 364
               + + +  S +  V+    +  ++  ++    + S   ++E  +  N  TI   +  
Sbjct: 284 FTVGVLSILGGSKLYMVISDQTL--ALINLEEALESESALIEVESYIAGNHGTIADMNFV 341

Query: 365 YEKRD-----PTSPT----PIKAHT-----IEL-QGSRTDVRSIDISDDNALLATASNGE 409
             + D       SPT    P+         +EL +G +  + ++D ++D   LATAS   
Sbjct: 342 GPELDKLALATNSPTLRIIPVSMEGGLPIDVELYEGHKDLLNAVDATEDGLWLATASKDS 401

Query: 410 LKI-WNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAH 468
             I W   + S             KF+P          EG+       ++V L  I   H
Sbjct: 402 TAILWWYQSNSN------------KFVP------YAKFEGH---SSAVTAVGLPNI--MH 438

Query: 469 EGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGD 528
           +G  W        + ++T S D ++K W           +++ +  Q+  V + T    +
Sbjct: 439 KG--WP-------EFILTASNDLTVKKWAVPKP----VASNESFELQVVKVSEYTRRAHE 485

Query: 529 -DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITS 587
            DI ++ ++ +D   A +  D T KV+ L+S +   +L  H+  +  +      ++I T 
Sbjct: 486 KDINALSVAPNDSTFATASYDKTCKVWDLESGEVKATLANHRRGLWDVAFCQYERLIATC 545

Query: 588 SADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQ 647
           S DK IKIW LD     K+   H +++    F+       S+S DG VK WD    EC++
Sbjct: 546 SGDKTIKIWSLDTFAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVK 605

Query: 648 KLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEETDDQVFLXXXXXXXXXXXXXDTLLA 707
            L  H + +WAL V+++G+ +VS   D   + W+++ +Q                 +L  
Sbjct: 606 TLDGHTNRIWALCVAEDGDLIVSADADGVFQFWKDSTEQERQQHNEQQHLKVEQEQSLQN 665

Query: 708 SLEEGNADDTFKGDVKNDEDDEATRVSKQTIESLKAGER 746
            L +G+  + F   +  D      RV KQ++ S+   ER
Sbjct: 666 YLSQGDWTNAFLLAITLDHPLRLFRVLKQSLGSMDDDER 704

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 69/151 (45%), Gaps = 13/151 (8%)

Query: 49  VWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVS 108
           VWDL++ E++  L++               +V++ Q+     LIA    D  IK+W L +
Sbjct: 511 VWDLESGEVKATLAN---------HRRGLWDVAFCQYER---LIATCSGDKTIKIWSLDT 558

Query: 109 KTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLW 168
             V+ +F GH + +    F    TQL+S S D  + +WD  +   +  L  H   I  L 
Sbjct: 559 FAVVKTFEGHTNAVQRCSFINKQTQLVSSSADGLVKIWDCSTGECVKTLDGHTNRIWALC 618

Query: 169 CDSD-NWLISTSKDGLIKVWDLKTQQCIETH 198
              D + ++S   DG+ + W   T+Q  + H
Sbjct: 619 VAEDGDLIVSADADGVFQFWKDSTEQERQQH 649

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 58/133 (43%), Gaps = 7/133 (5%)

Query: 529 DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSS 588
           DI ++K++ D ++L  +     +K+F L   K   S+     P   +D    + ++    
Sbjct: 62  DITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMKISS-PSYVVDSDSTSTLLAIGG 120

Query: 589 ADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN-----FFSASKDGFVKYWDGDKF 643
            D +I +  ++ G    SL  H  +I  VKF  G  N       S   +G VK WD  K 
Sbjct: 121 TDGSITVVDVENGYVTHSLKGHGGTISSVKFY-GEQNGEVWLLASGDTNGMVKIWDLVKR 179

Query: 644 ECIQKLAAHQSEV 656
           +CI  +  H + V
Sbjct: 180 KCIHTVQEHTAAV 192

>TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.717
           YOR269W
          Length = 848

 Score =  120 bits (301), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 149/657 (22%), Positives = 265/657 (40%), Gaps = 101/657 (15%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           E++ LQ   +   +     + ++K++++V K  + S         M   D+T T L  G 
Sbjct: 63  EITALQLSPDGKYLCYASTNQLLKIYNIVEKKFVKSLKISSPSYVM-SIDQTSTLLAVGG 121

Query: 139 EDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSD-------NWLI-STSKDGLIKVWDLK 190
            D ++ V D+ +    +  + H  TI+ +   SD        WL+ S    G+IKV D+ 
Sbjct: 122 TDGSVTVIDIENSYITHSFKGHGATISAVKFYSDASTQNNEGWLLFSGDTAGMIKVCDMV 181

Query: 191 TQQCIETHIAHTGECWALGIMTDF-----------VVTSSADSQLKIWQMDLEGEPGSKL 239
            ++C+ T   HT     L I               +++   D  + +W+ +L  +  SKL
Sbjct: 182 KRRCLYTFQEHTSAIRGLDIRLSPSHVENDEPLLQLLSGGRDDIVNLWEFNLRRK--SKL 239

Query: 240 IEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKR- 298
           I+     +Q +  G         +     Y   +D   +I  +  +  + K +K  E+  
Sbjct: 240 IKTIPVYQQVEACGF-----LNGNYEDLIYTGGSDAIFQILSISSNKILKKTLKPIEELF 294

Query: 299 ----------------LTEKGMTEEDIKTNISESYVSFVMHPFQVV-RSMYKIK-SVAWT 340
                           L+++ +   D++ N++E       +P + V  ++ KI+ S+A  
Sbjct: 295 IIGVLPILDNSKFYLVLSDQTLLLVDVEENMAED-----ENPSEYVDHTIIKIENSIAGN 349

Query: 341 LSLSTKLEVV--------VTTNSNTIEYYSVP-----YEKRDPTSPTPIKAHTIELQGSR 387
                 + VV        + TNS T+    +       + +D  S  PI     E  G  
Sbjct: 350 HGTIADMRVVDPTLSKLALATNSPTLRIIPISEANEEADSKDALSRIPIDVDMYE--GHT 407

Query: 388 TDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTR 446
             + S+D ++D+  +ATAS +    +W  N        E  Y +  KFL           
Sbjct: 408 DLLNSLDSTEDSLWIATASKDNSCILWRYNA-----VLE-KYQIYAKFLGH--------- 452

Query: 447 EGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIA 506
                    ASSV    +         ++   N    ++T S D +IK W    K     
Sbjct: 453 ---------ASSVTAVGLP--------NVLTKNYPDYVITASNDSTIKKWKVP-KPTKNL 494

Query: 507 GTSDKYVPQMNIVHDSTLELGD-DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSL 565
             +D + P    + + T    D DI ++ IS +D   A +  D T K++ L+S     +L
Sbjct: 495 DNNDSFKPHEVKLSEYTRRAHDKDINALSISPNDSIFATASYDKTCKIWDLESGDLKATL 554

Query: 566 YGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN 625
             HK  +  +      K I+T+S DK IK+W LD     K+   H +++   +F+     
Sbjct: 555 VNHKRGLWDVSFCQYDKFIVTASGDKTIKMWSLDTFTVVKTFEGHSNAVQRCQFINKQKQ 614

Query: 626 FFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEE 682
             S   DG +K WD    ECI+ L  H + +WAL+V ++G+ ++S   D   + W +
Sbjct: 615 LVSCGADGLIKIWDCSSGECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFWRD 671

 Score = 74.7 bits (182), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 103/236 (43%), Gaps = 16/236 (6%)

Query: 62  SDGLPPGSVDL----KSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNG 117
           +D   P  V L    + +   +++ L       + A    D   K+WDL S  +  +   
Sbjct: 497 NDSFKPHEVKLSEYTRRAHDKDINALSISPNDSIFATASYDKTCKIWDLESGDLKATLVN 556

Query: 118 HKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLI 176
           HK  +  + F +    +++ S D  I +W L +   +     H   +    + +    L+
Sbjct: 557 HKRGLWDVSFCQYDKFIVTASGDKTIKMWSLDTFTVVKTFEGHSNAVQRCQFINKQKQLV 616

Query: 177 STSKDGLIKVWDLKTQQCIETHIAHTGECWALGIMT--DFVVTSSADSQLKIWQMDLEGE 234
           S   DGLIK+WD  + +CI+T   H+   WAL ++   D ++++ AD   + W+ D  GE
Sbjct: 617 SCGADGLIKIWDCSSGECIKTLDGHSNRIWALSVINDGDVIISADADGVFQFWR-DCTGE 675

Query: 235 PGSKLIEKGAF---EKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFR-LRKDI 286
              K +EK      ++QS Q  L+ E  T +    F      D  + +F  LRK +
Sbjct: 676 NREKDLEKERLKVEQEQSLQNYLANEDWTNA----FLLAMTLDHPLRLFNVLRKSL 727

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 98/247 (39%), Gaps = 35/247 (14%)

Query: 453 FDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKS--IKFWDFQVKQELIAGTSD 510
            +L +S   TT+   + G      +++DG  L T   D+   +KF D           ++
Sbjct: 1   MELKTSYKNTTLSPIYAGTSSVASISSDGSILATPILDEINIVKFID-----------NN 49

Query: 511 KYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKL 570
            Y+   N+ +D   E    I ++++S D K+L  +  +  +K++ +   KF  SL     
Sbjct: 50  SYLLD-NVSNDDEQE----ITALQLSPDGKYLCYASTNQLLKIYNIVEKKFVKSLKISS- 103

Query: 571 PVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN----- 625
           P   + I   + ++     D ++ +  ++      S   H  +I  VKF   +       
Sbjct: 104 PSYVMSIDQTSTLLAVGGTDGSVTVIDIENSYITHSFKGHGATISAVKFYSDASTQNNEG 163

Query: 626 --FFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVS------DNGE---RVVSVSHD 674
              FS    G +K  D  K  C+     H S +  L +       +N E   +++S   D
Sbjct: 164 WLLFSGDTAGMIKVCDMVKRRCLYTFQEHTSAIRGLDIRLSPSHVENDEPLLQLLSGGRD 223

Query: 675 HSIRIWE 681
             + +WE
Sbjct: 224 DIVNLWE 230

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score =  119 bits (298), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 141/637 (22%), Positives = 271/637 (42%), Gaps = 111/637 (17%)

Query: 72  LKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKF--DK 129
           +K S P+ V  +   S + LIA G  DG I + D+ +  +  SF GH   I+ LKF  + 
Sbjct: 98  MKISSPSYV--MDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKFHGEL 155

Query: 130 TGTQLISGSEDSNII--VWDLVSEVGLYKLRSHKGTITGL---WCDSDNW--LISTSKDG 182
            G + +  S D+N +  VWDLV    L+ ++ H   I GL     + ++   L+S  +D 
Sbjct: 156 NGDKWLLASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDD 215

Query: 183 LIKVWDL---KTQQCIETHIAHTG-ECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSK 238
           ++ +W+    K  + ++T   H   E       +D V T+  ++ L++  + LE +   K
Sbjct: 216 IVNLWEFNMKKHSKLLKTVPVHQQVESCGFVRESDLVYTAGGEAVLQL--ISLESQ---K 270

Query: 239 LIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKR 298
           +I+K     Q     L I           FY+  +D+T+++      I + +AI   +  
Sbjct: 271 VIKK----TQKPIEELFIVGVLPILSGREFYLVLSDQTLQL------INMEEAISNFDDE 320

Query: 299 LTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTI 358
           L        ++ ++I+ ++            ++  I+ V   L+     ++ + TNS  +
Sbjct: 321 LI-------NVASSIAGNH-----------GTIADIRVVGPGLN-----KIALATNSPAL 357

Query: 359 EYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKI-WNLNT 417
               +P +  + + P  ++ +    +G    + S+D ++D   LAT S     I W  N 
Sbjct: 358 RIIPIP-QTSENSLPLDVEVY----EGHEDLLNSLDATEDGLWLATCSKDSSAILWRFNV 412

Query: 418 KSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDV 477
           +            T KF P                               H  ++ ++ +
Sbjct: 413 E------------TAKFFPYAKF-------------------------TGHSASVTAVAL 435

Query: 478 TNDGKR-----LVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLEL---GDD 529
            N   R     L+T S D ++K W        +   +++ +  +  +  S         D
Sbjct: 436 PNVMLRGWPEFLITASNDLTVKRWK-------VPKPANEDISDLLTIKQSEYTFHVHAKD 488

Query: 530 ILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSA 589
           I ++ ++ +D   A +  D T K++ +++ +   +L GHK  +  +      K++ TSS 
Sbjct: 489 INALSLAPNDSLFATASYDKTCKIWDVETGESKATLAGHKRGLWDVSFCQYDKLLATSSG 548

Query: 590 DKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKL 649
           DK IKIW LD   C K+L  H +++    F+       S+  DG +K WD    +C++ L
Sbjct: 549 DKTIKIWNLDTFSCVKTLEGHTNAVQRCAFMNKQKQLVSSGADGLIKIWDCITGDCLKTL 608

Query: 650 AAHQSEVWALAVSDNGERVVSVSHDHSIRIWEETDDQ 686
             H + +WA+ V ++G+ ++S   D   + W +  ++
Sbjct: 609 DGHGNRIWAMNVCNDGDLIISADADGVFQFWRDCTEE 645

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/179 (25%), Positives = 78/179 (43%), Gaps = 15/179 (8%)

Query: 514 PQMNIVHDSTLELGDD--ILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLP 571
           P   ++H  T+E  D+  I +++++ D ++L        +K+F LDSMK   S+     P
Sbjct: 47  PTQKLLH--TIENDDEQEITALRLTPDGRYLCYVSQAQQLKIFSLDSMKITRSMKISS-P 103

Query: 572 VLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN-----F 626
              +D    + +I     D +I +  ++ G    S   H  +I  +KF  G  N      
Sbjct: 104 SYVMDSDSTSTLIAIGGTDGSISVVDVENGYITHSFKGHGGTISSLKF-HGELNGDKWLL 162

Query: 627 FSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD-NGE---RVVSVSHDHSIRIWE 681
            S   +G  K WD  K  C+  +  H S +  L   +  GE   +++S   D  + +WE
Sbjct: 163 ASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDDIVNLWE 221

>CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON}
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222c
          Length = 816

 Score =  117 bits (294), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 151/633 (23%), Positives = 267/633 (42%), Gaps = 104/633 (16%)

Query: 72  LKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKF-DKT 130
           LK S P+ V  +     + L+A G  DG I + D+ +  +  SF GH   I+ LKF  + 
Sbjct: 100 LKVSSPSYV--MTCDPTSTLVAIGGTDGSITVIDIENGYIAHSFKGHGGTISSLKFYGEL 157

Query: 131 GTQL-ISGSEDSNII--VWDLVSEVGLYKLRSHKGTITGL-WCDSDNW----LISTSKDG 182
           GT + + GS D+N +  VWDLV+    + ++ H   I G+ +  +D+     LI+  +D 
Sbjct: 158 GTNIWLLGSGDTNGMAKVWDLVTRKCKFTVQEHSSAIRGIDFTKNDDKDVLNLITGGRDN 217

Query: 183 LIKVWDL----KTQQCIETHIAHTGECWALGIMTD----FVVTSSADSQLKIWQMDLEGE 234
           ++ +W      K+ + ++T  AH  +  A G +T     F  T+  D+  +I  +DL   
Sbjct: 218 VLNLWRFNIKGKSSKLVKTIPAHL-QIEACGFITHNDETFAYTAGGDAVFQI--IDLNES 274

Query: 235 PGSKLIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKA--I 292
              K  +K   E       L I      +  + FY   +D+T+++ +   +I  +K+  I
Sbjct: 275 SVVKCTKKPIEE-------LFITGVIPINQGNQFYAVLSDQTIQLLQPNSEIFSSKSEFI 327

Query: 293 KRREKRLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVT 352
           + +E      G   +                                 L L TK +  + 
Sbjct: 328 QIQEYIAGNHGTVAD---------------------------------LCLVTKNKDCIA 354

Query: 353 TNSNTIEYYSVPYEKRDP-TSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELK 411
             +N+     +P  K D  T  T +       +G    + S+  ++D   LATAS  +  
Sbjct: 355 LATNSPSLRIIPLPKIDADTQDTDLPIEVNLYEGHSDLLNSLACTEDGQWLATASKDKTA 414

Query: 412 I-WNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEG 470
           I W+ N  S  + F                 +  T  G+      A+SV    +    E 
Sbjct: 415 ILWHWNNTS--KRF----------------YIYATFVGH------AASVSAVCLPNVME- 449

Query: 471 AIWSLDVTNDGKRLVTGSADKSIKFWDF-QVKQELIAGTSDKYVPQMNIVHDSTLELGDD 529
                   N  K ++T S D ++K W+   +K +L       ++ + +I      E   D
Sbjct: 450 -------KNYPKYIITASNDLTVKKWEIPPMKNDL---NEVPFIVKSSIYTRHAHE--KD 497

Query: 530 ILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSA 589
           I +I ++ +D   A +  D T K++ +D+ +   +L  HK  +  +   +  K I T S 
Sbjct: 498 INAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFCESEKWIATCSG 557

Query: 590 DKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKL 649
           DK +KIW L+     K+L  H +++    F+       SA  DG +K WD    +CI+ L
Sbjct: 558 DKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVWDIASGDCIKNL 617

Query: 650 AAHQSEVWALAVSDNGERVVSVSHDHSIRIWEE 682
             H + +WAL+V ++G+ ++S   D   + W++
Sbjct: 618 DGHSNRIWALSVLEDGDLIISADADSVFQFWKD 650

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 82/185 (44%), Gaps = 3/185 (1%)

Query: 69  SVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFD 128
           S+  + +   +++ +       + A    D   KLW++ +   + +   HK  +  + F 
Sbjct: 487 SIYTRHAHEKDINAISMAPNDSIFATASYDKTCKLWNVDTGEPVATLANHKRGLWDVSFC 546

Query: 129 KTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGLIKVW 187
           ++   + + S D  + +W L S   L  L  H   +    + +    L+S   DGLIKVW
Sbjct: 547 ESEKWIATCSGDKTVKIWSLESFTVLKTLEGHTNAVQRCSFMNKQKQLVSAGADGLIKVW 606

Query: 188 DLKTQQCIETHIAHTGECWALGIMT--DFVVTSSADSQLKIWQMDLEGEPGSKLIEKGAF 245
           D+ +  CI+    H+   WAL ++   D ++++ ADS  + W+   E E    L E    
Sbjct: 607 DIASGDCIKNLDGHSNRIWALSVLEDGDLIISADADSVFQFWKDCTEAEIQGALEENKVR 666

Query: 246 EKQSK 250
            +Q +
Sbjct: 667 VEQEQ 671

>NCAS0C02710 Chr3 complement(505852..508299) [2448 bp, 815 aa] {ON}
           Anc_8.435
          Length = 815

 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 137/590 (23%), Positives = 238/590 (40%), Gaps = 85/590 (14%)

Query: 124 MLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL----WCDSDNWLI-ST 178
           ++  D T T +  G  D +I V D+ +    + L+ H  TI+ L      +S+ WL+ S 
Sbjct: 111 IMDCDSTSTLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVWLLCSG 170

Query: 179 SKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDF----VVTSSADSQLKIWQMDLEGE 234
             +G++KVWDL  ++C+ T   H+     L +        +++   D+   +W  +L+ +
Sbjct: 171 DTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLWNFNLKKK 230

Query: 235 -------PGSKLIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIE 287
                  P  + +E   F           +   T+ G       + +K   I + +K IE
Sbjct: 231 CTLLKTIPVHQQVESCGFINHEHD-----DLIYTAGGDALLQFISLEKATMIKKTKKHIE 285

Query: 288 ------IAKAIKRREKRLTEKGMTEE--DIKTNISESYVSFVMHPFQVVRSMYKIKSVAW 339
                 +   ++  +  L     T E  DIK+N+       +     +  +   I  + +
Sbjct: 286 ELFIIGVLPILENDKMYLVMSDQTLELVDIKSNLLNESSDIIEIESCIAGNNGTIADMKF 345

Query: 340 TLSLSTKLEVVVTTNSNTIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDN 399
                 KL   + TNS T+    VP  +++     PI     E  G    + S+D +DD 
Sbjct: 346 VGPNHDKL--ALATNSPTLRIIPVPSSEQEEL---PINVEMYE--GHEDLLNSLDTTDDG 398

Query: 400 ALLATASNGELKI-WNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASS 458
             +ATAS     I W  N  S I  F+  Y    KF+                       
Sbjct: 399 LWMATASKDHTAIVWKYN--SIINKFQ-PYV---KFI----------------------- 429

Query: 459 VLLTTIEAAHEGAIWSLDVTNDGKR-----LVTGSADKSIKFWDFQVKQELIAGTSDKYV 513
                    H   + ++ + N   R     L+T S D +IK W           T+ +  
Sbjct: 430 --------GHSATVTAVGLPNVMLRGYPEFLLTASNDLTIKKWKIPK-----PSTTVEED 476

Query: 514 PQMNIVHDSTLELGD-DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPV 572
            Q+  V + T    + DI ++ IS +D   A +  D T K++ L++ +   +L  HK  +
Sbjct: 477 CQIVKVSEYTRRAHEKDINALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGL 536

Query: 573 LSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKD 632
             +      K+I T S DK IKIW LD     K+L  H +++    F+       S+  D
Sbjct: 537 WDVAFCQYDKLIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGAD 596

Query: 633 GFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEE 682
           G +K WD    +C++ L  H + +WAL   ++G+ +VS   D   + W++
Sbjct: 597 GLIKIWDCSTGDCLKTLDGHDNRIWALTEINDGDMIVSADADGVFQFWKD 646

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 149/613 (24%), Positives = 236/613 (38%), Gaps = 117/613 (19%)

Query: 72  LKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTG 131
           +K S P  +  +   S + L+A G  DG I + D+ +  +  S  GH + I+ LKF    
Sbjct: 103 MKMSSPCYI--MDCDSTSTLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQA 160

Query: 132 TQ----LISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCD--SDNW-LISTSKDGLI 184
                 L SG  +  + VWDLV    L+ ++ H   + GL      D W LIS  +D + 
Sbjct: 161 NSNVWLLCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVC 220

Query: 185 KVW--DLKTQQCIETHIAHTGECWALGIMT----DFVVTSSADSQLKIWQMDLEGEPGSK 238
            +W  +LK +  +   I    +  + G +     D + T+  D+ L+   +         
Sbjct: 221 TLWNFNLKKKCTLLKTIPVHQQVESCGFINHEHDDLIYTAGGDALLQFISL--------- 271

Query: 239 LIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKR 298
             EK    K++K+    IE                    E+F     I +   ++  +  
Sbjct: 272 --EKATMIKKTKKH---IE--------------------ELFI----IGVLPILENDKMY 302

Query: 299 LTEKGMTEE--DIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSN 356
           L     T E  DIK+N+       +     +  +   I  + +      KL   + TNS 
Sbjct: 303 LVMSDQTLELVDIKSNLLNESSDIIEIESCIAGNNGTIADMKFVGPNHDKL--ALATNSP 360

Query: 357 TIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKI-WNL 415
           T+    VP  +++     PI     E  G    + S+D +DD   +ATAS     I W  
Sbjct: 361 TLRIIPVPSSEQE---ELPINVEMYE--GHEDLLNSLDTTDDGLWMATASKDHTAIVWKY 415

Query: 416 NTKSCIRTFE-----CGYA--LTCKFLPGGLLVVVGTREGNLQLFDLASSVLL------- 461
           N  S I  F+      G++  +T   LP  +L       G  +    AS+ L        
Sbjct: 416 N--SIINKFQPYVKFIGHSATVTAVGLPNVML------RGYPEFLLTASNDLTIKKWKIP 467

Query: 462 ---TTIEA-------------AHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELI 505
              TT+E              AHE  I +L ++ +     T S DK+ K WD +   EL 
Sbjct: 468 KPSTTVEEDCQIVKVSEYTRRAHEKDINALAISPNDSIFATASYDKTCKIWDLE-NGELT 526

Query: 506 AGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSL 565
           A  S+         H   L        +     DK +A    D T+K++ LD+     +L
Sbjct: 527 ATLSN---------HKRGL------WDVAFCQYDKLIATCSGDKTIKIWSLDTFSVMKTL 571

Query: 566 YGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN 625
            GH   V      +    +++S AD  IKIW    GDC K+L  H + I  +  +     
Sbjct: 572 EGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCSTGDCLKTLDGHDNRIWALTEINDGDM 631

Query: 626 FFSASKDGFVKYW 638
             SA  DG  ++W
Sbjct: 632 IVSADADGVFQFW 644

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 104/234 (44%), Gaps = 10/234 (4%)

Query: 73  KSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGT 132
           + +   +++ L       + A    D   K+WDL +  +  + + HK  +  + F +   
Sbjct: 487 RRAHEKDINALAISPNDSIFATASYDKTCKIWDLENGELTATLSNHKRGLWDVAFCQYDK 546

Query: 133 QLISGSEDSNIIVWDLVSEVGLYKLRSHKGTIT-GLWCDSDNWLISTSKDGLIKVWDLKT 191
            + + S D  I +W L +   +  L  H   +   ++ +    L+S+  DGLIK+WD  T
Sbjct: 547 LIATCSGDKTIKIWSLDTFSVMKTLEGHTNAVQRCMFINKQLQLVSSGADGLIKIWDCST 606

Query: 192 QQCIETHIAHTGECWALGIMT--DFVVTSSADSQLKIWQ--MDLEGEPGSKLIEKGAFEK 247
             C++T   H    WAL  +   D +V++ AD   + W+   +LE E   +L ++   ++
Sbjct: 607 GDCLKTLDGHDNRIWALTEINDGDMIVSADADGVFQFWKDCTELEKEQNLELEKEKVEKE 666

Query: 248 QSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFR-LRKDIEIAKAIKRREKRLT 300
           Q+ +  L  E  T +    F      D  + +F  L++ +   KA    + ++T
Sbjct: 667 QTLKNYLLNEDWTNA----FLLALTLDHPMRVFNVLKQSLNARKAGSEEQGKIT 716

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 54/238 (22%), Positives = 101/238 (42%), Gaps = 25/238 (10%)

Query: 453 FDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKY 512
            DL +S   TT+   + G+     V+ DG  L T   D            E+I+ T+   
Sbjct: 1   MDLKTSYQSTTLRPIYAGSSAIATVSADGTVLATPILDDI----------EIISLTT--- 47

Query: 513 VPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKF----FLSLYGH 568
            PQ  + H    +   +I ++K++ D ++L+    +  +K+F LD  K      +     
Sbjct: 48  -PQRRL-HSIANDDEQEITALKLTPDAQYLSFISQNQLLKIFKLDQEKKDQGKIIRSMKM 105

Query: 569 KLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN--- 625
             P   +D    + ++     D +I +  ++ G    SL  H  +I  +KF   +++   
Sbjct: 106 SSPCYIMDCDSTSTLVALGGTDGSITVVDIENGFITHSLKGHGATISALKFFGQANSNVW 165

Query: 626 -FFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGE--RVVSVSHDHSIRIW 680
              S   +G VK WD  K +C+  +  H + V  L V + G+  +++S   D+   +W
Sbjct: 166 LLCSGDTNGMVKVWDLVKRKCLHTMQEHSNAVRGLDVREVGDEWQLISGGRDNVCTLW 223

>TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8.435
           YLR222C
          Length = 835

 Score =  113 bits (283), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 143/610 (23%), Positives = 247/610 (40%), Gaps = 104/610 (17%)

Query: 124 MLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWC----DSDNWLISTS 179
           +L+ D T T L  G  D ++ V D+ +    + L+ H  TI+ L       ++ WL+S+ 
Sbjct: 119 VLETDPTSTLLAIGGTDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQHTNTWLLSSG 178

Query: 180 -KDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDF-------------VVTSSADSQLK 225
             +G++K+WDL +++ I T   H      +    DF             ++T + D  + 
Sbjct: 179 DTNGMVKIWDLVSRKAIHTLQEHNSAVRGI----DFKLIEKKNSEDSLQLITGARDDVIN 234

Query: 226 IWQM-DLEGEPGSKLIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRK 284
            W+  D+      KL++     +Q +  G  I            Y    D  ++I  L  
Sbjct: 235 HWEFKDVTNLKRCKLLKTIPVHQQIEACGFIINIDGID--DDLIYTSGGDAVLQIVSLNN 292

Query: 285 DIEIAKAIKRREKRLTEKGMTEEDIKTNISESYVSFVMHPFQVV----------RSMYKI 334
           +      +K+ +K L E  +       N ++ Y+ F     Q+V            +  +
Sbjct: 293 N----SIVKKSKKPLEELFIIGVLPVRNFTQLYLVFSDQTLQLVDLKDTFSNPKEYIEVV 348

Query: 335 KSVAWTLSLSTKLEVV--------VTTNSNTIEYYSVPYEKRDPTSPTPIKAHTIELQGS 386
            S+A        ++VV        + TNS+T+    +P    D ++   I   + EL   
Sbjct: 349 SSLAGNHGTIADMKVVGPNFDKLALATNSSTLRI--IPISDVDDSNSVSI---STELYEG 403

Query: 387 RTDV-RSIDISDDNALLATASNGELKI-WNLNTKSCIRTFECGYALTCKFLPGGLLVVVG 444
            TD+  ++D ++D   +ATAS     I W  N ++   T  C YA       G +  V  
Sbjct: 404 HTDLLNAVDATEDGLWIATASKDNSAILWRYNPRT---TLFCKYA----HFQGHVSSV-- 454

Query: 445 TREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDG--KRLVTGSADKSIKFWDF---- 498
                       +SV L              +V N G  + L+T S D ++K W      
Sbjct: 455 ------------TSVGLP-------------NVMNKGWPEYLITASNDLTVKKWKVPKPT 489

Query: 499 -QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLD 557
            +   E+ + +S +Y  +    H+       DI  + IS +D   A +  D T K++ L+
Sbjct: 490 DRFDIEIYSISSSEYTRR---AHEK------DINMLSISPNDSIFATASYDKTCKIWDLE 540

Query: 558 SMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCV 617
           + +   +L  HK  +  +      K I T+S DK +KIW LD     K+L  H +++   
Sbjct: 541 TGELKATLNNHKRGLWDVSFCQYDKFIATASGDKTVKIWSLDTFTVVKTLEGHSNAVQRC 600

Query: 618 KFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSI 677
            F        S   DG VK WD    ECI  L  H + +WAL V  +G+ V++   D   
Sbjct: 601 SFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIWALNVIKDGDIVITADADGVF 660

Query: 678 RIWEETDDQV 687
           + W++  ++ 
Sbjct: 661 QFWKDRTEEA 670

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 81/182 (44%), Gaps = 4/182 (2%)

Query: 73  KSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGT 132
           + +   +++ L       + A    D   K+WDL +  +  + N HK  +  + F +   
Sbjct: 506 RRAHEKDINMLSISPNDSIFATASYDKTCKIWDLETGELKATLNNHKRGLWDVSFCQYDK 565

Query: 133 QLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGLIKVWDLKT 191
            + + S D  + +W L +   +  L  H   +    + +    L+ST  DGL+K+WD  T
Sbjct: 566 FIATASGDKTVKIWSLDTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCST 625

Query: 192 QQCIETHIAHTGECWALGIMT--DFVVTSSADSQLKIWQMDLEGEPGSKLIEKGAFEKQS 249
            +CI T   H    WAL ++   D V+T+ AD   + W+ D   E   + IEK   + + 
Sbjct: 626 GECINTLDGHDNRIWALNVIKDGDIVITADADGVFQFWK-DRTEEAREEDIEKEKLKVEQ 684

Query: 250 KQ 251
            Q
Sbjct: 685 MQ 686

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 69/155 (44%), Gaps = 19/155 (12%)

Query: 49  VWDLKTSELEYVLSD---GLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWD 105
           +WDL+T EL+  L++   GL             +VS+ Q+      IA    D  +K+W 
Sbjct: 536 IWDLETGELKATLNNHKRGL------------WDVSFCQYDK---FIATASGDKTVKIWS 580

Query: 106 LVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTIT 165
           L + TV+ +  GH + +    F     QL+S   D  + +WD  +   +  L  H   I 
Sbjct: 581 LDTFTVVKTLEGHSNAVQRCSFFNKQKQLVSTGADGLVKLWDCSTGECINTLDGHDNRIW 640

Query: 166 GLWCDSD-NWLISTSKDGLIKVWDLKTQQCIETHI 199
            L    D + +I+   DG+ + W  +T++  E  I
Sbjct: 641 ALNVIKDGDIVITADADGVFQFWKDRTEEAREEDI 675

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 47/92 (51%), Gaps = 11/92 (11%)

Query: 78  AEVSYLQF----HSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKF------ 127
           A +S L+F    H+ T L+++G  +G++K+WDLVS+  + +   H S +  + F      
Sbjct: 157 ATISSLKFYGEQHTNTWLLSSGDTNGMVKIWDLVSRKAIHTLQEHNSAVRGIDFKLIEKK 216

Query: 128 -DKTGTQLISGSEDSNIIVWDLVSEVGLYKLR 158
             +   QLI+G+ D  I  W+      L + +
Sbjct: 217 NSEDSLQLITGARDDVINHWEFKDVTNLKRCK 248

 Score = 35.4 bits (80), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 68/167 (40%), Gaps = 12/167 (7%)

Query: 529 DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSS 588
           +I ++ ++ D ++L        +K+F L + K   S+     P   L+    + ++    
Sbjct: 75  EITALALTPDAQYLCYVSQAQLLKIFKLSTGKIVKSMKISS-PSYVLETDPTSTLLAIGG 133

Query: 589 ADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN----FFSASKDGFVKYWDGDKFE 644
            D ++ +  ++ G    SL  H  +I  +KF    H       S   +G VK WD    +
Sbjct: 134 TDGSVTVIDIENGYITHSLKGHGATISSLKFYGEQHTNTWLLSSGDTNGMVKIWDLVSRK 193

Query: 645 CIQKLAAHQSEVWALAV-------SDNGERVVSVSHDHSIRIWEETD 684
            I  L  H S V  +         S++  ++++ + D  I  WE  D
Sbjct: 194 AIHTLQEHNSAVRGIDFKLIEKKNSEDSLQLITGARDDVINHWEFKD 240

>Kpol_1031.49 s1031
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 bp, 760 aa] {ON}
           (132811..133005,133055..133063,133288..133320,
           133324..133428,133432..135372) [2283 nt, 761 aa]
          Length = 760

 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 143/654 (21%), Positives = 268/654 (40%), Gaps = 93/654 (14%)

Query: 70  VDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFN---GHKSRITMLK 126
           +D KSS  + VS    ++ TG +A    DG I    +V +  +++     G+ + +T ++
Sbjct: 1   MDFKSSY-SNVSLSPIYASTGAVATISEDGSILATPVVDEINIVALEDNAGNGTLLTTVE 59

Query: 127 FDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL--WCDSDN--WLISTSKDG 182
            D        G     + V D+ + +  + L+ H  TI+ L  + +S++  WL+++    
Sbjct: 60  NDDEQDXXXGGP----VSVLDIENYI-THSLKGHGATISSLKFYGESEDSVWLLASGDTN 114

Query: 183 LIKVWDLKTQQCIETHIAHTGECWALGIM---TD----FVVTSSADSQLKIWQMDLEGEP 235
           ++KVWDL  ++CI T   H+     +      TD     +VT   D+ +  W   + G  
Sbjct: 115 MVKVWDLVKRKCIHTLQEHSSAVRGIDFKQSSTDSDIIHLVTGGRDNIINHWT--ISGLK 172

Query: 236 GSKLIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRR 295
             KLI      +Q +  G    F  +++  +  Y    D   +I  L         IK+ 
Sbjct: 173 NFKLIRTFPVHQQVEACG----FIKSTEDDNCIYTAGGDAVFQILSLSN----GSVIKKT 224

Query: 296 EKRLTEKGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKL-------- 347
           +K   E  +       N ++ Y+       Q++  +   +  +  +++ + +        
Sbjct: 225 KKPTEELFIIGVLPIKNFTKLYLVLSDQTLQLIDLIDTFEEDSEIITIKSSIAGNHGTIA 284

Query: 348 ----------EVVVTTNSNTIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDV-RSIDIS 396
                      + + TNS T+    +P    D  +  P+    +EL     D+  S+D +
Sbjct: 285 DMRLVGPELKSIALATNSPTLRI--IPVISEDNKNNIPLG---VELYDGHEDLLNSLDAT 339

Query: 397 DDNALLATAS-NGELKIWNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDL 455
           +D   +ATAS +    +W  N       F+  YA                     Q    
Sbjct: 340 EDGLWIATASKDNTAMLWRFNDSE--NKFK-KYA---------------------QFIGH 375

Query: 456 ASSVLLTTIEAAHEGAIWSLDVTNDG--KRLVTGSADKSIKFWDFQVKQELIAGTSDKYV 513
           ASSV   ++           +V N+G  + ++T S D ++K W  +V        +D  +
Sbjct: 376 ASSVTSVSLP----------NVINNGWPEFIITSSNDFTVKKW--KVPSPTKKSDNDDDM 423

Query: 514 PQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVL 573
             + +   +      DI ++ I+ +D   A +  D T K++ LDS +   +L  HK  + 
Sbjct: 424 HLIKVSEYTRRAHEKDINALSIAPNDSIFATASYDKTCKIWDLDSGELMATLANHKRGLW 483

Query: 574 SLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDG 633
            +      K I T+S DK IKIW L+      +L  H +++    F+       S   DG
Sbjct: 484 DVSFCQYDKYIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQIVSTGADG 543

Query: 634 FVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEETDDQV 687
            +K WD    EC++ L  H + +WAL V  +G+ +++   D   + W++  ++V
Sbjct: 544 LIKIWDCSSGECLKTLDGHANRIWALCVLRDGDMIITADADGVFQFWKDCTEEV 597

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 82/182 (45%), Gaps = 4/182 (2%)

Query: 73  KSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGT 132
           + +   +++ L       + A    D   K+WDL S  ++ +   HK  +  + F +   
Sbjct: 433 RRAHEKDINALSIAPNDSIFATASYDKTCKIWDLDSGELMATLANHKRGLWDVSFCQYDK 492

Query: 133 QLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGLIKVWDLKT 191
            + + S D  I +W L +   +  L  H   +    + +    ++ST  DGLIK+WD  +
Sbjct: 493 YIATASGDKTIKIWSLETFKVVNTLEGHTNAVQRCSFINKQKQIVSTGADGLIKIWDCSS 552

Query: 192 QQCIETHIAHTGECWALGIMT--DFVVTSSADSQLKIWQMDLEGEPGSKLIEKGAFEKQS 249
            +C++T   H    WAL ++   D ++T+ AD   + W+ D   E   + +EK     + 
Sbjct: 553 GECLKTLDGHANRIWALCVLRDGDMIITADADGVFQFWK-DCTEEVKEQDLEKEKLRVEQ 611

Query: 250 KQ 251
           +Q
Sbjct: 612 EQ 613

>SAKL0H12760g Chr8 complement(1089272..1091797) [2526 bp, 841 aa]
           {ON} highly similar to uniprot|Q05946 Saccharomyces
           cerevisiae YLR222C UTP13 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 841

 Score =  110 bits (275), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 137/642 (21%), Positives = 261/642 (40%), Gaps = 124/642 (19%)

Query: 100 VIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRS 159
           +++++ L SK ++ S     S + +++ D T T L  G  D ++ + D+ +    +  + 
Sbjct: 103 LLRVYHLPSKKIVRSMKV-SSPVYVMECDVTSTLLAIGGTDGSVSIIDIENGYVTHSFKG 161

Query: 160 HKGTITGL----WCDSDNW-LISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDF 214
           H GTI+ +      +S+ W L S    G++K+WDL  ++C+ T   HT     L    DF
Sbjct: 162 HGGTISSVKFHGELNSNVWRLASGDTTGVVKIWDLVKRKCLHTVQEHTMAVRGL----DF 217

Query: 215 -----------VVTSSADSQLKIWQMDLEGEPGSKLIEKGAFEKQSKQRGLSIEFTTTSD 263
                      +++   D+ + ++Q D       KL++     +Q +  G    F  T  
Sbjct: 218 RVLDEDEDQMQLISGGRDNIINLYQFD--SRKKCKLLKTLPIHQQVESCG----FINTGG 271

Query: 264 GVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKR-----------------LTEKGMTE 306
             +  Y   +D   +I  L     I K  +  E+                  L+++ +  
Sbjct: 272 VQNCVYTAGSDAVYQIVSLDTGSVIRKTAQPIEELFIIGVLPILEGSKMFLILSDQTLFL 331

Query: 307 EDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLS----LSTKLE-VVVTTNSNTIEYY 361
            D++  I+           +++    KI     T++    +  KL+ + + TNS T+   
Sbjct: 332 IDVEAAIANED--------EIIDIELKIAGNHGTIADMRFVGPKLDKLALATNSPTLRVI 383

Query: 362 SVPY---------------EKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATAS 406
            VP                +K +   P  ++ +    +G    + S+D ++D   LATAS
Sbjct: 384 PVPVYGNEEEERDEEMEDDQKEEIQLPIEVEMY----EGHEDLLNSLDATEDGMWLATAS 439

Query: 407 NGELKI-WNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIE 465
                I W  + ++ +      +    KF+                              
Sbjct: 440 KDNFVILWRYDEQTEL------FKQYAKFV------------------------------ 463

Query: 466 AAHEGAIWSLDVTNDGKR-----LVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVH 520
             H G + ++ + N   R     L++ S D +IK W     ++   G    +V + +   
Sbjct: 464 -GHAGPVTAVGLPNVMNRPWPEFLLSASNDLTIKKWAVPKPED---GKDTVHVVKASEYT 519

Query: 521 DSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDD 580
               E   DI ++ +S +D   A +  D T K++ LD+ +   +L  HK  +  ++    
Sbjct: 520 RRAHE--KDINALAVSPNDSVFATASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQY 577

Query: 581 TKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDG 640
            K++ T S DK +KIW LD     K+L  H +++    F+  +    S+  DG VK WD 
Sbjct: 578 DKLLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDC 637

Query: 641 DKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEE 682
              EC++ L AH + +WAL+V  +G+ +V+   D   + W++
Sbjct: 638 STGECVKTLDAHNNRIWALSVLKDGDIIVTADADGVFQFWKD 679

 Score = 65.9 bits (159), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 72/159 (45%), Gaps = 3/159 (1%)

Query: 73  KSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGT 132
           + +   +++ L       + A    D   K+W L +  +  +   HK  +  + F +   
Sbjct: 520 RRAHEKDINALAVSPNDSVFATASYDKTCKIWSLDTGELEATLANHKRGLWDVNFCQYDK 579

Query: 133 QLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKT 191
            L + S D  + +W L +   +  L  H   +      S N  L+S+  DGL+K+WD  T
Sbjct: 580 LLATCSGDKTVKIWSLDTYSVMKTLEGHTNAVQRCSFISKNKQLVSSGADGLVKLWDCST 639

Query: 192 QQCIETHIAHTGECWALGIMT--DFVVTSSADSQLKIWQ 228
            +C++T  AH    WAL ++   D +VT+ AD   + W+
Sbjct: 640 GECVKTLDAHNNRIWALSVLKDGDIIVTADADGVFQFWK 678

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 62/132 (46%), Gaps = 12/132 (9%)

Query: 72  LKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKF---- 127
           +K S P  V  ++    + L+A G  DG + + D+ +  V  SF GH   I+ +KF    
Sbjct: 118 MKVSSPVYV--MECDVTSTLLAIGGTDGSVSIIDIENGYVTHSFKGHGGTISSVKFHGEL 175

Query: 128 DKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL---WCDSDN---WLISTSKD 181
           +    +L SG     + +WDLV    L+ ++ H   + GL     D D     LIS  +D
Sbjct: 176 NSNVWRLASGDTTGVVKIWDLVKRKCLHTVQEHTMAVRGLDFRVLDEDEDQMQLISGGRD 235

Query: 182 GLIKVWDLKTQQ 193
            +I ++   +++
Sbjct: 236 NIINLYQFDSRK 247

 Score = 38.9 bits (89), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 70/163 (42%), Gaps = 12/163 (7%)

Query: 529 DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSS 588
           +I +++I+ D +FL        ++V+ L S K   S+     PV  ++    + ++    
Sbjct: 82  EITALRITPDGQFLCFVSQAQLLRVYHLPSKKIVRSMKVSS-PVYVMECDVTSTLLAIGG 140

Query: 589 ADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN-----FFSASKDGFVKYWDGDKF 643
            D ++ I  ++ G    S   H  +I  VKF  G  N       S    G VK WD  K 
Sbjct: 141 TDGSVSIIDIENGYVTHSFKGHGGTISSVKF-HGELNSNVWRLASGDTTGVVKIWDLVKR 199

Query: 644 ECIQKLAAHQSEVWAL--AVSDNGE---RVVSVSHDHSIRIWE 681
           +C+  +  H   V  L   V D  E   +++S   D+ I +++
Sbjct: 200 KCLHTVQEHTMAVRGLDFRVLDEDEDQMQLISGGRDNIINLYQ 242

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 155/658 (23%), Positives = 251/658 (38%), Gaps = 135/658 (20%)

Query: 72  LKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTG 131
           +K S P  V  +   S + L+A G  DG + + D+ +  V  SF GH + I+ +KF   G
Sbjct: 98  MKVSSPVYV--MDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFH--G 153

Query: 132 TQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKT 191
            Q  SGS      +W L S                               G++KVWDL  
Sbjct: 154 EQ--SGS------IWRLAS---------------------------GDTSGMVKVWDLVR 178

Query: 192 QQCIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQ---------MDLEGEPGSKLIEK 242
           + CI T   H      L    DF ++ + D  L++             L     +KL+  
Sbjct: 179 RNCIHTIQEHAAAVRGL----DFRLSPADDGVLELLTGGRDDIVNLFQLNSTKKAKLMRT 234

Query: 243 GAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLTEK 302
               +Q +  G    F   S     FY    D   +I        +AK  K+  + L   
Sbjct: 235 IPVHQQIEACG----FIRDSPDGSLFYTAGGDAVFQILSF-TSASVAKRTKKPIEELFII 289

Query: 303 G----MTEEDIKTNISESYVSFVMHPFQVVRS------MYKIKSVAWTLS----LSTKLE 348
           G    M    +   +S+  +  V     + +        +KI     T++    +  +L+
Sbjct: 290 GVLPIMQGSKVYLVLSDQTLFLVNLSASLSKDGDEIVIEHKIAGNHGTVADMRFVGKELD 349

Query: 349 -VVVTTNSNTIEYYSVPYEKRD-------PTSPTPIK---AHTIELQGSRTDV-RSIDIS 396
            + + TNS  +   + P  K +       PTS   I+      +EL    TD+  S+D S
Sbjct: 350 KLALATNSPALRVITAPVTKHNAAEKEDEPTSKVDIQNCLPLEVELYEGHTDLLNSLDSS 409

Query: 397 DDNALLATASNGELKI-WNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDL 455
           ++   LAT S     I W LN  S             KF P                   
Sbjct: 410 ENGEWLATCSKDHTVILWKLNADSE------------KFKPYARFT-------------- 443

Query: 456 ASSVLLTTIEAAHEGAIWSLDVTNDGKR-----LVTGSADKSIKFWDFQVKQELIAGTSD 510
                       H G + ++ + N  +      ++T S D +IK W        +   + 
Sbjct: 444 -----------GHAGPVTAVGLPNVMRNTWPEFIITASNDLTIKKWS-------VPKPTS 485

Query: 511 KYVPQMNI-VHDSTLELGD-DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGH 568
             V   NI V D T    + DI ++ IS +D   A +  D T K++ +DS +   +L  H
Sbjct: 486 NDVDMHNIKVSDYTRRAHEKDINALSISPNDSVFATASYDKTCKIWNVDSGELEGTLANH 545

Query: 569 KLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFS 628
           K  +  +      K++ T S DK IK+W L+     K+L  H +++    F+  +    S
Sbjct: 546 KRGLWDVTFCQYDKLLATCSGDKTIKVWSLESMSVVKTLEGHTNAVQRCSFINRNKQIVS 605

Query: 629 ASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEETDDQ 686
              DG +K WD    ECI+ L AH + +WAL+V  +G+  V+   D   + W++  ++
Sbjct: 606 TGADGLIKVWDLSTGECIRTLDAHSNRIWALSVLSDGKEFVTADADGVFQFWKDCSEE 663

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 65/152 (42%), Gaps = 9/152 (5%)

Query: 514 PQMNIVHDSTLELGDD--ILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLP 571
           P   ++H  T+E  D+  I ++K++ + ++L        ++++ L S K   S+     P
Sbjct: 47  PTKRLIH--TIENDDEQEITALKLTPNGEYLCFVSQAQLLRIYKLSSKKIIRSMKVSS-P 103

Query: 572 VLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKF---LPGS-HNFF 627
           V  +D    + ++     D ++ +  ++ G    S   H  +I  VKF     GS     
Sbjct: 104 VYVMDCDSSSTLVALGGTDGSVTVVDIENGYVTHSFKGHGATISSVKFHGEQSGSIWRLA 163

Query: 628 SASKDGFVKYWDGDKFECIQKLAAHQSEVWAL 659
           S    G VK WD  +  CI  +  H + V  L
Sbjct: 164 SGDTSGMVKVWDLVRRNCIHTIQEHAAAVRGL 195

>KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 826

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 146/653 (22%), Positives = 249/653 (38%), Gaps = 135/653 (20%)

Query: 100 VIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRS 159
           +++++ L SK V+ S     S + ++  D + T +  G  D ++ V D+ +    + L+ 
Sbjct: 83  LLRIYHLRSKRVVRSMKV-SSPVYVIDCDPSSTLVALGGTDGSVSVIDIENGYVTHSLKG 141

Query: 160 HKGTITGL----WCDSDNW-LISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDF 214
           H  TI+ +      +S  W L S   +G++KVWDL  + C+ T   H      L    DF
Sbjct: 142 HGATISSVKFFGELNSTTWRLGSGDTNGVVKVWDLVRRSCLHTIQEHAAAVRGL----DF 197

Query: 215 VVTSSADSQLKIWQ---------MDLEGEPGSKLIEKGAFEKQSKQRGLSIEFTTTSDGV 265
            V+ + D  L++             L      KL++     +Q +  G         DG 
Sbjct: 198 RVSDADDDVLELLSGGRDDIVNLYQLGSTKKVKLVKTIPVHQQIEACGF------IHDGE 251

Query: 266 H--FFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLTEKGMTEEDIKTNISESYVSFVMH 323
           H   FY    D   +I  L      A  IK+  K               I E ++  V+ 
Sbjct: 252 HQDLFYTAGGDAVYQILSL----ATASVIKKTNKP--------------IEELFIIGVL- 292

Query: 324 PFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEYYSVPYEKRDPTSPTPIKAHTIEL 383
           P      MY        L LS +   +V   ++ +E          P +   I++     
Sbjct: 293 PILQGSKMY--------LVLSDQTLFLVDLEASFVE----------PDTAVVIESKIAGN 334

Query: 384 QGSRTDVRSIDISDDNALLATASNGE----LKIWNLNTKSCIRTFECGYALTCKFLPGGL 439
            G+  D+R   +  D   LA A+N      +   +LN KS +           +      
Sbjct: 335 HGTVADMRF--VGPDLKFLALATNSPALRVIPAPDLNAKSIVSDETTAARDHAQDSRDCF 392

Query: 440 LVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQ 499
            + V   EG+  L +                   +LD + DGK L T S D ++  W + 
Sbjct: 393 PLEVELYEGHTDLLN-------------------ALDSSEDGKWLATCSKDHTVILWRYS 433

Query: 500 VKQE-------------------------------LIAGTSDKYV--------------P 514
            + E                               +I  ++D  +              P
Sbjct: 434 SELEKFKAYAKFTGHAGPVTAVGLPNVMRSAWPEFIITASNDLTIKKWTVPKPGHETAEP 493

Query: 515 QMNIVHDSTLELGD-DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVL 573
            +  V D T    D DI ++ IS +D   A +  D T KV+ +DS +   +L  HK  + 
Sbjct: 494 HVVKVSDYTRRAHDKDINALSISPNDSTFATASYDKTCKVWDVDSGELQGTLANHKRGLW 553

Query: 574 SLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDG 633
            +      K++ T S DK +K+W LD     K+L  H +++    F+  +    S   DG
Sbjct: 554 DVSFCQYDKLLATCSGDKTVKVWSLDTLSVVKTLEGHTNAVQRCSFINKNKQLVSTGADG 613

Query: 634 FVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEETDDQ 686
            +K WD    EC++ L AH++ +WAL+V  +G+  V+   D   + W++  ++
Sbjct: 614 LIKLWDLSTGECVRTLDAHENRIWALSVLHDGDEFVTADADGVFQFWKDCSEE 666

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 70/153 (45%), Gaps = 3/153 (1%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           +++ L         A    D   K+WD+ S  +  +   HK  +  + F +    L + S
Sbjct: 509 DINALSISPNDSTFATASYDKTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCS 568

Query: 139 EDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGLIKVWDLKTQQCIET 197
            D  + VW L +   +  L  H   +    + + +  L+ST  DGLIK+WDL T +C+ T
Sbjct: 569 GDKTVKVWSLDTLSVVKTLEGHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRT 628

Query: 198 HIAHTGECWALGIMTDF--VVTSSADSQLKIWQ 228
             AH    WAL ++ D    VT+ AD   + W+
Sbjct: 629 LDAHENRIWALSVLHDGDEFVTADADGVFQFWK 661

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 86/201 (42%), Gaps = 47/201 (23%)

Query: 349 VVVTTNSNTIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATAS-- 406
           ++  +N  TI+ ++VP    +   P  +K      +    D+ ++ IS +++  ATAS  
Sbjct: 469 IITASNDLTIKKWTVPKPGHETAEPHVVKVSDYTRRAHDKDINALSISPNDSTFATASYD 528

Query: 407 ---------NGEL--------------------------------KIWNLNTKSCIRTFE 425
                    +GEL                                K+W+L+T S ++T E
Sbjct: 529 KTCKVWDVDSGELQGTLANHKRGLWDVSFCQYDKLLATCSGDKTVKVWSLDTLSVVKTLE 588

Query: 426 --CGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKR 483
                   C F+     +V    +G ++L+DL++   + T++A HE  IW+L V +DG  
Sbjct: 589 GHTNAVQRCSFINKNKQLVSTGADGLIKLWDLSTGECVRTLDA-HENRIWALSVLHDGDE 647

Query: 484 LVTGSADKSIKFW-DFQVKQE 503
            VT  AD   +FW D   +QE
Sbjct: 648 FVTADADGVFQFWKDCSEEQE 668

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 65/132 (49%), Gaps = 12/132 (9%)

Query: 72  LKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKF---- 127
           +K S P  V  +     + L+A G  DG + + D+ +  V  S  GH + I+ +KF    
Sbjct: 98  MKVSSPVYV--IDCDPSSTLVALGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFFGEL 155

Query: 128 DKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL---WCDSDN---WLISTSKD 181
           + T  +L SG  +  + VWDLV    L+ ++ H   + GL     D+D+    L+S  +D
Sbjct: 156 NSTTWRLGSGDTNGVVKVWDLVRRSCLHTIQEHAAAVRGLDFRVSDADDDVLELLSGGRD 215

Query: 182 GLIKVWDLKTQQ 193
            ++ ++ L + +
Sbjct: 216 DIVNLYQLGSTK 227

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 49/226 (21%), Positives = 92/226 (40%), Gaps = 24/226 (10%)

Query: 453 FDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKY 512
            DL SS   + +   + G+     V+ DG+ L T   D+            +I     + 
Sbjct: 1   MDLKSSYSNSELRPFYAGSGAVASVSEDGRLLATSVIDEV----------NII-----EL 45

Query: 513 VPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPV 572
            P   ++H    +   +I ++K++ D ++L        ++++ L S +   S+     PV
Sbjct: 46  APTKRVLHRIENDDEQEITALKLTPDGEYLCYVSQAQLLRIYHLRSKRVVRSMKVSS-PV 104

Query: 573 LSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN-----FF 627
             +D    + ++     D ++ +  ++ G    SL  H  +I  VKF  G  N       
Sbjct: 105 YVIDCDPSSTLVALGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFF-GELNSTTWRLG 163

Query: 628 SASKDGFVKYWDGDKFECIQKLAAHQSEVWAL--AVSDNGERVVSV 671
           S   +G VK WD  +  C+  +  H + V  L   VSD  + V+ +
Sbjct: 164 SGDTNGVVKVWDLVRRSCLHTIQEHAAAVRGLDFRVSDADDDVLEL 209

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 91  LIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVW-DLV 149
           L++ G ADG+IKLWDL +   + + + H++RI  L     G + ++   D     W D  
Sbjct: 606 LVSTG-ADGLIKLWDLSTGECVRTLDAHENRIWALSVLHDGDEFVTADADGVFQFWKDCS 664

Query: 150 SEVGLYKLRSHK 161
            E     L +HK
Sbjct: 665 EEQEKENLENHK 676

>KLLA0F13244g Chr6 (1224178..1226622) [2445 bp, 814 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA
          Length = 814

 Score =  107 bits (266), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 149/653 (22%), Positives = 262/653 (40%), Gaps = 118/653 (18%)

Query: 81  SYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSED 140
           SYL F S+  L+         +++ L  + ++ S     S + ++  D+T T L  G  D
Sbjct: 73  SYLCFVSQAQLL---------RVYSLKQERIIRSMK-ISSPVYVMNCDQTSTLLAIGGTD 122

Query: 141 SNIIVWDLVSEVGLYKLRSHKGTITGL----WCDSDNW-LISTSKDGLIKVWDLKTQQCI 195
            ++ V D+ +    + L+ H  TI+ +      +S+ W L S   +G+IKVWDL  + C 
Sbjct: 123 GSVSVIDIENGYVTHSLKGHGATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKRNCQ 182

Query: 196 ETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGS--KLIEKGAFEKQSKQRG 253
            T   HT     L    DF VT      L++    L G   +   L E  + +K    + 
Sbjct: 183 CTIQEHTTAVRGL----DFRVTDEEKGTLQL----LSGGRDNILNLFEFNSTKKYKLLKT 234

Query: 254 LSIEFTTTSDGVHFFYVQNADKTVE-----IFRLRKDIEIAKAIKRREKRLTEKGMTEED 308
           + +     S G    + Q+ D         I++L   +   + +K+  K + E  +    
Sbjct: 235 IPVIEQVESCG----FTQDPDVVYSAGGGAIYQLVS-LSTGRVLKKTAKPIEELFIIGTL 289

Query: 309 IKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKL------------------EVV 350
              N ++ Y+ F      ++     ++S +  + +  K+                  ++ 
Sbjct: 290 CILNGTKQYLVFSDQTLFLIDVESALQSESEVIEVENKIAGNHGTIADIRFVGPKRDKLA 349

Query: 351 VTTNSNTIEYYSVP------YEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLAT 404
           + TNS T+     P      +E  +     PI+    E  G    + S+D + D   +AT
Sbjct: 350 LATNSPTLRIIPTPTSSEEEFENGENKETFPIEVKMYE--GHTDLLNSLDATADGLWVAT 407

Query: 405 AS-NGELKIWNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTT 463
           AS +  + +W  + K     +E  Y  T KF+                            
Sbjct: 408 ASKDHSVILWRYHAK-----YEDFYPYT-KFV---------------------------- 433

Query: 464 IEAAHEGAIWSLDVTNDGKR-----LVTGSADKSIKFWDF-----QVKQELIAGTSDKYV 513
               H G++ ++ + N   R     ++T S D +IK W          ++LI   + +Y 
Sbjct: 434 ---GHVGSVNAVGLPNVMPRSWPEFIITASNDLTIKKWKVPKVTSDEPEDLILVKTSEYT 490

Query: 514 PQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVL 573
            +    H+       DI +I IS +D   A +  D T K++ LD  +F  +L  HK  + 
Sbjct: 491 RR---AHEK------DINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLW 541

Query: 574 SLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDG 633
            +      K++ T S DK IKIW L+     K+L  H +++    F+  +    S   DG
Sbjct: 542 DVAFCQYDKLLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADG 601

Query: 634 FVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEETDDQ 686
            V  WD    E ++ L AH + +WALAV ++GE  V+   D     W +  ++
Sbjct: 602 LVIIWDLSTGESVKTLDAHNNRIWALAVMNDGESFVTADADGFFEFWRDNSEE 654

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 83/188 (44%), Gaps = 5/188 (2%)

Query: 73  KSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGT 132
           + +   +++ +       L A    D   K+W+L       +   HK  +  + F +   
Sbjct: 491 RRAHEKDINAISISPNDSLFATASYDKTCKIWNLDDGEFQATLANHKRGLWDVAFCQYDK 550

Query: 133 QLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGLIKVWDLKT 191
            L + S D  I +W L S   +  L  H   +    + + +  LIST  DGL+ +WDL T
Sbjct: 551 LLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLST 610

Query: 192 QQCIETHIAHTGECWALGIMTD--FVVTSSADSQLKIWQMDLEGEPGSKL-IEKGAFEK- 247
            + ++T  AH    WAL +M D    VT+ AD   + W+ + E E    L  EK   E+ 
Sbjct: 611 GESVKTLDAHNNRIWALAVMNDGESFVTADADGFFEFWRDNSEEEHERNLEQEKLKIEQE 670

Query: 248 QSKQRGLS 255
           QS Q  LS
Sbjct: 671 QSLQNYLS 678

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 57/106 (53%), Gaps = 4/106 (3%)

Query: 401 LLATASNGE-LKIWNLNTKSCIRTFE--CGYALTCKFLPGGLLVVVGTREGNLQLFDLAS 457
           LLAT S  + +KIW+L + + ++T E        C F+     ++    +G + ++DL++
Sbjct: 551 LLATCSGDKTIKIWSLESYAVVKTLEGHTNAVQRCSFINKNKQLISTGADGLVIIWDLST 610

Query: 458 SVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQE 503
              + T++A H   IW+L V NDG+  VT  AD   +FW    ++E
Sbjct: 611 GESVKTLDA-HNNRIWALAVMNDGESFVTADADGFFEFWRDNSEEE 655

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 39/73 (53%), Gaps = 9/73 (12%)

Query: 78  AEVSYLQFH----SETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKF-----D 128
           A +S ++FH    SE   +A+G  +G+IK+WDLV +    +   H + +  L F     +
Sbjct: 144 ATISSVKFHGELNSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGLDFRVTDEE 203

Query: 129 KTGTQLISGSEDS 141
           K   QL+SG  D+
Sbjct: 204 KGTLQLLSGGRDN 216

 Score = 39.7 bits (91), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 46/212 (21%), Positives = 82/212 (38%), Gaps = 22/212 (10%)

Query: 453 FDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKY 512
            DL ++   T +E  + G      V+ DG+ L T   DK            +++  S + 
Sbjct: 1   MDLRTTYASTKLEPFYAGTGAIASVSEDGRLLATSVVDKI----------NIVSLDSPRR 50

Query: 513 VPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPV 572
           V     +H    E   DI ++ ++ D  +L        ++V+ L   +   S+     PV
Sbjct: 51  V-----LHSVDTEDEQDITALHLTPDGSYLCFVSQAQLLRVYSLKQERIIRSMKISS-PV 104

Query: 573 LSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN-----FF 627
             ++    + ++     D ++ +  ++ G    SL  H  +I  VKF  G  N       
Sbjct: 105 YVMNCDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKF-HGELNSEIWKLA 163

Query: 628 SASKDGFVKYWDGDKFECIQKLAAHQSEVWAL 659
           S   +G +K WD  K  C   +  H + V  L
Sbjct: 164 SGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGL 195

 Score = 38.9 bits (89), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 46/100 (46%), Gaps = 6/100 (6%)

Query: 72  LKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKF---- 127
           +K S P  V  +     + L+A G  DG + + D+ +  V  S  GH + I+ +KF    
Sbjct: 98  MKISSPVYV--MNCDQTSTLLAIGGTDGSVSVIDIENGYVTHSLKGHGATISSVKFHGEL 155

Query: 128 DKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL 167
           +    +L SG  +  I VWDLV       ++ H   + GL
Sbjct: 156 NSEIWKLASGDTNGMIKVWDLVKRNCQCTIQEHTTAVRGL 195

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 102/203 (50%), Gaps = 3/203 (1%)

Query: 484 LVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLA 543
           L++ S D ++K W  +V +     T D+ +P +     +      DI ++ IS +D   A
Sbjct: 447 LLSSSTDMTVKKW--KVPKPTQNPTEDE-IPVVKTSEYTRRAHEKDINALSISPNDSIFA 503

Query: 544 ISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDC 603
            +  D T K++ L + +   +L  HK  +  +      K+I T S DK IKIW L+  + 
Sbjct: 504 TASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKLIATCSGDKTIKIWSLENYNI 563

Query: 604 HKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD 663
             +L  H +++  + F+  +    S   DG VK WD    EC++ L AH + +WAL V+D
Sbjct: 564 KATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWALEVAD 623

Query: 664 NGERVVSVSHDHSIRIWEETDDQ 686
           +G+R V+   D   + W++  ++
Sbjct: 624 DGDRFVTADADGLFQFWKDNSEE 646

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 85/188 (45%), Gaps = 5/188 (2%)

Query: 73  KSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGT 132
           + +   +++ L       + A    D   K+WDLV+  ++ +   HK  +  + F +   
Sbjct: 483 RRAHEKDINALSISPNDSIFATASYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDK 542

Query: 133 QLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGLIKVWDLKT 191
            + + S D  I +W L +      L  H   +  + + + +  L+S   DGL+K+WD  T
Sbjct: 543 LIATCSGDKTIKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVSCGADGLVKIWDCST 602

Query: 192 QQCIETHIAHTGECWALGIM--TDFVVTSSADSQLKIWQMDLEGEPGSKLIEK--GAFEK 247
            +C+ T  AH    WAL +    D  VT+ AD   + W+ + E E    L +K     ++
Sbjct: 603 GECLRTLDAHDNRIWALEVADDGDRFVTADADGLFQFWKDNSEEEHEQDLEKKRLKVEQE 662

Query: 248 QSKQRGLS 255
           QS Q  LS
Sbjct: 663 QSLQNYLS 670

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 77/172 (44%), Gaps = 16/172 (9%)

Query: 467 AHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLEL 526
           AHE  I +L ++ +     T S DK+ K WD  V  EL+A  ++         H   L  
Sbjct: 485 AHEKDINALSISPNDSIFATASYDKTCKIWDL-VTGELVATLAN---------HKRGL-- 532

Query: 527 GDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIIT 586
                 +     DK +A    D T+K++ L++     +L GH   V  +   +  K +++
Sbjct: 533 ----WDVSFCQHDKLIATCSGDKTIKIWSLENYNIKATLEGHTNAVQRISFINKNKQLVS 588

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYW 638
             AD  +KIW    G+C ++L AH + I  ++       F +A  DG  ++W
Sbjct: 589 CGADGLVKIWDCSTGECLRTLDAHDNRIWALEVADDGDRFVTADADGLFQFW 640

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 100/234 (42%), Gaps = 24/234 (10%)

Query: 453 FDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKY 512
            D  ++   TT+   + G+  ++ +TNDG  L T   D  I     + + E         
Sbjct: 1   MDFKTTFFNTTLAPFYAGSGTAVSITNDGSLLATSVLD-VINIVQLKERHE--------- 50

Query: 513 VPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPV 572
                IVH    +   +I ++K++ D  +L     +  ++++ L S K   S+     PV
Sbjct: 51  -----IVHKINNDDEQEITALKLTPDGSYLCFVAQNQLLRIYSLASKKIVRSMKVSS-PV 104

Query: 573 LSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKF---LPGSHNFFSA 629
             +D  + + +++    D ++ I+ ++ G    S   H   I  VKF   L G+ N+  A
Sbjct: 105 YVMDCDETSTLLVIGGTDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGELDGA-NWLLA 163

Query: 630 SKD--GFVKYWDGDKFECIQKLAAHQSEVWAL--AVSDNGERVVSVSHDHSIRI 679
           S D  G VK WD  K  C+  +  H + V  L   V D+   ++S   D  I +
Sbjct: 164 SGDTNGVVKIWDLVKRRCMHTIQEHTAAVRGLDFCVKDSEMLLISGGRDEIINL 217

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 73/146 (50%), Gaps = 10/146 (6%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           E++ L+   +   +     + +++++ L SK ++ S     S + ++  D+T T L+ G 
Sbjct: 62  EITALKLTPDGSYLCFVAQNQLLRIYSLASKKIVRSMKV-SSPVYVMDCDETSTLLVIGG 120

Query: 139 EDSNIIVWDLVSEVGLYKLRSHKGTITGL----WCDSDNWLISTS-KDGLIKVWDLKTQQ 193
            D ++ ++D+ +    +  + H G I+ +      D  NWL+++   +G++K+WDL  ++
Sbjct: 121 TDGSVSIFDIENGYVTHSFKGHGGIISSVKFYGELDGANWLLASGDTNGVVKIWDLVKRR 180

Query: 194 CIETHIAHTGECWALGIMTDFVVTSS 219
           C+ T   HT     L    DF V  S
Sbjct: 181 CMHTIQEHTAAVRGL----DFCVKDS 202

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 58/107 (54%), Gaps = 6/107 (5%)

Query: 401 LLATASNGE-LKIWNLNTKSCIRTFECGYALTCK---FLPGGLLVVVGTREGNLQLFDLA 456
           L+AT S  + +KIW+L   +   T E G+    +   F+     +V    +G ++++D +
Sbjct: 543 LIATCSGDKTIKIWSLENYNIKATLE-GHTNAVQRISFINKNKQLVSCGADGLVKIWDCS 601

Query: 457 SSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQE 503
           +   L T++A H+  IW+L+V +DG R VT  AD   +FW    ++E
Sbjct: 602 TGECLRTLDA-HDNRIWALEVADDGDRFVTADADGLFQFWKDNSEEE 647

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/245 (20%), Positives = 94/245 (38%), Gaps = 64/245 (26%)

Query: 357 TIEYYSVPYEKRDPTS-PTPI-KAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWN 414
           T++ + VP   ++PT    P+ K      +    D+ ++ IS ++++ ATAS        
Sbjct: 455 TVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSISPNDSIFATAS-------- 506

Query: 415 LNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWS 474
                        Y  TCK                  ++DL +  L+ T+ A H+  +W 
Sbjct: 507 -------------YDKTCK------------------IWDLVTGELVATL-ANHKRGLWD 534

Query: 475 LDVTNDGKRLVTGSADKSIKFW---DFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDIL 531
           +      K + T S DK+IK W   ++ +K  L   T                   + + 
Sbjct: 535 VSFCQHDKLIATCSGDKTIKIWSLENYNIKATLEGHT-------------------NAVQ 575

Query: 532 SIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADK 591
            I     +K L     D  VK++   + +   +L  H   + +L+++DD    +T+ AD 
Sbjct: 576 RISFINKNKQLVSCGADGLVKIWDCSTGECLRTLDAHDNRIWALEVADDGDRFVTADADG 635

Query: 592 NIKIW 596
             + W
Sbjct: 636 LFQFW 640

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 60/140 (42%), Gaps = 25/140 (17%)

Query: 115 FNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRS----HKGTITGLWCD 170
           + GH   +  L   + G  + + S+D  +++W    ++G +K  +    H G++T +   
Sbjct: 377 YGGHVDLLNALDASEDGLWIATASKDHTVLLWRYSEQLGDFKQYAKFIGHAGSVTAVALP 436

Query: 171 S------DNWLISTSKDGLIKVWDL--KTQQCIETHI-----------AHTGECWALGIM 211
           +       N+L+S+S D  +K W +   TQ   E  I           AH  +  AL I 
Sbjct: 437 NIMDQHFPNFLLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSIS 496

Query: 212 TD--FVVTSSADSQLKIWQM 229
            +     T+S D   KIW +
Sbjct: 497 PNDSIFATASYDKTCKIWDL 516

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 6/70 (8%)

Query: 80  VSYLQFHSETG----LIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQ-- 133
           +S ++F+ E      L+A+G  +GV+K+WDLV +  + +   H + +  L F    ++  
Sbjct: 146 ISSVKFYGELDGANWLLASGDTNGVVKIWDLVKRRCMHTIQEHTAAVRGLDFCVKDSEML 205

Query: 134 LISGSEDSNI 143
           LISG  D  I
Sbjct: 206 LISGGRDEII 215

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 52/109 (47%), Gaps = 10/109 (9%)

Query: 397 DDNALLATASNGELKIWNLNTKSCIRTFECG---YALTCKFLPGGLLVVVGTREGNLQLF 453
           D + L   A N  L+I++L +K  +R+ +     Y + C       L+V+G  +G++ +F
Sbjct: 71  DGSYLCFVAQNQLLRIYSLASKKIVRSMKVSSPVYVMDCD--ETSTLLVIGGTDGSVSIF 128

Query: 454 DLASSVLLTTIEAAHEGAIWSLDVTN--DGKR--LVTGSADKSIKFWDF 498
           D+ +  +  + +  H G I S+      DG    L +G  +  +K WD 
Sbjct: 129 DIENGYVTHSFK-GHGGIISSVKFYGELDGANWLLASGDTNGVVKIWDL 176

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 64/142 (45%), Gaps = 25/142 (17%)

Query: 564 SLYGHKLPVL-SLDISDDTKVIITSSADKNIKIWGL--DFGDC--HKSLFAHQDSIMCVK 618
           ++YG  + +L +LD S+D   I T+S D  + +W      GD   +     H  S+  V 
Sbjct: 375 NMYGGHVDLLNALDASEDGLWIATASKDHTVLLWRYSEQLGDFKQYAKFIGHAGSVTAVA 434

Query: 619 FLPG---SH--NF-FSASKDGFVKYWD---------GDKFECIQ----KLAAHQSEVWAL 659
            LP     H  NF  S+S D  VK W           D+   ++       AH+ ++ AL
Sbjct: 435 -LPNIMDQHFPNFLLSSSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINAL 493

Query: 660 AVSDNGERVVSVSHDHSIRIWE 681
           ++S N     + S+D + +IW+
Sbjct: 494 SISPNDSIFATASYDKTCKIWD 515

>ZYRO0D01122g Chr4 complement(86927..88327) [1401 bp, 466 aa] {ON}
           similar to uniprot|P20053 Saccharomyces cerevisiae
           YPR178W PRP4 Splicing factor component of the U4/U6-U5
           snRNP complex
          Length = 466

 Score = 96.3 bits (238), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 78/315 (24%), Positives = 140/315 (44%), Gaps = 27/315 (8%)

Query: 376 IKAHTIELQGSRT----DVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRT---FECG 427
           +K   IEL GS+      V  + +S + +L+A AS  G+L I N  T   ++       G
Sbjct: 165 MKTKNIELMGSQVVSTRPVSQVSLSPNGSLVAAASWAGDLTILNSQTLEILQNKPQIHMG 224

Query: 428 YALTCKFLPGGLLVVVGTREGNLQLFDLASSVL--LTTIEAAHEGAIWSLDVTNDGKRLV 485
                 + P G L+  G  EG+++LF   S+ L  + T+   HE  +        G+ + 
Sbjct: 225 KIGGIHWSPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNG-HENRVTDSKFHPSGRFIA 283

Query: 486 TGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAIS 545
           + S D + + WD + ++EL+          +   H      G ++ S+    D   +   
Sbjct: 284 SASFDMTWRLWDVETQEELL----------LQEGH------GKELYSLGFQCDGSLVCSG 327

Query: 546 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHK 605
            +D    V+ + S K  +SL GH  P+ SLD S +   + T S D  I+IW L   + ++
Sbjct: 328 GIDCKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQ 387

Query: 606 SLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNG 665
           ++ AH+  +  V F    +   S+  D  +  +    +  +  L  H  ++  + +S+N 
Sbjct: 388 TILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVDISENA 447

Query: 666 ERVVSVSHDHSIRIW 680
             VVS   D S+++W
Sbjct: 448 SSVVSCGWDRSVKLW 462

 Score = 60.8 bits (146), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 57/119 (47%), Gaps = 1/119 (0%)

Query: 84  QFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNI 143
           +FH     IA+   D   +LWD+ ++  LL   GH   +  L F   G+ + SG  D   
Sbjct: 274 KFHPSGRFIASASFDMTWRLWDVETQEELLLQEGHGKELYSLGFQCDGSLVCSGGIDCKG 333

Query: 144 IVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGLIKVWDLKTQQCIETHIAH 201
           +VWD+ S      L  H   I  L W  +   + + S DG I++WDL+  +  +T +AH
Sbjct: 334 LVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAH 392

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 87/198 (43%), Gaps = 17/198 (8%)

Query: 37  GKVITGALENIS--VWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           G+ I  A  +++  +WD++T E E +L +G              E+  L F  +  L+ +
Sbjct: 279 GRFIASASFDMTWRLWDVETQE-ELLLQEG-----------HGKELYSLGFQCDGSLVCS 326

Query: 95  GYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGL 154
           G  D    +WD+ S    +S +GH   I  L +   G Q+ +GS D  I +WDL      
Sbjct: 327 GGIDCKGLVWDIRSGKRAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEY 386

Query: 155 YKLRSHKGTITGLWCDSD-NWLISTSKDGLIKVWDLKTQQCIETHIAHTGE--CWALGIM 211
             + +HK  +T +  + + N L+S+  D  I ++       + T   H  +  C  +   
Sbjct: 387 QTILAHKSIVTKVAFEKNGNCLVSSGYDKSINLYGAYNWAQLTTLQGHMDKILCVDISEN 446

Query: 212 TDFVVTSSADSQLKIWQM 229
              VV+   D  +K+W M
Sbjct: 447 ASSVVSCGWDRSVKLWTM 464

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 80/172 (46%), Gaps = 11/172 (6%)

Query: 87  SETG-LIAAGYADGVIKLWDLVSKTV--LLSFNGHKSRITMLKFDKTGTQLISGSEDSNI 143
           S TG LI AG  +G +KL+   S T+  + + NGH++R+T  KF  +G  + S S D   
Sbjct: 232 SPTGDLITAGGEEGSVKLFGYKSNTLEEMATLNGHENRVTDSKFHPSGRFIASASFDMTW 291

Query: 144 IVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK-DGLIKVWDLKTQQCIETHIAHT 202
            +WD+ ++  L     H   +  L    D  L+ +   D    VWD+++ +   +   HT
Sbjct: 292 RLWDVETQEELLLQEGHGKELYSLGFQCDGSLVCSGGIDCKGLVWDIRSGKRAMSLSGHT 351

Query: 203 GECWALGIMTDF--VVTSSADSQLKIWQMDLEGE-----PGSKLIEKGAFEK 247
              ++L    +   V T S D  ++IW +    E         ++ K AFEK
Sbjct: 352 KPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAHKSIVTKVAFEK 403

 Score = 40.4 bits (93), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 58/124 (46%), Gaps = 4/124 (3%)

Query: 379 HTIELQGSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYALTCK--FL 435
             + L G    + S+D S +   +AT S +G ++IW+L      +T     ++  K  F 
Sbjct: 343 RAMSLSGHTKPIYSLDWSPNGYQVATGSGDGTIRIWDLRKPEEYQTILAHKSIVTKVAFE 402

Query: 436 PGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKF 495
             G  +V    + ++ L+   +   LTT++  H   I  +D++ +   +V+   D+S+K 
Sbjct: 403 KNGNCLVSSGYDKSINLYGAYNWAQLTTLQG-HMDKILCVDISENASSVVSCGWDRSVKL 461

Query: 496 WDFQ 499
           W  Q
Sbjct: 462 WTMQ 465

 Score = 36.6 bits (83), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 47/246 (19%), Positives = 87/246 (35%), Gaps = 56/246 (22%)

Query: 436 PGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKF 495
           P G LV   +  G+L + +  +  +L      H G I  +  +  G  +  G  + S+K 
Sbjct: 190 PNGSLVAAASWAGDLTILNSQTLEILQNKPQIHMGKIGGIHWSPTGDLITAGGEEGSVKL 249

Query: 496 WDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFF 555
           + ++        T + +    N V DS           K     +F+A +  D T +++ 
Sbjct: 250 FGYKSNTLEEMATLNGH---ENRVTDS-----------KFHPSGRFIASASFDMTWRLWD 295

Query: 556 LDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 615
           +++ +  L   GH   + SL    D  ++ +   D    +W +  G    SL        
Sbjct: 296 VETQEELLLQEGHGKELYSLGFQCDGSLVCSGGIDCKGLVWDIRSGKRAMSL-------- 347

Query: 616 CVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDH 675
                                             + H   +++L  S NG +V + S D 
Sbjct: 348 ----------------------------------SGHTKPIYSLDWSPNGYQVATGSGDG 373

Query: 676 SIRIWE 681
           +IRIW+
Sbjct: 374 TIRIWD 379

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 97.1 bits (240), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 129/279 (46%), Gaps = 43/279 (15%)

Query: 428 YALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTG 487
           Y  +  F P G  +  G  +  ++++DL+S  +L T++  HE  I+SLD    G +LV+G
Sbjct: 371 YIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQG-HEQDIYSLDYFPAGDKLVSG 429

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS-GDDKFLAISL 546
           S D++++ WD +  Q  +                 TL + D + ++ +S GD K++A   
Sbjct: 430 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 472

Query: 547 LDNTVKVFFLDSMKFFLS---------LYGHKLPVLSLDISDDTKVIITSSADKNIKIWG 597
           LD TV+V+  DS   FL            GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 473 LDRTVRVW--DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWD 530

Query: 598 L-------DFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLA 650
           L           C  +   H+D ++ V          S SKD  V +WD      +  L 
Sbjct: 531 LRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQ 590

Query: 651 AHQSEVWALAVSDN---GERV---VSVSHDHSIRIWEET 683
            H++ V ++AV +    G  +    + S D   RIW+ T
Sbjct: 591 GHRNSVISVAVVNGFPLGPDIGVFATGSGDCKARIWKYT 629

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 114/242 (47%), Gaps = 31/242 (12%)

Query: 468 HEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMN------IVHD 521
           H   +  +  +NDG+ L TG  +K+ + +      EL+A  SD  V  +N      +  +
Sbjct: 292 HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTG-ELVARLSDDSVSGINNESSSVVAGN 349

Query: 522 STLELGDD--------------ILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYG 567
              E GD+              I S+  S D K+LA    D  ++++ L S K  ++L G
Sbjct: 350 GATEKGDESSATIQPGSSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQG 409

Query: 568 HKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFF 627
           H+  + SLD       +++ S D+ ++IW L  G C  +L + +D +  V   PG   + 
Sbjct: 410 HEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYI 468

Query: 628 SA-SKDGFVKYWDGDKFECIQKL-------AAHQSEVWALAVSDNGERVVSVSHDHSIRI 679
           +A S D  V+ WD +    +++L         H+  V+++  + +G  VVS S D S+++
Sbjct: 469 AAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKL 528

Query: 680 WE 681
           W+
Sbjct: 529 WD 530

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/164 (29%), Positives = 76/164 (46%), Gaps = 12/164 (7%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   +A G  D +I++WDL SK +L++  GH+  I  L +   G +L+SGS D  + 
Sbjct: 377 FSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVR 436

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIET------ 197
           +WDL +      L    G  T      D  ++ + S D  ++VWD +T   +E       
Sbjct: 437 IWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFLVERLDSENE 496

Query: 198 -HIAHTGECWALGIMTD--FVVTSSADSQLKIWQMDLEGEPGSK 238
               H    +++    D   VV+ S D  +K+W  DL G  G K
Sbjct: 497 LSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLW--DLRGLNGQK 538

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 61/253 (24%), Positives = 124/253 (49%), Gaps = 28/253 (11%)

Query: 385 GSRTD--VRSIDISDDNALLATASNGEL-KIWNLNTKSCIRTFECG----YALTCKFLPG 437
           GS +D  +RS+  S D   LAT +  +L +IW+L++K  + T +      Y+L   + P 
Sbjct: 365 GSSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIYSL--DYFPA 422

Query: 438 GLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVT-NDGKRLVTGSADKSIKFW 496
           G  +V G+ +  ++++DL +     T+    E  + ++ V+  DGK +  GS D++++ W
Sbjct: 423 GDKLVSGSGDRTVRIWDLRTGQCSLTLSI--EDGVTTVAVSPGDGKYIAAGSLDRTVRVW 480

Query: 497 DFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFL 556
           D +         +   V +++  ++ +    D + S+  + D + +    LD +VK++ L
Sbjct: 481 DSE---------TGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKLWDL 531

Query: 557 DSMK-------FFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFA 609
             +          ++  GHK  VLS+  + D + I++ S D+ +  W    G+    L  
Sbjct: 532 RGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQG 591

Query: 610 HQDSIMCVKFLPG 622
           H++S++ V  + G
Sbjct: 592 HRNSVISVAVVNG 604

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 106/233 (45%), Gaps = 28/233 (12%)

Query: 381 IELQGSRTDVRSID-ISDDNALLATASNGELKIWNLNTKSCIRTFECGYALTCKFL-PG- 437
           + LQG   D+ S+D     + L++ + +  ++IW+L T  C  T      +T   + PG 
Sbjct: 405 MTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGD 464

Query: 438 GLLVVVGTREGNLQLFDLASSVLLTTIEA------AHEGAIWSLDVTNDGKRLVTGSADK 491
           G  +  G+ +  ++++D  +  L+  +++       H+ +++S+  T DG+ +V+GS D+
Sbjct: 465 GKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDR 524

Query: 492 SIKFWDFQV--KQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDN 549
           S+K WD +    Q+  A     Y    + V           LS+  + DD+++     D 
Sbjct: 525 SVKLWDLRGLNGQKSHATCEVTYTGHKDFV-----------LSVATTQDDEYILSGSKDR 573

Query: 550 TVKVFFLDSMKFFLSLYGHKLPVLSLDI------SDDTKVIITSSADKNIKIW 596
            V  +   S    L L GH+  V+S+ +        D  V  T S D   +IW
Sbjct: 574 GVLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDIGVFATGSGDCKARIW 626

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 97/222 (43%), Gaps = 50/222 (22%)

Query: 38  KVITGALEN-ISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDL+T +    LS  DG+   +V      P +  Y         IAA
Sbjct: 425 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKY---------IAA 470

Query: 95  GYADGVIKLWDLVSKTVLL-----SFN----GHKSRITMLKFDKTGTQLISGSEDSNIIV 145
           G  D  +++WD  S+T  L     S N    GHK  +  + F + G  ++SGS D ++ +
Sbjct: 471 GSLDRTVRVWD--SETGFLVERLDSENELSTGHKDSVYSVVFTRDGRSVVSGSLDRSVKL 528

Query: 146 WDLVSEVGLYKLRSHKG---TITG--------LWCDSDNWLISTSKDGLIKVWDLKTQQC 194
           WDL    GL   +SH     T TG             D +++S SKD  +  WD  +   
Sbjct: 529 WDL---RGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNP 585

Query: 195 IETHIAHTGECWALGIMTDFVV--------TSSADSQLKIWQ 228
           +     H     ++ ++  F +        T S D + +IW+
Sbjct: 586 LLMLQGHRNSVISVAVVNGFPLGPDIGVFATGSGDCKARIWK 627

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 96.3 bits (238), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 94/370 (25%), Positives = 157/370 (42%), Gaps = 72/370 (19%)

Query: 359 EYYSVPYEKRDPTSPTPI--KAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLN 416
           E Y V Y   +PT P  I  + H   L  S   V  +  S++   LAT  N   KI+ + 
Sbjct: 293 EDYYVLY---NPTQPKDIDIELHRTLLHDSV--VCCVKFSNNGEYLATGCNKTTKIFEVA 347

Query: 417 TKSCIRTF----ECG------------YALTCKFLPGGLLVVVGTREGNLQLFDLASSVL 460
           T + +       + G            Y  +  F P G  +  G  +  ++++D+A   +
Sbjct: 348 TGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPDGKFLATGAEDKLIRIWDIAQRKI 407

Query: 461 LTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVH 520
           +  +   HE  I+SLD    G +LV+GS D++I+ WD    Q  +               
Sbjct: 408 VMVLRG-HEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSL--------------- 451

Query: 521 DSTLELGDDILSIKIS-GDDKFLAISLLDNTVKVFFLDSMKFFL---------SLYGHKL 570
             TL + D + ++ +S G+  ++A   LD TV+V+  DS   FL         +  GHK 
Sbjct: 452 --TLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVW--DSNSGFLVERLDSEGETGVGHKD 507

Query: 571 PVLSLDISDDTKVIITSSADKNIKIWGLDF-------------GDCHKSLFAHQDSIMCV 617
            V S+  + D K I++ S D+++K+W L               G+C  +   H+D ++ V
Sbjct: 508 SVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPKTEGNCEMTYIGHKDFVLSV 567

Query: 618 KFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD------NGERVVSV 671
                     S SKD  V +WD      +  L  H++ V ++AV++      N     + 
Sbjct: 568 TTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQGHRNSVISVAVANGKPLGANYNVFATG 627

Query: 672 SHDHSIRIWE 681
           S D   +IW+
Sbjct: 628 SGDCKAKIWK 637

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 95/201 (47%), Gaps = 12/201 (5%)

Query: 41  TGALENISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAE--VSYLQFHSETGLIAAGYAD 98
           TG  +   ++++ T  L   L D    G+ D  S+  A+  +  + F  +   +A G  D
Sbjct: 335 TGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSASSADLYIRSVCFSPDGKFLATGAED 394

Query: 99  GVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLR 158
            +I++WD+  + +++   GH+  I  L + ++G +L+SGS D  I +WDL +      L 
Sbjct: 395 KLIRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNKLVSGSGDRTIRIWDLHTGQCSLTLS 454

Query: 159 SHKG-TITGLWCDSDNWLISTSKDGLIKVWDLKTQQCI-------ETHIAHTGECWALGI 210
              G T   +   + N++ + S D  ++VWD  +   +       ET + H    +++  
Sbjct: 455 IEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNSGFLVERLDSEGETGVGHKDSVYSVVF 514

Query: 211 MTDF--VVTSSADSQLKIWQM 229
             D   +V+ S D  +K+W +
Sbjct: 515 TRDGKNIVSGSLDRSVKLWNL 535

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 83/212 (39%), Gaps = 58/212 (27%)

Query: 38  KVITGALEN-ISVWDLKTSELEYVLS--DGL-----PPGSVDLKSSKPAE---------- 79
           K+++G+ +  I +WDL T +    LS  DG+      PG+ +  ++   +          
Sbjct: 429 KLVSGSGDRTIRIWDLHTGQCSLTLSIEDGVTTVAVSPGNGNYVAAGSLDRTVRVWDSNS 488

Query: 80  ---VSYLQFHSETGL-----------------IAAGYADGVIKLWDL------------- 106
              V  L    ETG+                 I +G  D  +KLW+L             
Sbjct: 489 GFLVERLDSEGETGVGHKDSVYSVVFTRDGKNIVSGSLDRSVKLWNLRNINGASTSPQPK 548

Query: 107 VSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITG 166
                 +++ GHK  +  +   +    ++SGS+D  +I WD VS V L  L+ H+ ++  
Sbjct: 549 TEGNCEMTYIGHKDFVLSVTTTENDQYILSGSKDRGVIFWDKVSGVPLLMLQGHRNSVIS 608

Query: 167 LWCDSD-------NWLISTSKDGLIKVWDLKT 191
           +   +        N   + S D   K+W  +T
Sbjct: 609 VAVANGKPLGANYNVFATGSGDCKAKIWKFQT 640

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 136/299 (45%), Gaps = 52/299 (17%)

Query: 412 IWNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGA 471
           + NLNT S   +    Y  +  F P G  +  G  +  ++++D+ +  ++  ++  HE  
Sbjct: 431 VENLNTSSSPSSDL--YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQG-HEQD 487

Query: 472 IWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDIL 531
           I+SLD    G +LV+GS D++++ WD +  Q  +                 TL + D + 
Sbjct: 488 IYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEDGVT 530

Query: 532 SIKIS-GDDKFLAISLLDNTVKVFFLDSMKFFL---------SLYGHKLPVLSLDISDDT 581
           ++ +S GD K++A   LD  V+V+  DS   FL         S  GHK  V S+  + D 
Sbjct: 531 TVAVSPGDGKYIAAGSLDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDG 588

Query: 582 KVIITSSADKNIKIWGL------------DFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA 629
           + +++ S D+++K+W L            + G C  +   H+D ++ V          S 
Sbjct: 589 QSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSG 648

Query: 630 SKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERV-------VSVSHDHSIRIWE 681
           SKD  V +WD      +  L  H++ V ++AV+ NG  +        + S D   RIW+
Sbjct: 649 SKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVA-NGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 80/169 (47%), Gaps = 13/169 (7%)

Query: 74  SSKPAEVSYLQ---FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKT 130
           SS P+   Y++   F  +   +A G  D +I++WD+ ++ +++   GH+  I  L +  +
Sbjct: 437 SSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPS 496

Query: 131 GTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDL 189
           G +L+SGS D  + +WDL +      L    G  T      D  ++ + S D  ++VWD 
Sbjct: 497 GDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDS 556

Query: 190 KTQQCI-------ETHIAHTGECWALGIMTD--FVVTSSADSQLKIWQM 229
           +T   +       E+   H    +++    D   VV+ S D  +K+W +
Sbjct: 557 ETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNL 605

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 94/228 (41%), Gaps = 57/228 (25%)

Query: 38  KVITGALEN-ISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDL+T +    LS  DG+   +V      P +  Y         IAA
Sbjct: 499 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKY---------IAA 544

Query: 95  GYADGVIKLWDLVSKTVLL---------SFNGHKSRITMLKFDKTGTQLISGSEDSNIIV 145
           G  D  +++WD  S+T  L         S  GHK  +  + F + G  ++SGS D ++ +
Sbjct: 545 GSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKL 602

Query: 146 WDLVSEVGLYKLRSHKGTITGLWCD-----------------SDNWLISTSKDGLIKVWD 188
           W+L +       +S   T     C+                 +D +++S SKD  +  WD
Sbjct: 603 WNLQNANN----KSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 658

Query: 189 LKTQQCIETHIAHTGECWA--------LGIMTDFVVTSSADSQLKIWQ 228
            K+   +     H     +        LG   +   T S D + +IW+
Sbjct: 659 KKSGNPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 136/299 (45%), Gaps = 52/299 (17%)

Query: 412 IWNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGA 471
           + NLNT S   +    Y  +  F P G  +  G  +  ++++D+ +  ++  ++  HE  
Sbjct: 431 VENLNTSSSPSSDL--YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQG-HEQD 487

Query: 472 IWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDIL 531
           I+SLD    G +LV+GS D++++ WD +  Q  +                 TL + D + 
Sbjct: 488 IYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEDGVT 530

Query: 532 SIKIS-GDDKFLAISLLDNTVKVFFLDSMKFFL---------SLYGHKLPVLSLDISDDT 581
           ++ +S GD K++A   LD  V+V+  DS   FL         S  GHK  V S+  + D 
Sbjct: 531 TVAVSPGDGKYIAAGSLDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDG 588

Query: 582 KVIITSSADKNIKIWGL------------DFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA 629
           + +++ S D+++K+W L            + G C  +   H+D ++ V          S 
Sbjct: 589 QSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSG 648

Query: 630 SKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERV-------VSVSHDHSIRIWE 681
           SKD  V +WD      +  L  H++ V ++AV+ NG  +        + S D   RIW+
Sbjct: 649 SKDRGVLFWDKTSGNPLLMLQGHRNSVISVAVA-NGSPLGPEYNVFATGSGDCKARIWK 706

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 86/187 (45%), Gaps = 14/187 (7%)

Query: 74  SSKPAEVSYLQ---FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKT 130
           SS P+   Y++   F  +   +A G  D +I++WD+ ++ +++   GH+  I  L +  +
Sbjct: 437 SSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPS 496

Query: 131 GTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDL 189
           G +L+SGS D  + +WDL +      L    G  T      D  ++ + S D  ++VWD 
Sbjct: 497 GDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDS 556

Query: 190 KTQQCI-------ETHIAHTGECWALGIMTD--FVVTSSADSQLKIWQM-DLEGEPGSKL 239
           +T   +       E+   H    +++    D   VV+ S D  +K+W + +   +  SK 
Sbjct: 557 ETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKT 616

Query: 240 IEKGAFE 246
              G  E
Sbjct: 617 PNSGTCE 623

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 53/224 (23%), Positives = 94/224 (41%), Gaps = 49/224 (21%)

Query: 38  KVITGALE-NISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDL+T +    LS  DG+   +V      P +  Y         IAA
Sbjct: 499 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKY---------IAA 544

Query: 95  GYADGVIKLWDLVSKTVLL---------SFNGHKSRITMLKFDKTGTQLISGSEDSNIIV 145
           G  D  +++WD  S+T  L         S  GHK  +  + F + G  ++SGS D ++ +
Sbjct: 545 GSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGQSVVSGSLDRSVKL 602

Query: 146 WDL----------VSEVGLYKLR--SHKGTITGLW-CDSDNWLISTSKDGLIKVWDLKTQ 192
           W+L              G  ++    HK  +  +    +D +++S SKD  +  WD  + 
Sbjct: 603 WNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKTSG 662

Query: 193 QCIETHIAHTGECWA--------LGIMTDFVVTSSADSQLKIWQ 228
             +     H     +        LG   +   T S D + +IW+
Sbjct: 663 NPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 706

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 128/279 (45%), Gaps = 43/279 (15%)

Query: 428 YALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTG 487
           Y  +  F P G  +  G  +  ++++DL +  +L T++  HE  I+SLD    G +LV+G
Sbjct: 354 YIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQG-HEQDIYSLDYFPAGDKLVSG 412

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS-GDDKFLAISL 546
           S D++++ WD +  Q  +                 TL + D + ++ +S GD K++A   
Sbjct: 413 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 455

Query: 547 LDNTVKVFFLDSMKFFLS---------LYGHKLPVLSLDISDDTKVIITSSADKNIKIWG 597
           LD TV+V+  DS   FL            GHK  V S+  + D + +I+ S D+++K+W 
Sbjct: 456 LDRTVRVW--DSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWD 513

Query: 598 L-------DFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLA 650
           L           C  +   H+D ++ V          S SKD  V +WD      +  L 
Sbjct: 514 LRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQ 573

Query: 651 AHQSEVWALAVSDN---GERV---VSVSHDHSIRIWEET 683
            H++ V ++AV +    G  V    + S D   RIW+ T
Sbjct: 574 GHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIWKYT 612

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 115/242 (47%), Gaps = 31/242 (12%)

Query: 468 HEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMN------IVHD 521
           H   +  +  +NDG+ L TG  +K+ + +      EL+A  SD  V  +N        ++
Sbjct: 275 HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTG-ELLARLSDDSVAGVNNEASTGPANN 332

Query: 522 STLELGDD--------------ILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYG 567
            T + G +              I S+  S D K+LA    D  ++++ L + K  ++L G
Sbjct: 333 GTADNGGENSATIQPASSSDLYIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQG 392

Query: 568 HKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFF 627
           H+  + SLD       +++ S D+ ++IW L  G C  +L + +D +  V   PG   + 
Sbjct: 393 HEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYI 451

Query: 628 SA-SKDGFVKYWDGDKFECIQKL-------AAHQSEVWALAVSDNGERVVSVSHDHSIRI 679
           +A S D  V+ WD +    +++L         H+  V+++  + +G+ V+S S D S+++
Sbjct: 452 AAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKL 511

Query: 680 WE 681
           W+
Sbjct: 512 WD 513

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/233 (25%), Positives = 97/233 (41%), Gaps = 35/233 (15%)

Query: 39  VITGALENISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAE------------------- 79
           + TG  +   V+ + T EL   LSD    G  +  S+ PA                    
Sbjct: 291 LATGCNKTTQVYKVSTGELLARLSDDSVAGVNNEASTGPANNGTADNGGENSATIQPASS 350

Query: 80  ----VSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLI 135
               +  + F  +   +A G  D +I++WDL +K +L++  GH+  I  L +   G +L+
Sbjct: 351 SDLYIRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSLDYFPAGDKLV 410

Query: 136 SGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQC 194
           SGS D  + +WDL +      L    G  T      D  ++ + S D  ++VWD +T   
Sbjct: 411 SGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSETGFL 470

Query: 195 IET-------HIAHTGECWALGIMTD--FVVTSSADSQLKIWQMDLEGEPGSK 238
           +E           H    +++    D   V++ S D  +K+W  DL G  G K
Sbjct: 471 VERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLW--DLRGLNGQK 521

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/268 (23%), Positives = 125/268 (46%), Gaps = 32/268 (11%)

Query: 390 VRSIDISDDNALLATASNGEL-KIWNLNTKSCIRTFECG----YALTCKFLPGGLLVVVG 444
           +RS+  S D   LAT +  +L +IW+L TK  + T +      Y+L   + P G  +V G
Sbjct: 355 IRSVCFSPDGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIYSL--DYFPAGDKLVSG 412

Query: 445 TREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVT-NDGKRLVTGSADKSIKFWDFQVKQE 503
           + +  ++++DL +     T+    E  + ++ V+  DGK +  GS D++++ WD +    
Sbjct: 413 SGDRTVRIWDLRTGQCSLTLSI--EDGVTTVAVSPGDGKYIAAGSLDRTVRVWDSE---- 466

Query: 504 LIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMK--- 560
                +   V +++  ++ +    D + S+  + D + +    LD +VK++ L  +    
Sbjct: 467 -----TGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDRSVKLWDLRGLNGQK 521

Query: 561 ----FFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMC 616
                 ++  GHK  VLS+  + D + I++ S D+ +  W    G+    L  H++S++ 
Sbjct: 522 SHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFWDTASGNPLLMLQGHRNSVIS 581

Query: 617 VKFL------PGSHNFFSASKDGFVKYW 638
           V  +      P    F + S D   + W
Sbjct: 582 VAVVNGFPLGPDVGVFATGSGDCKARIW 609

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 56/233 (24%), Positives = 106/233 (45%), Gaps = 28/233 (12%)

Query: 381 IELQGSRTDVRSID-ISDDNALLATASNGELKIWNLNTKSCIRTFECGYALTCKFL-PG- 437
           + LQG   D+ S+D     + L++ + +  ++IW+L T  C  T      +T   + PG 
Sbjct: 388 MTLQGHEQDIYSLDYFPAGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGD 447

Query: 438 GLLVVVGTREGNLQLFDLASSVLLTTIEA------AHEGAIWSLDVTNDGKRLVTGSADK 491
           G  +  G+ +  ++++D  +  L+  +++       H+ +++S+  T DG+ +++GS D+
Sbjct: 448 GKYIAAGSLDRTVRVWDSETGFLVERLDSENELSTGHKDSVYSVVFTRDGQGVISGSLDR 507

Query: 492 SIKFWDFQV--KQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDN 549
           S+K WD +    Q+  A     Y    + V           LS+  + DD+++     D 
Sbjct: 508 SVKLWDLRGLNGQKSHATCEVTYTGHKDFV-----------LSVATTQDDEYILSGSKDR 556

Query: 550 TVKVFFLDSMKFFLSLYGHKLPVLSLDI------SDDTKVIITSSADKNIKIW 596
            V  +   S    L L GH+  V+S+ +        D  V  T S D   +IW
Sbjct: 557 GVLFWDTASGNPLLMLQGHRNSVISVAVVNGFPLGPDVGVFATGSGDCKARIW 609

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 64/138 (46%), Gaps = 16/138 (11%)

Query: 37  GKVIT-GALE-NISVWDLKTSEL-EYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIA 93
           GK I  G+L+  + VWD +T  L E + S+       +L +     V  + F  +   + 
Sbjct: 448 GKYIAAGSLDRTVRVWDSETGFLVERLDSEN------ELSTGHKDSVYSVVFTRDGQGVI 501

Query: 94  AGYADGVIKLWDLVS-------KTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVW 146
           +G  D  +KLWDL          T  +++ GHK  +  +   +    ++SGS+D  ++ W
Sbjct: 502 SGSLDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVATTQDDEYILSGSKDRGVLFW 561

Query: 147 DLVSEVGLYKLRSHKGTI 164
           D  S   L  L+ H+ ++
Sbjct: 562 DTASGNPLLMLQGHRNSV 579

>KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON}
           uniprot|P56094 Kluyveromyces lactis KLLA0F10263g TUP1
           Transcriptional repressor TUP1
          Length = 682

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 128/276 (46%), Gaps = 41/276 (14%)

Query: 428 YALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTG 487
           Y  +  F P G  +  G  +  ++++DL +  ++ T++  HE  I+SLD    G +LV+G
Sbjct: 408 YIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKG-HEQDIYSLDYFPSGNKLVSG 466

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS-GDDKFLAISL 546
           S D++++ WD      L  GT              TL + D + ++ +S G+ KF+A   
Sbjct: 467 SGDRTVRIWD------LTTGTCSL-----------TLSIEDGVTTVAVSPGEGKFIAAGS 509

Query: 547 LDNTVKVFFLDSMKFFLSL-------YGHKLPVLSLDISDDTKVIITSSADKNIKIWGLD 599
           LD TV+V+  D+      L        GH+  V S+  + D K +++ S D+++K+W L+
Sbjct: 510 LDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLN 569

Query: 600 -------FGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAH 652
                    +C  +   H+D ++ V          S SKD  V +WD      +  L  H
Sbjct: 570 GLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPLLMLQGH 629

Query: 653 QSEVWALAVSDNGERV-------VSVSHDHSIRIWE 681
           ++ V ++ V+ NG  +        + S D   RIW+
Sbjct: 630 RNSVISVTVA-NGHPLGPEYGVFATGSGDCKARIWK 664

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 76/164 (46%), Gaps = 12/164 (7%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   +A G  D +I++WDL +K ++++  GH+  I  L +  +G +L+SGS D  + 
Sbjct: 414 FSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSGDRTVR 473

Query: 145 VWDLVSEVGLYKLRSHKG-TITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIET------ 197
           +WDL +      L    G T   +      ++ + S D  ++VWD  T   +E       
Sbjct: 474 IWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENE 533

Query: 198 -HIAHTGECWALGIMTD--FVVTSSADSQLKIWQMDLEGEPGSK 238
               H    +++    D   VV+ S D  +K+W  +L G  G K
Sbjct: 534 LGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLW--NLNGLSGQK 575

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 55/113 (48%), Gaps = 2/113 (1%)

Query: 570 LPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA 629
           L + S+  S D K + T + DK I+IW L+      +L  H+  I  + + P  +   S 
Sbjct: 407 LYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSG 466

Query: 630 SKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDN-GERVVSVSHDHSIRIWE 681
           S D  V+ WD     C   L+  +  V  +AVS   G+ + + S D ++R+W+
Sbjct: 467 SGDRTVRIWDLTTGTCSLTLSI-EDGVTTVAVSPGEGKFIAAGSLDRTVRVWD 518

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 94/222 (42%), Gaps = 50/222 (22%)

Query: 38  KVITGALEN-ISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDL T      LS  DG+   +V      P E  +         IAA
Sbjct: 462 KLVSGSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAV-----SPGEGKF---------IAA 507

Query: 95  GYADGVIKLWD-----LVSKTVLLSFN----GHKSRITMLKFDKTGTQLISGSEDSNIIV 145
           G  D  +++WD     LV +  L S N    GH+  +  + F + G  ++SGS D ++ +
Sbjct: 508 GSLDRTVRVWDSDTGFLVER--LDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKL 565

Query: 146 WDLVSEVGLYKLRSH---KGTITG--------LWCDSDNWLISTSKDGLIKVWDLKTQQC 194
           W+L    GL   +SH   + T TG            +D +++S SKD  +  WD K+   
Sbjct: 566 WNLN---GLSGQKSHAECEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNP 622

Query: 195 IETHIAH--------TGECWALGIMTDFVVTSSADSQLKIWQ 228
           +     H              LG       T S D + +IW+
Sbjct: 623 LLMLQGHRNSVISVTVANGHPLGPEYGVFATGSGDCKARIWK 664

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 38/70 (54%)

Query: 614 IMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSH 673
           I  V F P      + ++D  ++ WD +  + +  L  H+ ++++L    +G ++VS S 
Sbjct: 409 IRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNKLVSGSG 468

Query: 674 DHSIRIWEET 683
           D ++RIW+ T
Sbjct: 469 DRTVRIWDLT 478

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 43/210 (20%), Positives = 86/210 (40%), Gaps = 31/210 (14%)

Query: 37  GKVITGALEN--ISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           GK +    E+  I +WDL+T ++   L                 ++  L +      + +
Sbjct: 418 GKFLATGAEDKLIRIWDLETKKIVMTLK------------GHEQDIYSLDYFPSGNKLVS 465

Query: 95  GYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGL 154
           G  D  +++WDL + T  L+ +      T+      G  + +GS D  + VWD  +   +
Sbjct: 466 GSGDRTVRIWDLTTGTCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLV 525

Query: 155 YKLRSHKGTITG--------LWCDSDNWLISTSKDGLIKVWDLKTQQCIETH----IAHT 202
            +L S     TG        ++      ++S S D  +K+W+L      ++H    + +T
Sbjct: 526 ERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLWNLNGLSGQKSHAECEVTYT 585

Query: 203 GEC-WALGIMT----DFVVTSSADSQLKIW 227
           G   + L + T    +++++ S D  +  W
Sbjct: 586 GHKDFVLSVATTQNDEYILSGSKDRGVLFW 615

>TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {ON}
           Anc_6.363 YCR084C
          Length = 699

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 129/282 (45%), Gaps = 49/282 (17%)

Query: 428 YALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTG 487
           Y  +  F P G  +  G  +  ++++D+A   ++  ++  HE  I+SLD    G++LV+G
Sbjct: 429 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQG-HEQDIYSLDYFPSGEKLVSG 487

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDD-KFLAISL 546
           S D++++ WD +  Q  +                 TL + D + ++ +S +D K++A   
Sbjct: 488 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPEDGKYIAAGS 530

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSLDISDDTKVIITSSADKNIKIWG 597
           LD  V+V+  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 531 LDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWN 588

Query: 598 LD-----------FGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECI 646
           L+            G C  +   H+D ++ V    G     S SKD  V +WD      +
Sbjct: 589 LNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLFWDTKSGNPL 648

Query: 647 QKLAAHQSEVWALAVSDNGERV-------VSVSHDHSIRIWE 681
             L  H++ V ++AV+ NG  +        + S D   RIW+
Sbjct: 649 LMLQGHRNSVISVAVA-NGHPLGTEYGVFATGSGDCKARIWK 689

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 109/244 (44%), Gaps = 30/244 (12%)

Query: 468 HEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSD----KYVPQMNIVHDST 523
           H   +  +  +NDGK L TG  +K+ + ++     ELIA  SD       P  N      
Sbjct: 351 HTSVVCCVRFSNDGKFLATG-CNKTTQVYNV-ASGELIARLSDDSASHITPGQNSKDSEG 408

Query: 524 LELGDD---------------ILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGH 568
            E  +D               I S+  S D KFLA    D  ++++ +   K  + L GH
Sbjct: 409 GEENNDTTTYSTSATTSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGH 468

Query: 569 KLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFS 628
           +  + SLD     + +++ S D+ ++IW L  G C  +L + +D +  V   P    + +
Sbjct: 469 EQDIYSLDYFPSGEKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPEDGKYIA 527

Query: 629 A-SKDGFVKYWDGDKFECIQKL-------AAHQSEVWALAVSDNGERVVSVSHDHSIRIW 680
           A S D  V+ WD +    +++L         H+  V+++  + +G  VVS S D S+++W
Sbjct: 528 AGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLW 587

Query: 681 EETD 684
              D
Sbjct: 588 NLND 591

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 72/156 (46%), Gaps = 10/156 (6%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   +A G  D +I++WD+  K +++   GH+  I  L +  +G +L+SGS D  + 
Sbjct: 435 FSPDGKFLATGAEDRLIRIWDIAQKKIIMVLQGHEQDIYSLDYFPSGEKLVSGSGDRTVR 494

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIET------ 197
           +WDL +      L    G  T      D  ++ + S D  ++VWD +T   +E       
Sbjct: 495 IWDLRTGQCSLTLSIEDGVTTVAVSPEDGKYIAAGSLDRAVRVWDSETGFLVERLDSENE 554

Query: 198 -HIAHTGECWALGIMTDF--VVTSSADSQLKIWQMD 230
               H    +++    D   VV+ S D  +K+W ++
Sbjct: 555 LGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLN 590

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 95/223 (42%), Gaps = 48/223 (21%)

Query: 38  KVITGALEN-ISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDL+T +    LS  DG+   +V  +  K               IAA
Sbjct: 483 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPEDGK--------------YIAA 528

Query: 95  GYADGVIKLWDLVSKTVLL-----SFN----GHKSRITMLKFDKTGTQLISGSEDSNIIV 145
           G  D  +++WD  S+T  L     S N    GHK  +  + F + G  ++SGS D ++ +
Sbjct: 529 GSLDRAVRVWD--SETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKL 586

Query: 146 WDL-----------VSEVGLYKLRSHKGTITGLWC-DSDNWLISTSKDGLIKVWDLKTQQ 193
           W+L           V          HK  +  +     D +++S SKD  +  WD K+  
Sbjct: 587 WNLNDANNKDLKPNVPGTCEVTYTGHKDFVLSVATTQGDEYILSGSKDRGVLFWDTKSGN 646

Query: 194 CIETHIAHTGECWALGIM------TDFVV--TSSADSQLKIWQ 228
            +     H     ++ +       T++ V  T S D + +IW+
Sbjct: 647 PLLMLQGHRNSVISVAVANGHPLGTEYGVFATGSGDCKARIWK 689

>TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON}
           Anc_6.363 YCR084C
          Length = 727

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/333 (23%), Positives = 145/333 (43%), Gaps = 60/333 (18%)

Query: 390 VRSIDISDDNALLATASNGELKIWNLNTKSCIRTFECG--------------------YA 429
           V  +  S+D   LAT  N   +++  +T   I T                        Y 
Sbjct: 401 VCCVRFSNDGQFLATGCNKTTRVYKTSTGELIATLLVDPQSSNNSNSEQQTNPESSDLYI 460

Query: 430 LTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSA 489
            +  F P G  +  G  +  ++++D+ +  ++  ++  HE  I+SLD    G++LV+GS 
Sbjct: 461 RSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKG-HEQDIYSLDYFPSGEKLVSGSG 519

Query: 490 DKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDD-KFLAISLLD 548
           DK+++ WD +  Q  +                 TL + D + ++  S ++ KF+A   LD
Sbjct: 520 DKTVRIWDLRTGQCSL-----------------TLSIEDGVTTVSSSPNNGKFIAAGSLD 562

Query: 549 NTVKV------FFLDSMKFFLSLY-GHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFG 601
            + ++      F L  +     L  GHK  + S+  + D K +++ S D+++K+W LD  
Sbjct: 563 RSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLDTT 622

Query: 602 D------CHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSE 655
           +      C  +   H+D ++ V          S SKD  V +WD +    +  L  H++ 
Sbjct: 623 NNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQGHKNS 682

Query: 656 VWALAVSDNGERV-------VSVSHDHSIRIWE 681
           V ++AV+ NG+ +        + S D + +IW 
Sbjct: 683 VISVAVA-NGQPLGPEFGVFSTGSGDFTAKIWR 714

 Score = 76.3 bits (186), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 110/225 (48%), Gaps = 14/225 (6%)

Query: 467 AHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAG--TSDKYVPQMNIVHDSTL 524
           +H   +  +  +NDG+ L TG  +K+ + +      ELIA      +     N    +  
Sbjct: 396 SHPSVVCCVRFSNDGQFLATG-CNKTTRVYKTSTG-ELIATLLVDPQSSNNSNSEQQTNP 453

Query: 525 ELGD-DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKV 583
           E  D  I S+  S D KFLA    D  ++++ + + +  + L GH+  + SLD     + 
Sbjct: 454 ESSDLYIRSVCFSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEK 513

Query: 584 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA-SKDGFVKYWDGDK 642
           +++ S DK ++IW L  G C  +L + +D +  V   P +  F +A S D   + WD + 
Sbjct: 514 LVSGSGDKTVRIWDLRTGQCSLTL-SIEDGVTTVSSSPNNGKFIAAGSLDRSARIWDTET 572

Query: 643 FECIQKL-------AAHQSEVWALAVSDNGERVVSVSHDHSIRIW 680
              +++L         H+  +++++ + +G+++VS S D S+++W
Sbjct: 573 GFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLW 617

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 105/229 (45%), Gaps = 25/229 (10%)

Query: 383 LQGSRTDVRSID-ISDDNALLATASNGELKIWNLNTKSCIRTF--ECGYALTCKFLPGGL 439
           L+G   D+ S+D       L++ + +  ++IW+L T  C  T   E G          G 
Sbjct: 495 LKGHEQDIYSLDYFPSGEKLVSGSGDKTVRIWDLRTGQCSLTLSIEDGVTTVSSSPNNGK 554

Query: 440 LVVVGTREGNLQLFDLASSVLL------TTIEAAHEGAIWSLDVTNDGKRLVTGSADKSI 493
            +  G+ + + +++D  +  LL      T ++  H+ +I+S+  T DGK+LV+GS D+S+
Sbjct: 555 FIAAGSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSV 614

Query: 494 KFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKV 553
           K W+     +     S++      I H       D +LS+  S +D+++     D  V  
Sbjct: 615 KLWNL----DTTNNNSNESCEVTFIGHK------DFVLSVTTSQNDEYVLSGSKDRGVLF 664

Query: 554 FFLDSMKFFLSLYGHKLPVLSLDISDDTK------VIITSSADKNIKIW 596
           +  +S    L L GHK  V+S+ +++         V  T S D   KIW
Sbjct: 665 WDTNSGNPLLMLQGHKNSVISVAVANGQPLGPEFGVFSTGSGDFTAKIW 713

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 75/157 (47%), Gaps = 12/157 (7%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   +AAG  D +I++WD+ +K +++   GH+  I  L +  +G +L+SGS D  + 
Sbjct: 465 FSPDGKFLAAGAEDKLIRIWDITTKQIVMILKGHEQDIYSLDYFPSGEKLVSGSGDKTVR 524

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDN--WLISTSKDGLIKVWDLKT-------QQCI 195
           +WDL +      L    G +T +    +N  ++ + S D   ++WD +T           
Sbjct: 525 IWDLRTGQCSLTLSIEDG-VTTVSSSPNNGKFIAAGSLDRSARIWDTETGFLLKRLDSQT 583

Query: 196 ETHIAHTGECWALGIMTDF--VVTSSADSQLKIWQMD 230
           +    H    +++    D   +V+ S D  +K+W +D
Sbjct: 584 DLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWNLD 620

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 92/216 (42%), Gaps = 39/216 (18%)

Query: 38  KVITGALE-NISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDL+T +    LS  DG     V   SS P    +         IAA
Sbjct: 513 KLVSGSGDKTVRIWDLRTGQCSLTLSIEDG-----VTTVSSSPNNGKF---------IAA 558

Query: 95  GYADGVIKLWDLVSKTVLLSF-------NGHKSRITMLKFDKTGTQLISGSEDSNIIVWD 147
           G  D   ++WD  +  +L          NGHK  I  + F K G +L+SGS D ++ +W+
Sbjct: 559 GSLDRSARIWDTETGFLLKRLDSQTDLQNGHKDSIYSVSFTKDGKKLVSGSLDRSVKLWN 618

Query: 148 L------VSEVGLYKLRSHKGTITGLWC-DSDNWLISTSKDGLIKVWDLKTQQCIETHIA 200
           L       +E        HK  +  +    +D +++S SKD  +  WD  +   +     
Sbjct: 619 LDTTNNNSNESCEVTFIGHKDFVLSVTTSQNDEYVLSGSKDRGVLFWDTNSGNPLLMLQG 678

Query: 201 HTGECWALGIMT------DFVV--TSSADSQLKIWQ 228
           H     ++ +        +F V  T S D   KIW+
Sbjct: 679 HKNSVISVAVANGQPLGPEFGVFSTGSGDFTAKIWR 714

>Smik_3.183 Chr3 complement(259959..262088) [2130 bp, 709 aa] {ON}
           YCR084C (REAL)
          Length = 709

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 134/299 (44%), Gaps = 52/299 (17%)

Query: 412 IWNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGA 471
           + NLNT S   +    Y  +  F P G  +  G  +  ++++D+    ++  ++  HE  
Sbjct: 427 VENLNTSSSPSSDL--YIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQG-HEQD 483

Query: 472 IWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDIL 531
           I+SLD    G +LV+GS D++++ WD +  Q  +                 TL + D + 
Sbjct: 484 IYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEDGVT 526

Query: 532 SIKIS-GDDKFLAISLLDNTVKVFFLDSMKFFL---------SLYGHKLPVLSLDISDDT 581
           ++ +S GD K++A   LD  V+V+  DS   FL         S  GHK  V S+  + D 
Sbjct: 527 TVAVSPGDGKYIAAGSLDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDG 584

Query: 582 KVIITSSADKNIKIWGL------------DFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA 629
             +++ S D+++K+W L            + G C  +   H+D ++ V          S 
Sbjct: 585 HSVVSGSLDRSVKLWNLQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSG 644

Query: 630 SKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERV-------VSVSHDHSIRIWE 681
           SKD  V +WD      +  L  H++ V ++AV+ NG  +        + S D   RIW+
Sbjct: 645 SKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVA-NGSPLGPEYNVFATGSGDCKARIWK 702

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 85/187 (45%), Gaps = 14/187 (7%)

Query: 74  SSKPAEVSYLQ---FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKT 130
           SS P+   Y++   F  +   +A G  D +I++WD+  + +++   GH+  I  L +  +
Sbjct: 433 SSSPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIEKRKIVMILQGHEQDIYSLDYFPS 492

Query: 131 GTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDL 189
           G +L+SGS D  + +WDL +      L    G  T      D  ++ + S D  ++VWD 
Sbjct: 493 GDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDS 552

Query: 190 KTQQCI-------ETHIAHTGECWALGIMTD--FVVTSSADSQLKIWQM-DLEGEPGSKL 239
           +T   +       E+   H    +++    D   VV+ S D  +K+W + +   +  SK 
Sbjct: 553 ETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKLWNLQNANNKSDSKA 612

Query: 240 IEKGAFE 246
              G  E
Sbjct: 613 PNSGTCE 619

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 95/224 (42%), Gaps = 49/224 (21%)

Query: 38  KVITGALEN-ISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDL+T +    LS  DG+   +V      P +  Y         IAA
Sbjct: 495 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKY---------IAA 540

Query: 95  GYADGVIKLWDLVSKTVLL---------SFNGHKSRITMLKFDKTGTQLISGSEDSNIIV 145
           G  D  +++WD  S+T  L         S  GHK  +  + F + G  ++SGS D ++ +
Sbjct: 541 GSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGHSVVSGSLDRSVKL 598

Query: 146 WDL----------VSEVGLYKLR--SHKGTITGLWC-DSDNWLISTSKDGLIKVWDLKTQ 192
           W+L              G  ++    HK  +  +    +D +++S SKD  +  WD K+ 
Sbjct: 599 WNLQNANNKSDSKAPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSG 658

Query: 193 QCIETHIAHTGECWA--------LGIMTDFVVTSSADSQLKIWQ 228
             +     H     +        LG   +   T S D + +IW+
Sbjct: 659 NPLLMLQGHRNSVISVAVANGSPLGPEYNVFATGSGDCKARIWK 702

>Suva_3.121 Chr3 complement(177765..179864) [2100 bp, 700 aa] {ON}
           YCR084C (REAL)
          Length = 700

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 127/274 (46%), Gaps = 44/274 (16%)

Query: 412 IWNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGA 471
           + NLNT S   +    Y  +  F P G  +  G  +  ++++D+ +  ++  ++  HE  
Sbjct: 435 VENLNTSSTPSSDL--YIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQG-HEQD 491

Query: 472 IWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDIL 531
           I+SLD    G +LV+GS D++++ WD +  Q  +                 TL + D + 
Sbjct: 492 IYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSL-----------------TLSIEDGVT 534

Query: 532 SIKIS-GDDKFLAISLLDNTVKVFFLDSMKFFL---------SLYGHKLPVLSLDISDDT 581
           ++ +S GD K++A   LD  V+V+  DS   FL         S  GHK  V S+  + D 
Sbjct: 535 TVAVSPGDGKYIAAGSLDRAVRVW--DSETGFLVERLDSENESGTGHKDSVYSVVFTRDG 592

Query: 582 KVIITSSADKNIKIWGL------------DFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA 629
           + +++ S D+++K+W L            + G C  +   H+D ++ V          S 
Sbjct: 593 ESVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSG 652

Query: 630 SKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD 663
           SKD  V +WD      +  L  H++ V ++AV++
Sbjct: 653 SKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVAN 686

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 83/159 (52%), Gaps = 9/159 (5%)

Query: 530 ILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSA 589
           I S+  S D KFLA    D  ++++ +++ K  + L GH+  + SLD       +++ S 
Sbjct: 450 IRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSG 509

Query: 590 DKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA-SKDGFVKYWDGDKFECIQK 648
           D+ ++IW L  G C  +L + +D +  V   PG   + +A S D  V+ WD +    +++
Sbjct: 510 DRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVER 568

Query: 649 L-------AAHQSEVWALAVSDNGERVVSVSHDHSIRIW 680
           L         H+  V+++  + +GE VVS S D S+++W
Sbjct: 569 LDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLW 607

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 80/169 (47%), Gaps = 13/169 (7%)

Query: 74  SSKPAEVSYLQ---FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKT 130
           SS P+   Y++   F  +   +A G  D +I++WD+ ++ +++   GH+  I  L +  +
Sbjct: 441 SSTPSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPS 500

Query: 131 GTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDL 189
           G +L+SGS D  + +WDL +      L    G  T      D  ++ + S D  ++VWD 
Sbjct: 501 GDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDS 560

Query: 190 KTQQCI-------ETHIAHTGECWALGIMTD--FVVTSSADSQLKIWQM 229
           +T   +       E+   H    +++    D   VV+ S D  +K+W +
Sbjct: 561 ETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKLWNL 609

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 55/113 (48%), Gaps = 2/113 (1%)

Query: 570 LPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA 629
           L + S+  S D K + T + D+ I+IW ++       L  H+  I  + + P      S 
Sbjct: 448 LYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSG 507

Query: 630 SKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD-NGERVVSVSHDHSIRIWE 681
           S D  V+ WD    +C   L+  +  V  +AVS  +G+ + + S D ++R+W+
Sbjct: 508 SGDRTVRIWDLRTGQCSLTLSI-EDGVTTVAVSPGDGKYIAAGSLDRAVRVWD 559

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 81/179 (45%), Gaps = 41/179 (22%)

Query: 38  KVITGALEN-ISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDL+T +    LS  DG+   +V      P +  Y         IAA
Sbjct: 503 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAV-----SPGDGKY---------IAA 548

Query: 95  GYADGVIKLWDLVSKTVLL---------SFNGHKSRITMLKFDKTGTQLISGSEDSNIIV 145
           G  D  +++WD  S+T  L         S  GHK  +  + F + G  ++SGS D ++ +
Sbjct: 549 GSLDRAVRVWD--SETGFLVERLDSENESGTGHKDSVYSVVFTRDGESVVSGSLDRSVKL 606

Query: 146 WDL----------VSEVGLYKLR--SHKGTITGLWC-DSDNWLISTSKDGLIKVWDLKT 191
           W+L              G  ++    HK  +  +    +D +++S SKD  +  WD K+
Sbjct: 607 WNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKS 665

 Score = 36.2 bits (82), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 12/85 (14%)

Query: 92  IAAGYADGVIKLWDLV------------SKTVLLSFNGHKSRITMLKFDKTGTQLISGSE 139
           + +G  D  +KLW+L             S T  +++ GHK  +  +   +    ++SGS+
Sbjct: 595 VVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSK 654

Query: 140 DSNIIVWDLVSEVGLYKLRSHKGTI 164
           D  ++ WD  S   L  L+ H+ ++
Sbjct: 655 DRGVLFWDKKSGNPLLMLQGHRNSV 679

>TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa]
           {ON} Anc_6.363 YCR084C
          Length = 657

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 127/284 (44%), Gaps = 48/284 (16%)

Query: 428 YALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTG 487
           Y  +  F P G  +  G  +  ++++D+A   ++  ++  HE  I+SLD    G +LV+G
Sbjct: 377 YIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQG-HEQDIYSLDYFPSGDKLVSG 435

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS-GDDKFLAISL 546
           S D++++ WD +  Q  +                 TL + D + ++ +S GD KF+A   
Sbjct: 436 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 478

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSLDISDDTKVIITSSADKNIKIWG 597
           LD  V+V+  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 479 LDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWN 536

Query: 598 L------------DFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFEC 645
           L              G C  +   H+D ++ V          S SKD  V +WD      
Sbjct: 537 LRGDKNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWDTQSGNP 596

Query: 646 IQKLAAHQSEVWALAVSDN---GER---VVSVSHDHSIRIWEET 683
           +  L  H++ V ++AV++    G +     + S D   RIW+ T
Sbjct: 597 LLMLQGHRNSVISVAVANGFPLGPQYGVFATGSGDCKARIWKYT 640

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 111/246 (45%), Gaps = 31/246 (12%)

Query: 468 HEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQ-ELIAGTSDKYVPQMNIVHDSTL-- 524
           H   +  +  +NDG+ L TG  +K+ +   F+V    LIA  SD    Q+     S    
Sbjct: 300 HTSVVCCVRFSNDGEYLATG-CNKTTQV--FRVSDGALIARLSDDAASQVAAPAGSPANA 356

Query: 525 -ELGDD---------------ILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGH 568
            E  +D               I S+  S D KFLA    D  ++++ +   +  + L GH
Sbjct: 357 DEPNNDVNSFVTAKSASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGH 416

Query: 569 KLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFS 628
           +  + SLD       +++ S D+ ++IW L  G C  +L + +D +  V   PG   F +
Sbjct: 417 EQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGDGKFIA 475

Query: 629 A-SKDGFVKYWDGDKFECIQKL-------AAHQSEVWALAVSDNGERVVSVSHDHSIRIW 680
           A S D  V+ WD +    +++L         H+  V+++  + +G  VVS S D S+++W
Sbjct: 476 AGSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLW 535

Query: 681 EETDDQ 686
               D+
Sbjct: 536 NLRGDK 541

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 70/155 (45%), Gaps = 10/155 (6%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   +A G  D +I++WD+  K +++   GH+  I  L +  +G +L+SGS D  + 
Sbjct: 383 FSPDGKFLATGAEDRLIRIWDIAKKQIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 442

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST-SKDGLIKVWDLKTQQCIET------ 197
           +WDL +      L    G  T      D   I+  S D  ++VWD +T   +E       
Sbjct: 443 IWDLRTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENE 502

Query: 198 -HIAHTGECWALGIMTD--FVVTSSADSQLKIWQM 229
               H    +++    D   VV+ S D  +K+W +
Sbjct: 503 LGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNL 537

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/244 (24%), Positives = 102/244 (41%), Gaps = 60/244 (24%)

Query: 38  KVITGALEN-ISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDL+T +    LS  DG+   +V     K               IAA
Sbjct: 431 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGK--------------FIAA 476

Query: 95  GYADGVIKLWDLVSKTVLL-----SFN----GHKSRITMLKFDKTGTQLISGSEDSNIIV 145
           G  D  +++WD  S+T  L     S N    GHK  +  + F + G  ++SGS D ++ +
Sbjct: 477 GSLDRAVRVWD--SETGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKL 534

Query: 146 WDLVSEVGLYKLRSHKGTITGLWCD-----------------SDNWLISTSKDGLIKVWD 188
           W+L  +    K  S  G  T   C+                 +D +++S SKD  +  WD
Sbjct: 535 WNLRGD----KNNSSSGKPTPGTCEVTYTGHKDFVLSVATTQNDQYILSGSKDRGVLFWD 590

Query: 189 LKTQQCIETHIAHTGECWALGIMTDFVV--------TSSADSQLKIW---QMDLEGEPGS 237
            ++   +     H     ++ +   F +        T S D + +IW   + D   + GS
Sbjct: 591 TQSGNPLLMLQGHRNSVISVAVANGFPLGPQYGVFATGSGDCKARIWKYTKTDAGIDSGS 650

Query: 238 KLIE 241
           K+ E
Sbjct: 651 KIKE 654

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 67/166 (40%), Gaps = 26/166 (15%)

Query: 37  GKVITGALEN--ISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           GK +    E+  I +WD+   ++  VL                 ++  L +      + +
Sbjct: 387 GKFLATGAEDRLIRIWDIAKKQIVMVLQ------------GHEQDIYSLDYFPSGDKLVS 434

Query: 95  GYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGL 154
           G  D  +++WDL +    L+ +      T+      G  + +GS D  + VWD  SE G 
Sbjct: 435 GSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWD--SETGF 492

Query: 155 YKLR---------SHKGTITGLWCDSD-NWLISTSKDGLIKVWDLK 190
              R          HK ++  +    D N ++S S D  +K+W+L+
Sbjct: 493 LVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLR 538

>NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363
          Length = 621

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 128/276 (46%), Gaps = 42/276 (15%)

Query: 428 YALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTG 487
           Y  +  F P G  +  G  +  ++++++    ++  ++  HE  I+SLD   DG++LV+G
Sbjct: 343 YIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKG-HEQDIYSLDYFPDGQKLVSG 401

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDD-KFLAISL 546
           S D+SI+ WD +  Q  +                 TL + D + ++ +S ++ K +A   
Sbjct: 402 SGDRSIRIWDLKTGQCSL-----------------TLSIEDGVTTVAVSPNEGKLIAAGS 444

Query: 547 LDNTVKVFFLDSMKFFL---------SLYGHKLPVLSLDISDDTKVIITSSADKNIKIWG 597
           LD +V+++  DS   FL         S  GH+  V S+  + D + +++ S D+ +K+W 
Sbjct: 445 LDRSVRIW--DSSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWN 502

Query: 598 LD-----FGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAH 652
           L       G C  +   H+D ++ V         FS SKD  V  WD D    I  L  H
Sbjct: 503 LGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGH 562

Query: 653 QSEVWALAV----SDNGER---VVSVSHDHSIRIWE 681
           ++ V ++A      D+G+      + S D   RIW+
Sbjct: 563 RNSVISVATVNSNVDDGKNYKLFATGSGDCKARIWK 598

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 113/233 (48%), Gaps = 15/233 (6%)

Query: 467 AHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQ---ELIAGTSDKYVPQMNIVHDST 523
            H+  +  +  + DGK L TG  +++ + +D    +   +L+  T +  +      ++ T
Sbjct: 277 PHDSVVCCVKFSQDGKYLATG-CNRTTQIFDVATGELYVKLLDDTVNTAIVTTTTENNET 335

Query: 524 LELGDD--ILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDT 581
           +    D  I SI  S D +FLA    D  ++++ +   K  + L GH+  + SLD   D 
Sbjct: 336 VTTTADLYIRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDG 395

Query: 582 KVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA-SKDGFVKYWDG 640
           + +++ S D++I+IW L  G C  +L + +D +  V   P      +A S D  V+ WD 
Sbjct: 396 QKLVSGSGDRSIRIWDLKTGQCSLTL-SIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDS 454

Query: 641 DKFECIQKL-------AAHQSEVWALAVSDNGERVVSVSHDHSIRIWEETDDQ 686
                +++L         HQ  V+++A + +G+ VVS S D ++++W   D Q
Sbjct: 455 STGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQ 507

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 120/239 (50%), Gaps = 24/239 (10%)

Query: 390 VRSIDISDDNALLATASNGEL-KIWNLNTKSCIRTFECG----YALTCKFLPGGLLVVVG 444
           +RSI  S D   LAT +  +L +IWN+  +  +   +      Y+L   + P G  +V G
Sbjct: 344 IRSICFSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSL--DYFPDGQKLVSG 401

Query: 445 TREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVT-NDGKRLVTGSADKSIKFWDFQVKQE 503
           + + +++++DL +     T+    E  + ++ V+ N+GK +  GS D+S++ WD      
Sbjct: 402 SGDRSIRIWDLKTGQCSLTLSI--EDGVTTVAVSPNEGKLIAAGSLDRSVRIWD------ 453

Query: 504 LIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLD-----S 558
               ++   V +++  ++S     D + S+  + D + +    LD TVK++ L      +
Sbjct: 454 ---SSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNLGDTQSGT 510

Query: 559 MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCV 617
            K  ++  GHK  VLS+  S+D K I + S D+ + IW  D G+    L  H++S++ V
Sbjct: 511 GKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQGHRNSVISV 569

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 72/155 (46%), Gaps = 10/155 (6%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   +A G  D +I++W++  + +++   GH+  I  L +   G +L+SGS D +I 
Sbjct: 349 FSPDGEFLATGAEDKLIRIWNIKERKIVMVLKGHEQDIYSLDYFPDGQKLVSGSGDRSIR 408

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST-SKDGLIKVWDLKTQQCI-------E 196
           +WDL +      L    G  T     ++  LI+  S D  +++WD  T   +       E
Sbjct: 409 IWDLKTGQCSLTLSIEDGVTTVAVSPNEGKLIAAGSLDRSVRIWDSSTGFLVERLDSDNE 468

Query: 197 THIAHTGECWALGIMTD--FVVTSSADSQLKIWQM 229
           +   H    +++    D   VV+ S D  +K+W +
Sbjct: 469 SGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKLWNL 503

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 100/229 (43%), Gaps = 43/229 (18%)

Query: 38  KVITGALE-NISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ + +I +WDLKT +    LS  DG+   +V     K              LIAA
Sbjct: 397 KLVSGSGDRSIRIWDLKTGQCSLTLSIEDGVTTVAVSPNEGK--------------LIAA 442

Query: 95  GYADGVIKLWDLVSKTVLL---------SFNGHKSRITMLKFDKTGTQLISGSEDSNIIV 145
           G  D  +++WD  S T  L         S NGH+  +  + F K G  ++SGS D  + +
Sbjct: 443 GSLDRSVRIWD--SSTGFLVERLDSDNESGNGHQDSVYSVAFTKDGQHVVSGSLDRTVKL 500

Query: 146 WDLV-SEVGLYKLR----SHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHI 199
           W+L  ++ G  K       HK  +  +   +D+ ++ S SKD  + +WD  +   I    
Sbjct: 501 WNLGDTQSGTGKCEVTYIGHKDFVLSVATSNDDKYIFSGSKDRGVIIWDKDSGNPILMLQ 560

Query: 200 AHTGECWALGIMTDFV---------VTSSADSQLKIWQMDLEGEPGSKL 239
            H     ++  +   V          T S D + +IW+    GE  +K+
Sbjct: 561 GHRNSVISVATVNSNVDDGKNYKLFATGSGDCKARIWKYFKMGEVTAKI 609

>Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON}
           (63032..65266) [2235 nt, 745 aa]
          Length = 744

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 127/283 (44%), Gaps = 47/283 (16%)

Query: 428 YALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTG 487
           Y  +  F P G  +  G  +  ++++D+A   ++  ++  HE  I+SLD    G +LV+G
Sbjct: 464 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQG-HEQDIYSLDYFPSGDKLVSG 522

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS-GDDKFLAISL 546
           S D++++ WD +  Q  +                 TL + D + ++ +S GD K++A   
Sbjct: 523 SGDRTVRIWDLRNGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 565

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSLDISDDTKVIITSSADKNIKIWG 597
           LD  V+V+  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 566 LDRAVRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWN 623

Query: 598 LD-----------FGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECI 646
           L             G C  +   H+D ++ V          S SKD  V +WD      +
Sbjct: 624 LRGDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGNPL 683

Query: 647 QKLAAHQSEVWALAVSDN---GERV---VSVSHDHSIRIWEET 683
             L  H++ V ++AV++    G  V    + S D   RIW+ T
Sbjct: 684 LMLQGHRNSVISVAVANGFPLGPNVGVFATGSGDCKARIWKYT 726

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 105/239 (43%), Gaps = 27/239 (11%)

Query: 468 HEGAIWSLDVTNDGKRLVTGSADKSIKF-----------------WDFQVKQELIAGTSD 510
           H   +  +  +NDG+ L TG    +  F                    Q + +   GT+D
Sbjct: 385 HTSVVCCVRFSNDGQFLATGCNKTTQVFRVSDGELVARLSDDSTSQGVQGQSDAANGTAD 444

Query: 511 KYVPQMNIVHDSTLELGD-DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHK 569
               + N    ST    D  I S+  S D KFLA    D  ++++ +   K  + L GH+
Sbjct: 445 GTSGETNSFATSTSASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHE 504

Query: 570 LPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA 629
             + SLD       +++ S D+ ++IW L  G C  +L + +D +  V   PG   + +A
Sbjct: 505 QDIYSLDYFPSGDKLVSGSGDRTVRIWDLRNGQCSLTL-SIEDGVTTVAVSPGDGKYIAA 563

Query: 630 -SKDGFVKYWDGDKFECIQKL-------AAHQSEVWALAVSDNGERVVSVSHDHSIRIW 680
            S D  V+ WD +    +++L         H+  V+++  + +G  VVS S D S+++W
Sbjct: 564 GSLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLW 622

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 71/155 (45%), Gaps = 10/155 (6%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   +A G  D +I++WD+  K +++   GH+  I  L +  +G +L+SGS D  + 
Sbjct: 470 FSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 529

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIET------ 197
           +WDL +      L    G  T      D  ++ + S D  ++VWD +T   +E       
Sbjct: 530 IWDLRNGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENE 589

Query: 198 -HIAHTGECWALGIMTDF--VVTSSADSQLKIWQM 229
               H    +++    D   VV+ S D  +K+W +
Sbjct: 590 LGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNL 624

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 93/223 (41%), Gaps = 48/223 (21%)

Query: 38  KVITGALEN-ISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDL+  +    LS  DG     V   +  P +  Y         IAA
Sbjct: 518 KLVSGSGDRTVRIWDLRNGQCSLTLSIEDG-----VTTVAVSPGDGKY---------IAA 563

Query: 95  GYADGVIKLWD-----LVSKTVLLSFN----GHKSRITMLKFDKTGTQLISGSEDSNIIV 145
           G  D  +++WD     LV +  L S N    GHK  +  + F + G  ++SGS D ++ +
Sbjct: 564 GSLDRAVRVWDSETGFLVER--LDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKL 621

Query: 146 WDL-----------VSEVGLYKLRSHKGTITGLWC-DSDNWLISTSKDGLIKVWDLKTQQ 193
           W+L           V          HK  +  +    +D +++S SKD  +  WD K+  
Sbjct: 622 WNLRGDNNQDVKPNVPGTCEVTYTGHKDFVLSVATTQNDEYILSGSKDRGVLFWDTKSGN 681

Query: 194 CIETHIAHTGECWALGIMTDFVV--------TSSADSQLKIWQ 228
            +     H     ++ +   F +        T S D + +IW+
Sbjct: 682 PLLMLQGHRNSVISVAVANGFPLGPNVGVFATGSGDCKARIWK 724

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 41/76 (53%)

Query: 614 IMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSH 673
           I  V F P      + ++D  ++ WD  + + +  L  H+ ++++L    +G+++VS S 
Sbjct: 465 IRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSG 524

Query: 674 DHSIRIWEETDDQVFL 689
           D ++RIW+  + Q  L
Sbjct: 525 DRTVRIWDLRNGQCSL 540

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 80/195 (41%), Gaps = 29/195 (14%)

Query: 37  GKVITGALEN--ISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           GK +    E+  I +WD+   ++  VL                 ++  L +      + +
Sbjct: 474 GKFLATGAEDRLIRIWDIAQKKIVMVLQ------------GHEQDIYSLDYFPSGDKLVS 521

Query: 95  GYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGL 154
           G  D  +++WDL +    L+ +      T+      G  + +GS D  + VWD  SE G 
Sbjct: 522 GSGDRTVRIWDLRNGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWD--SETGF 579

Query: 155 YKLR---------SHKGTITGLWCDSD-NWLISTSKDGLIKVWDLK--TQQCIETHIAHT 202
              R          HK ++  +    D N ++S S D  +K+W+L+    Q ++ ++  T
Sbjct: 580 LVERLDSENELGTGHKDSVYSVVFTRDGNNVVSGSLDRSVKLWNLRGDNNQDVKPNVPGT 639

Query: 203 GECWALGIMTDFVVT 217
            E    G   DFV++
Sbjct: 640 CEVTYTG-HKDFVLS 653

>SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some
           similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 660

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 129/284 (45%), Gaps = 51/284 (17%)

Query: 428 YALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTG 487
           Y  +  F P G  +  G  +  ++++DL++  ++ T++  HE  I+SLD    G +LV+G
Sbjct: 380 YIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQG-HEQDIYSLDYFPSGDKLVSG 438

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS-GDDKFLAISL 546
           S D++++ WD +  Q  +                 TL + D + ++ +S G+ KF+A   
Sbjct: 439 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGEGKFIAAGS 481

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSLDISDDTKVIITSSADKNIKIWG 597
           LD T++V+  DS   FL            GHK  V S+  + D + +++ S D+++K+W 
Sbjct: 482 LDRTLRVW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWN 539

Query: 598 LD-------------FGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFE 644
           L                 C  +   H+D ++ V          S SKD  V +WD     
Sbjct: 540 LHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGN 599

Query: 645 CIQKLAAHQSEVWALAVSDNGERV-------VSVSHDHSIRIWE 681
            +  L  H++ V ++AV+ NG  +        + S D   RIW+
Sbjct: 600 PLLMLQGHRNSVISVAVA-NGFPLGPDYGVFATGSGDCKARIWK 642

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 113/239 (47%), Gaps = 29/239 (12%)

Query: 468 HEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSD---KYVPQMNIVHDS-- 522
           H   +  +  +NDG+ L TG  +K+ + +       L+A  SD         +I  D+  
Sbjct: 303 HSSVVCCVRFSNDGEYLATG-CNKTTQVYKVSTG-ALVARLSDDSASTTANSSISQDANN 360

Query: 523 TLELGDD-------------ILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHK 569
           + E G++             I S+  S D KFLA    D  ++++ L + +  ++L GH+
Sbjct: 361 SGENGENAVSSASTSSSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHE 420

Query: 570 LPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA 629
             + SLD       +++ S D+ ++IW L  G C  +L + +D +  V   PG   F +A
Sbjct: 421 QDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPGEGKFIAA 479

Query: 630 -SKDGFVKYWDGDKFECIQKL-------AAHQSEVWALAVSDNGERVVSVSHDHSIRIW 680
            S D  ++ WD +    +++L         H+  V+++  + +G+ VVS S D S+++W
Sbjct: 480 GSLDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLW 538

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 109/233 (46%), Gaps = 22/233 (9%)

Query: 381 IELQGSRTDVRSID-ISDDNALLATASNGELKIWNLNTKSCIRTFECGYALTCKFL-PG- 437
           + LQG   D+ S+D     + L++ + +  ++IW+L T  C  T      +T   + PG 
Sbjct: 414 MTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGE 473

Query: 438 GLLVVVGTREGNLQLFDLASSVLLTTIEA------AHEGAIWSLDVTNDGKRLVTGSADK 491
           G  +  G+ +  L+++D  +  L+  +++       H+ +++S+  T DG+ +V+GS D+
Sbjct: 474 GKFIAAGSLDRTLRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDR 533

Query: 492 SIKFWDFQVKQELIAGTSDK--YVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDN 549
           S+K W+         G+S K    P       +     D +LS+  + +DK++     D 
Sbjct: 534 SVKLWNLHN-----TGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDR 588

Query: 550 TVKVFFLDSMKFFLSLYGHKLPVLSLDISD------DTKVIITSSADKNIKIW 596
            V  +   S    L L GH+  V+S+ +++      D  V  T S D   +IW
Sbjct: 589 GVLFWDTQSGNPLLMLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIW 641

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 74/159 (46%), Gaps = 10/159 (6%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   +A G  D +I++WDL +K ++++  GH+  I  L +  +G +L+SGS D  + 
Sbjct: 386 FSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 445

Query: 145 VWDLVSEVGLYKLRSHKG-TITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIET------ 197
           +WDL +      L    G T   +      ++ + S D  ++VWD +T   +E       
Sbjct: 446 IWDLRTGQCSLTLSIEDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSETGFLVERLDSENE 505

Query: 198 -HIAHTGECWALGIMTD--FVVTSSADSQLKIWQMDLEG 233
               H    +++    D   VV+ S D  +K+W +   G
Sbjct: 506 LGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLHNTG 544

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 126/278 (45%), Gaps = 46/278 (16%)

Query: 390 VRSIDISDDNALLATASNGEL-KIWNLNTKSCIRTFECG----YALTCKFLPGGLLVVVG 444
           +RS+  S D   LAT +  +L +IW+L+TK  + T +      Y+L   + P G  +V G
Sbjct: 381 IRSVCFSPDGKFLATGAEDKLIRIWDLSTKRIVMTLQGHEQDIYSL--DYFPSGDKLVSG 438

Query: 445 TREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVT-NDGKRLVTGSADKSIKFWDFQVKQE 503
           + +  ++++DL +     T+    E  + ++ V+  +GK +  GS D++++ WD +    
Sbjct: 439 SGDRTVRIWDLRTGQCSLTLSI--EDGVTTVAVSPGEGKFIAAGSLDRTLRVWDSE---- 492

Query: 504 LIAGTSDKYVPQMNIVHDSTLELG----DDILSIKISGDDKFLAISLLDNTVKVFFLD-- 557
                +   V ++    DS  ELG    D + S+  + D + +    LD +VK++ L   
Sbjct: 493 -----TGFLVERL----DSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKLWNLHNT 543

Query: 558 -----------SMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKS 606
                      +    ++  GHK  VLS+  + + K I++ S D+ +  W    G+    
Sbjct: 544 GSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQSGNPLLM 603

Query: 607 LFAHQDSIMCVKFL------PGSHNFFSASKDGFVKYW 638
           L  H++S++ V         P    F + S D   + W
Sbjct: 604 LQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIW 641

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 95/225 (42%), Gaps = 50/225 (22%)

Query: 38  KVITGALE-NISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDL+T +    LS  DG     V   +  P E  +         IAA
Sbjct: 434 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDG-----VTTVAVSPGEGKF---------IAA 479

Query: 95  GYADGVIKLWD-----LVSKTVLLSFN----GHKSRITMLKFDKTGTQLISGSEDSNIIV 145
           G  D  +++WD     LV +  L S N    GHK  +  + F + G  ++SGS D ++ +
Sbjct: 480 GSLDRTLRVWDSETGFLVER--LDSENELGTGHKDSVYSVVFTRDGQGVVSGSLDRSVKL 537

Query: 146 WDLVSEVGLYKLRSHKG------TITG--------LWCDSDNWLISTSKDGLIKVWDLKT 191
           W+L +     K  S         T TG            +D +++S SKD  +  WD ++
Sbjct: 538 WNLHNTGSSSKNDSKPTAATCEVTYTGHKDFVLSVATTQNDKYILSGSKDRGVLFWDTQS 597

Query: 192 QQCIETHIAHTGECWALGIMTDFVV--------TSSADSQLKIWQ 228
              +     H     ++ +   F +        T S D + +IW+
Sbjct: 598 GNPLLMLQGHRNSVISVAVANGFPLGPDYGVFATGSGDCKARIWK 642

>ZYRO0D17292g Chr4 complement(1424965..1427121) [2157 bp, 718 aa]
           {ON} some similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084C
          Length = 718

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 127/284 (44%), Gaps = 47/284 (16%)

Query: 428 YALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTG 487
           Y  +  F P G  +  G  +  ++++D+A   ++  ++  HE  I+SLD    G +LV+G
Sbjct: 438 YIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQG-HEQDIYSLDYFPSGDKLVSG 496

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS-GDDKFLAISL 546
           S D++++ WD +  Q  +                 TL + D + ++ +S GD K++A   
Sbjct: 497 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSLGDGKYIAAGS 539

Query: 547 LDNTVKV------FFLDSMKFFLSL-YGHKLPVLSLDISDDTKVIITSSADKNIKIWGLD 599
           LD  V+V      F ++ +     L  GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 540 LDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLS 599

Query: 600 FGD-------------CHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECI 646
            G              C  +   H+D ++ V          S SKD  V +WD      +
Sbjct: 600 SGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGNPL 659

Query: 647 QKLAAHQSEVWALAVSDNGERV-------VSVSHDHSIRIWEET 683
             L  H++ V ++AV+ NG  +        + S D   RIW+ T
Sbjct: 660 LMLQGHRNSVISVAVA-NGYPLGPQYCVFATGSGDCKARIWKYT 702

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 108/244 (44%), Gaps = 27/244 (11%)

Query: 468 HEGAIWSLDVTNDGKRLVTGSADKSIKFWDF---------------QVKQELIAGTSDK- 511
           H   +  +  +NDG+ L TG  +K+ + +                 Q  Q    GTSD  
Sbjct: 361 HTSVVCCVRFSNDGEYLATG-CNKTTQVFRVSDGALVARLSDDNATQGPQGPSGGTSDDD 419

Query: 512 YVPQMNIVHDSTLELGD-DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKL 570
           Y    N   ++     D  I S+  S D KFLA    D  ++++ +   K  + L GH+ 
Sbjct: 420 YNNDANSFANTRTASSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQ 479

Query: 571 PVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA- 629
            + SLD       +++ S D+ ++IW L  G C  +L + +D +  V    G   + +A 
Sbjct: 480 DIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSLGDGKYIAAG 538

Query: 630 SKDGFVKYWDGDKFECIQKL-------AAHQSEVWALAVSDNGERVVSVSHDHSIRIWEE 682
           S D  V+ WD +    +++L         H+  V+++  + +G  VVS S D S+++W  
Sbjct: 539 SLDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNL 598

Query: 683 TDDQ 686
           +  Q
Sbjct: 599 SSGQ 602

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 71/155 (45%), Gaps = 10/155 (6%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   +A G  D +I++WD+  K +++   GH+  I  L +  +G +L+SGS D  + 
Sbjct: 444 FSPDGKFLATGAEDRLIRIWDIAQKKIVMVLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 503

Query: 145 VWDLVSEVGLYKLRSHKG-TITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIET------ 197
           +WDL +      L    G T   +      ++ + S D  ++VWD +T   +E       
Sbjct: 504 IWDLRTGQCSLTLSIEDGVTTVAVSLGDGKYIAAGSLDRAVRVWDAETGFLVERLDSENE 563

Query: 198 -HIAHTGECWALGIMTD--FVVTSSADSQLKIWQM 229
               H    +++    D   VV+ S D  +K+W +
Sbjct: 564 LGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNL 598

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 91/228 (39%), Gaps = 46/228 (20%)

Query: 38  KVITGALEN-ISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDL+T +    LS  DG+   +V L   K               IAA
Sbjct: 492 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSLGDGK--------------YIAA 537

Query: 95  GYADGVIKLWDLVSKTVLLSFN-------GHKSRITMLKFDKTGTQLISGSEDSNIIVWD 147
           G  D  +++WD  +  ++   +       GHK  +  + F + G  ++SGS D ++ +W+
Sbjct: 538 GSLDRAVRVWDAETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 597

Query: 148 LVSEVGLYKLRSHKG------TITG--------LWCDSDNWLISTSKDGLIKVWDLKTQQ 193
           L S        +         T TG            +D +++S SKD  +  WD K+  
Sbjct: 598 LSSGQNNTNAETKPAPGTCEVTYTGHKDFVLSVATTRNDEYILSGSKDRGVLFWDTKSGN 657

Query: 194 CIETHIAH--------TGECWALGIMTDFVVTSSADSQLKIWQMDLEG 233
            +     H            + LG       T S D + +IW+    G
Sbjct: 658 PLLMLQGHRNSVISVAVANGYPLGPQYCVFATGSGDCKARIWKYTTTG 705

>KNAG0D00250 Chr4 (32581..34548) [1968 bp, 655 aa] {ON} Anc_6.363
           YCR084C
          Length = 655

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 64/224 (28%), Positives = 109/224 (48%), Gaps = 15/224 (6%)

Query: 468 HEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQ-ELIAGTSDKYVPQMNIVHDSTLEL 526
           H   +  +  +NDG+ L TG  +K+ +   F+V   EL+A  SD   P +    + +   
Sbjct: 314 HTSVVCCVKFSNDGQYLATG-CNKTTQV--FRVSDGELVARLSDDNAPSIQNGGNGSDSG 370

Query: 527 GDD--ILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVI 584
             D  I S+  S D KFLA    D  ++++ L   K  + L GH   V SLD       +
Sbjct: 371 STDLYIRSVCFSPDGKFLATGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGDKL 430

Query: 585 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA-SKDGFVKYWDGDKF 643
           ++ S D+ ++IW L  G C  +L + +D +  V   PG   + +A S D  V+ WD +  
Sbjct: 431 VSGSGDRTVRIWDLKTGQCSLTL-SIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETG 489

Query: 644 ECIQKL-------AAHQSEVWALAVSDNGERVVSVSHDHSIRIW 680
             +++L         H+  V+++  + +G +VVS S D S+++W
Sbjct: 490 FLVERLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLW 533

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 129/287 (44%), Gaps = 54/287 (18%)

Query: 428 YALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTG 487
           Y  +  F P G  +  G  +  ++++DLA   ++  ++  H+  ++SLD    G +LV+G
Sbjct: 375 YIRSVCFSPDGKFLATGAEDRLIRIWDLAQQKIVMVLQG-HDQDVYSLDYFPSGDKLVSG 433

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS-GDDKFLAISL 546
           S D++++ WD +  Q  +                 TL + D + ++ +S GD K++A   
Sbjct: 434 SGDRTVRIWDLKTGQCSL-----------------TLSIEDGVTTVAVSPGDGKYIAAGS 476

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSLDISDDTKVIITSSADKNIKIWG 597
           LD  V+V+  DS   FL            GH+  V S+  + D   +++SS D+++K+W 
Sbjct: 477 LDRAVRVW--DSETGFLVERLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKLWN 534

Query: 598 L-------DFGD---------CHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGD 641
           L       +  D         C  +   H+D ++ V          S SKD  V +WD +
Sbjct: 535 LRGYNEKENAADNNKSQSSVVCEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWDTN 594

Query: 642 KFECIQKLAAHQSEVWALAVSDNGERV-------VSVSHDHSIRIWE 681
               +  L  H++ V ++AV+ NG  +        + S D   RIW+
Sbjct: 595 TGNPLLMLQGHRNSVISVAVA-NGHPLGPEYQVFATGSGDCRARIWK 640

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 113/230 (49%), Gaps = 17/230 (7%)

Query: 383 LQGSRTDVRSID-ISDDNALLATASNGELKIWNLNTKSCIRTFECGYALTCKFL-PG-GL 439
           LQG   DV S+D     + L++ + +  ++IW+L T  C  T      +T   + PG G 
Sbjct: 411 LQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGK 470

Query: 440 LVVVGTREGNLQLFDLASSVLLTTIEA------AHEGAIWSLDVTNDGKRLVTGSADKSI 493
            +  G+ +  ++++D  +  L+  +++       H  +++S+  T DG ++V+ S D+S+
Sbjct: 471 YIAAGSLDRAVRVWDSETGFLVERLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSV 530

Query: 494 KFWDFQVKQELIAGTSDKYVPQMNIVHDST-LELGDDILSIKISGDDKFLAISLLDNTVK 552
           K W+ +   E     +D    Q ++V + T +   D +LS+  + +D+F+     D  V 
Sbjct: 531 KLWNLRGYNEK-ENAADNNKSQSSVVCEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVL 589

Query: 553 VFFLDSMKFFLSLYGHKLPVLSLDISD------DTKVIITSSADKNIKIW 596
            +  ++    L L GH+  V+S+ +++      + +V  T S D   +IW
Sbjct: 590 FWDTNTGNPLLMLQGHRNSVISVAVANGHPLGPEYQVFATGSGDCRARIW 639

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 90/212 (42%), Gaps = 27/212 (12%)

Query: 39  VITGALENISVWDLKTSELEYVLSDGLPP-----------GSVDLKSSKPAEVSYLQFHS 87
           + TG  +   V+ +   EL   LSD   P           GS DL       +  + F  
Sbjct: 330 LATGCNKTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDSGSTDLY------IRSVCFSP 383

Query: 88  ETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWD 147
           +   +A G  D +I++WDL  + +++   GH   +  L +  +G +L+SGS D  + +WD
Sbjct: 384 DGKFLATGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVRIWD 443

Query: 148 LVSEVGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIET-------HI 199
           L +      L    G  T      D  ++ + S D  ++VWD +T   +E          
Sbjct: 444 LKTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDSENELGT 503

Query: 200 AHTGECWALGIMTDF--VVTSSADSQLKIWQM 229
            H    +++    D   VV+SS D  +K+W +
Sbjct: 504 GHRDSVYSVVFTRDGNKVVSSSLDRSVKLWNL 535

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 72/177 (40%), Gaps = 20/177 (11%)

Query: 523 TLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLP----------- 571
           +LE    +  +K S D ++LA    + T +VF +   +    L     P           
Sbjct: 311 SLEHTSVVCCVKFSNDGQYLATGC-NKTTQVFRVSDGELVARLSDDNAPSIQNGGNGSDS 369

Query: 572 ------VLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN 625
                 + S+  S D K + T + D+ I+IW L        L  H   +  + + P    
Sbjct: 370 GSTDLYIRSVCFSPDGKFLATGAEDRLIRIWDLAQQKIVMVLQGHDQDVYSLDYFPSGDK 429

Query: 626 FFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD-NGERVVSVSHDHSIRIWE 681
             S S D  V+ WD    +C   L+     V  +AVS  +G+ + + S D ++R+W+
Sbjct: 430 LVSGSGDRTVRIWDLKTGQCSLTLSIEDG-VTTVAVSPGDGKYIAAGSLDRAVRVWD 485

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 52/229 (22%), Positives = 92/229 (40%), Gaps = 53/229 (23%)

Query: 38  KVITGALEN-ISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDLKT +    LS  DG+   +V      P +  Y         IAA
Sbjct: 429 KLVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAV-----SPGDGKY---------IAA 474

Query: 95  GYADGVIKLWDLVSKTVLL-----SFN----GHKSRITMLKFDKTGTQLISGSEDSNIIV 145
           G  D  +++WD  S+T  L     S N    GH+  +  + F + G +++S S D ++ +
Sbjct: 475 GSLDRAVRVWD--SETGFLVERLDSENELGTGHRDSVYSVVFTRDGNKVVSSSLDRSVKL 532

Query: 146 WDLVSEVGLYKLRSHKGTITGLWCD-----------------SDNWLISTSKDGLIKVWD 188
           W+L           +  + + + C+                 +D +++S SKD  +  WD
Sbjct: 533 WNLRGYNEKENAADNNKSQSSVVCEVTYIGHKDFVLSVTTTANDEFVLSGSKDRGVLFWD 592

Query: 189 LKTQQCIETHIAH--------TGECWALGIMTDFVVTSSADSQLKIWQM 229
             T   +     H              LG       T S D + +IW+ 
Sbjct: 593 TNTGNPLLMLQGHRNSVISVAVANGHPLGPEYQVFATGSGDCRARIWKF 641

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/282 (25%), Positives = 127/282 (45%), Gaps = 48/282 (17%)

Query: 428 YALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTG 487
           Y  +  F P G  +  G  +  ++++DLA+  ++ T++  HE  I+SLD    G +LV+G
Sbjct: 472 YIRSVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQG-HEQDIYSLDYFPSGDKLVSG 530

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS-GDDKFLAISL 546
           S D++++ WD +  Q  +                 TL + D + ++ +S GD K +A   
Sbjct: 531 SGDRTVRIWDLRTGQCSL-----------------TLSIEDGVTTVAVSPGDGKLIAAGS 573

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSLDISDDTKVIITSSADKNIKIWG 597
           LD TV+++  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 574 LDRTVRIW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 631

Query: 598 L------------DFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFEC 645
           L            +      +   H+D ++ V          S SKD  V +WD      
Sbjct: 632 LRSANGGTAEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNP 691

Query: 646 IQKLAAHQSEVWALAVSDN---GER---VVSVSHDHSIRIWE 681
           +  L  H++ V ++AV+++   G       + S D   RIW+
Sbjct: 692 LLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWK 733

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/218 (25%), Positives = 98/218 (44%), Gaps = 27/218 (12%)

Query: 39  VITGALENISVWDLKTSELEYVLSD---GLPPGSVDLKSSKPAEVS-----------YLQ 84
           + TG  +   V+ + T EL   LS+     P G+    +S+ A+ S           Y++
Sbjct: 415 LATGCNKTTQVYKVSTGELIARLSEDASSAPSGADASATSENAKASPAVATSASSDLYIR 474

Query: 85  ---FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDS 141
              F  +   +A G  D +I++WDL ++ ++++  GH+  I  L +  +G +L+SGS D 
Sbjct: 475 SVCFSPDGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDR 534

Query: 142 NIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST-SKDGLIKVWDLKTQQCIET--- 197
            + +WDL +      L    G  T      D  LI+  S D  +++WD +T   +E    
Sbjct: 535 TVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDS 594

Query: 198 ----HIAHTGECWALGIMTD--FVVTSSADSQLKIWQM 229
                  H    +++    D   VV+ S D  +K+W +
Sbjct: 595 ENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNL 632

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 84/212 (39%), Gaps = 57/212 (26%)

Query: 38  KVITGALE-NISVWDLKTSELEYVLS--DGL-----PPGSVDLKSSKPAEVSYLQFHSET 89
           K+++G+ +  + +WDL+T +    LS  DG+      PG   L ++   + +   + SET
Sbjct: 526 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSET 585

Query: 90  GLI----------AAGYADGV--------------------IKLWDLVSK---------- 109
           G +            G+ D V                    +KLW+L S           
Sbjct: 586 GFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNLRSANGGTAEGKAN 645

Query: 110 --TVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL 167
                +++ GHK  +  +   +    ++SGS+D  ++ WD  S   L  L+ H+ ++  +
Sbjct: 646 TAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNPLLMLQGHRNSVISV 705

Query: 168 WCDSDNWL-------ISTSKDGLIKVWDLKTQ 192
              +D+ L        + S D   ++W    Q
Sbjct: 706 AVANDHPLGPEYGVFATGSGDCKARIWKYSKQ 737

>CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some
           similarities with uniprot|P16649 Saccharomyces
           cerevisiae YCR084c TUP1
          Length = 836

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 80/340 (23%), Positives = 138/340 (40%), Gaps = 69/340 (20%)

Query: 393 IDISDDNALLATASNGELKIWNLNTKSCIRTFECGYALTCK------------------- 433
           +  S+D   LAT  N   +I+ ++    +  F    A T K                   
Sbjct: 497 VKFSNDGEFLATGCNKTTQIYRVSDGELVARFSDENAHTDKADGNDNAEAETSAGATTDL 556

Query: 434 ------FLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTG 487
                 F P G  +  G  +  ++++D+    ++  ++  HE  I+SLD    G +LV+G
Sbjct: 557 YIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKG-HEQDIYSLDYFPSGDKLVSG 615

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS-GDDKFLAISL 546
           S D++++ WD +  Q  +                 TL + D + ++ +S GD KF+A   
Sbjct: 616 SGDRTVRIWDLKTGQCTL-----------------TLSIEDGVTTVAVSPGDGKFIAAGS 658

Query: 547 LDNTVKVFFLDSMKFFLSL-------YGHKLPVLSLDISDDTKVIITSSADKNIKIWGL- 598
           LD  V+V+  D+      L        GHK  V S+  + D   +++ S D+++K+W L 
Sbjct: 659 LDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLR 718

Query: 599 -----------DFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQ 647
                        G C  +   H+D ++ V          S SKD  V +WD      + 
Sbjct: 719 NVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLL 778

Query: 648 KLAAHQSEVWALAVS------DNGERVVSVSHDHSIRIWE 681
            L  H++ V ++AV+       N     + S D   RIW+
Sbjct: 779 MLQGHRNSVISVAVNHGHPLGPNYHIFATGSGDCKARIWK 818

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 109/229 (47%), Gaps = 19/229 (8%)

Query: 468 HEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIA------GTSDKYVPQMNIVHD 521
           H   +  +  +NDG+ L TG  +K+ + +      EL+A        +DK     N   +
Sbjct: 490 HTSVVCCVKFSNDGEFLATG-CNKTTQIYRVS-DGELVARFSDENAHTDKADGNDNAEAE 547

Query: 522 STLELGDD--ILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISD 579
           ++     D  I S+  S D KFLA    D  ++++ ++  K  + L GH+  + SLD   
Sbjct: 548 TSAGATTDLYIRSVCFSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFP 607

Query: 580 DTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA-SKDGFVKYW 638
               +++ S D+ ++IW L  G C  +L + +D +  V   PG   F +A S D  V+ W
Sbjct: 608 SGDKLVSGSGDRTVRIWDLKTGQCTLTL-SIEDGVTTVAVSPGDGKFIAAGSLDRAVRVW 666

Query: 639 DGDKFECIQKL-------AAHQSEVWALAVSDNGERVVSVSHDHSIRIW 680
           D D    +++L         H+  V+++  + +G  VVS S D S+++W
Sbjct: 667 DSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLW 715

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 76/173 (43%), Gaps = 16/173 (9%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   +A G  D +I++WD+  K +++   GH+  I  L +  +G +L+SGS D  + 
Sbjct: 563 FSPDGKFLATGAEDKLIRIWDIEQKKIVMVLKGHEQDIYSLDYFPSGDKLVSGSGDRTVR 622

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST-SKDGLIKVWDLKTQQCIET------ 197
           +WDL +      L    G  T      D   I+  S D  ++VWD  T   +E       
Sbjct: 623 IWDLKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSDTGFLVERLDSENE 682

Query: 198 -HIAHTGECWALGIMTD--FVVTSSADSQLKIWQM------DLEGEPGSKLIE 241
               H    +++    D   VV+ S D  +K+W +      + +G+P S   E
Sbjct: 683 LGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCE 735

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/271 (21%), Positives = 116/271 (42%), Gaps = 61/271 (22%)

Query: 383 LQGSRTDVRSID-ISDDNALLATASNGELKIWNLNTKSCIRTFECGYALTCKFL-PG-GL 439
           L+G   D+ S+D     + L++ + +  ++IW+L T  C  T      +T   + PG G 
Sbjct: 593 LKGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGK 652

Query: 440 LVVVGTREGNLQLFDLASSVLLTTIEA------AHEGAIWSLDVTNDGKRLVTGSADKSI 493
            +  G+ +  ++++D  +  L+  +++       H+ +++S+  T DG  +V+GS D+S+
Sbjct: 653 FIAAGSLDRAVRVWDSDTGFLVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSV 712

Query: 494 KFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKV 553
           K W+ +                 N+ H+              + D K  +      T +V
Sbjct: 713 KLWNLR-----------------NVNHN--------------NADGKPTS-----GTCEV 736

Query: 554 FFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDS 613
            +           GHK  VLS+  ++D + I++ S D+ +  W    G+    L  H++S
Sbjct: 737 TYT----------GHKDFVLSVATTEDDEYILSGSKDRGVLFWDKVSGNPLLMLQGHRNS 786

Query: 614 IMCV------KFLPGSHNFFSASKDGFVKYW 638
           ++ V         P  H F + S D   + W
Sbjct: 787 VISVAVNHGHPLGPNYHIFATGSGDCKARIW 817

 Score = 40.0 bits (92), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 41/85 (48%), Gaps = 12/85 (14%)

Query: 92  IAAGYADGVIKLWDL------------VSKTVLLSFNGHKSRITMLKFDKTGTQLISGSE 139
           + +G  D  +KLW+L             S T  +++ GHK  +  +   +    ++SGS+
Sbjct: 703 VVSGSLDRSVKLWNLRNVNHNNADGKPTSGTCEVTYTGHKDFVLSVATTEDDEYILSGSK 762

Query: 140 DSNIIVWDLVSEVGLYKLRSHKGTI 164
           D  ++ WD VS   L  L+ H+ ++
Sbjct: 763 DRGVLFWDKVSGNPLLMLQGHRNSV 787

 Score = 35.8 bits (81), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 68/166 (40%), Gaps = 26/166 (15%)

Query: 37  GKVITGALEN--ISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           GK +    E+  I +WD++  ++  VL                 ++  L +      + +
Sbjct: 567 GKFLATGAEDKLIRIWDIEQKKIVMVLK------------GHEQDIYSLDYFPSGDKLVS 614

Query: 95  GYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGL 154
           G  D  +++WDL +    L+ +      T+      G  + +GS D  + VWD  S+ G 
Sbjct: 615 GSGDRTVRIWDLKTGQCTLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWD--SDTGF 672

Query: 155 YKLR---------SHKGTITGLWCDSD-NWLISTSKDGLIKVWDLK 190
              R          HK ++  +    D N ++S S D  +K+W+L+
Sbjct: 673 LVERLDSENELGTGHKDSVYSVVFTRDGNGVVSGSLDRSVKLWNLR 718

>KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {ON}
           Anc_8.544 YBR198C
          Length = 817

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/301 (21%), Positives = 128/301 (42%), Gaps = 40/301 (13%)

Query: 383 LQGSRTDVRSIDISDDNALLATA-SNGELKIWNLNTKSCIRTFECGYALTCKFLPGGLLV 441
              +  D+ S++ SDD+ L A    +  +K+W+L+  S I      Y             
Sbjct: 478 FHNTNRDMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSY------------- 524

Query: 442 VVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVK 501
               +   ++  D A+S L+      H G+++S   + D + L++GS DK+++ W     
Sbjct: 525 ----KRKEMETTDPATSTLI-----GHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTH 575

Query: 502 QELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKF 561
             L++     Y    + V D           +K S    + A +  D T +++  D +  
Sbjct: 576 TALVS-----YKGHNHPVWD-----------VKFSPLGHYFATASHDQTARLWSCDHIYP 619

Query: 562 FLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLP 621
                GH   V ++    +   + T S+DK  ++W +  GD  +  + H   I+     P
Sbjct: 620 LRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTP 679

Query: 622 GSHNFFSASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHDHSIRIW 680
                 + S DG +  WD    + I+++  H ++ V +L ++  G  ++S   DHS+R+W
Sbjct: 680 DGRWLCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVW 739

Query: 681 E 681
           +
Sbjct: 740 D 740

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 78/179 (43%), Gaps = 20/179 (11%)

Query: 529 DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFL-------------------SLYGHK 569
           D+ S++ S D +  A    D+ +K++ LD                         +L GH 
Sbjct: 484 DMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIGHS 543

Query: 570 LPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA 629
             V S   S D++ +++ S DK +++W LD      S   H   +  VKF P  H F +A
Sbjct: 544 GSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATA 603

Query: 630 SKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE-ETDDQV 687
           S D   + W  D    ++  A H S+V  ++   NG  V + S D + R+W+  T D V
Sbjct: 604 SHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSV 662

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 60/150 (40%), Gaps = 5/150 (3%)

Query: 92  IAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSE 151
            A    D   +LW       L  F GH S +  + F   G  + +GS D    +WD+ + 
Sbjct: 600 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTG 659

Query: 152 VGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHTGEC---WA 207
             +     H   I       D  WL + S DGLI +WD+ T + I+    H         
Sbjct: 660 DSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLT 719

Query: 208 LGIMTDFVVTSSADSQLKIWQM-DLEGEPG 236
           L    + +++  AD  +++W +     EPG
Sbjct: 720 LNKEGNVLLSGGADHSVRVWDLKKATNEPG 749

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 86/199 (43%), Gaps = 22/199 (11%)

Query: 47  ISVWDLKTSELEYVLSDGLPP-GSVDLKSSKPA---------EVSYLQFHSETGLIAAGY 96
           I +W L  S L   +S+ +P     +++++ PA          V    F  ++  + +G 
Sbjct: 506 IKLWSLDGSSL---ISNKIPSYKRKEMETTDPATSTLIGHSGSVYSTSFSPDSRFLLSGS 562

Query: 97  ADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYK 156
            D  ++LW L + T L+S+ GH   +  +KF   G    + S D    +W   S   +Y 
Sbjct: 563 EDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATASHDQTARLW---SCDHIYP 619

Query: 157 LRSHKGTITGL----WCDSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGIMT 212
           LR   G ++ +    +  +  ++ + S D   ++WD+ T   +     HT    +  +  
Sbjct: 620 LRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTP 679

Query: 213 D--FVVTSSADSQLKIWQM 229
           D  ++ T S D  + +W +
Sbjct: 680 DGRWLCTGSDDGLINLWDI 698

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 59/118 (50%), Gaps = 3/118 (2%)

Query: 385 GSRTDVRSIDISDDNALLATASNGE-LKIWNLNTKSCIRTF--ECGYALTCKFLPGGLLV 441
           G  +DV ++    +   + T S+ +  ++W+++T   +R F       L+    P G  +
Sbjct: 625 GHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWL 684

Query: 442 VVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQ 499
             G+ +G + L+D+ +   +  +    + A+ SL +  +G  L++G AD S++ WD +
Sbjct: 685 CTGSDDGLINLWDIGTGKRIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLK 742

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 79/183 (43%), Gaps = 23/183 (12%)

Query: 46  NISVWDLKTSELEYVLS-------------DGLPPGSVDLKSSKPAEVSYLQFHSETGLI 92
           N  VWD+K S L +  +             D + P  + + +   ++V  + FH     +
Sbjct: 585 NHPVWDVKFSPLGHYFATASHDQTARLWSCDHIYP--LRIFAGHLSDVDTVSFHPNGCYV 642

Query: 93  AAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEV 152
             G +D   ++WD+ +   +  F  H + I        G  L +GS+D  I +WD+ +  
Sbjct: 643 FTGSSDKTCRMWDISTGDSVRYFWVHTAPILSTVVTPDGRWLCTGSDDGLINLWDIGTGK 702

Query: 153 GLYKLRSH-KGTITGLWCDSD-NWLISTSKDGLIKVWDLKTQ------QCIETHIAHTGE 204
            + ++R H K  +  L  + + N L+S   D  ++VWDLK        +  +  I H G+
Sbjct: 703 RIKQMRGHGKNAVHSLTLNKEGNVLLSGGADHSVRVWDLKKATNEPGLEPEQPFIGHIGD 762

Query: 205 CWA 207
             A
Sbjct: 763 VTA 765

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/173 (19%), Positives = 68/173 (39%), Gaps = 22/173 (12%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVL-------------------LSFNGHK 119
           +++ L+F  ++ L AAG+ D  IKLW L   +++                    +  GH 
Sbjct: 484 DMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDPATSTLIGHS 543

Query: 120 SRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLIST 178
             +    F      L+SGSED  + +W L +   L   + H   +  + +    ++  + 
Sbjct: 544 GSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFSPLGHYFATA 603

Query: 179 SKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTD--FVVTSSADSQLKIWQM 229
           S D   ++W       +     H  +   +    +  +V T S+D   ++W +
Sbjct: 604 SHDQTARLWSCDHIYPLRIFAGHLSDVDTVSFHPNGCYVFTGSSDKTCRMWDI 656

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 58/141 (41%), Gaps = 22/141 (15%)

Query: 112 LLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDL------VSEVGLYK--------- 156
           + +F+     +T L+F        +G +DS I +W L       +++  YK         
Sbjct: 475 MYTFHNTNRDMTSLEFSDDSRLAAAGFQDSYIKLWSLDGSSLISNKIPSYKRKEMETTDP 534

Query: 157 ----LRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHTGECW--ALG 209
               L  H G++       D+ +L+S S+D  +++W L T   + ++  H    W     
Sbjct: 535 ATSTLIGHSGSVYSTSFSPDSRFLLSGSEDKTVRLWSLDTHTALVSYKGHNHPVWDVKFS 594

Query: 210 IMTDFVVTSSADSQLKIWQMD 230
            +  +  T+S D   ++W  D
Sbjct: 595 PLGHYFATASHDQTARLWSCD 615

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 127/284 (44%), Gaps = 48/284 (16%)

Query: 428 YALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTG 487
           Y  +  F P G  +  G  +  ++++DL +  ++ T++  HE  I+SLD    G +LV+G
Sbjct: 450 YIRSVCFSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQG-HEQDIYSLDYFPSGDKLVSG 508

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS-GDDKFLAISL 546
           S D++++ WD +  Q  +                 TL + D + ++ +S GD K +A   
Sbjct: 509 SGDRTVRIWDLRAGQCSL-----------------TLSIEDGVTTVAVSPGDGKLIAAGS 551

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSLDISDDTKVIITSSADKNIKIWG 597
           LD TV+++  DS   FL            GHK  V S+  + D   +++ S D+++K+W 
Sbjct: 552 LDRTVRIW--DSETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWN 609

Query: 598 L------------DFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFEC 645
           L            +      +   H+D ++ V          S SKD  V +WD      
Sbjct: 610 LRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSGNP 669

Query: 646 IQKLAAHQSEVWALAVSDN---GERV---VSVSHDHSIRIWEET 683
           +  L  H++ V ++AV+++   G       + S D   RIW+ T
Sbjct: 670 LLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYT 713

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 73/155 (47%), Gaps = 10/155 (6%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   +A G  D +I++WDL ++ ++++  GH+  I  L +  +G +L+SGS D  + 
Sbjct: 456 FSPDGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIYSLDYFPSGDKLVSGSGDRTVR 515

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST-SKDGLIKVWDLKTQQCIET------ 197
           +WDL +      L    G  T      D  LI+  S D  +++WD +T   +E       
Sbjct: 516 IWDLRAGQCSLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWDSETGFLVERLDSENE 575

Query: 198 -HIAHTGECWALGIMTD--FVVTSSADSQLKIWQM 229
               H    +++    D   VV+ S D  +K+W +
Sbjct: 576 LGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKLWNL 610

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 56/231 (24%), Positives = 97/231 (41%), Gaps = 49/231 (21%)

Query: 38  KVITGALEN-ISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDL+  +    LS  DG+   +V     K              LIAA
Sbjct: 504 KLVSGSGDRTVRIWDLRAGQCSLTLSIEDGVTTVAVSPGDGK--------------LIAA 549

Query: 95  GYADGVIKLWDLVSKTVLL-----SFN----GHKSRITMLKFDKTGTQLISGSEDSNIIV 145
           G  D  +++WD  S+T  L     S N    GHK  +  + F + G  ++SGS D ++ +
Sbjct: 550 GSLDRTVRIWD--SETGFLVERLDSENELGTGHKDSVYSVVFTRDGHGVVSGSLDRSVKL 607

Query: 146 WDLVSE-----VGLYKLRSHKGTITG--------LWCDSDNWLISTSKDGLIKVWDLKTQ 192
           W+L S       G     + + T TG            +D +++S SKD  +  WD  + 
Sbjct: 608 WNLRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDRGVLFWDTPSG 667

Query: 193 QCIETHIAHTGECWALGIMTDFVV--------TSSADSQLKIWQMDLEGEP 235
             +     H     ++ +  D  +        T S D + +IW+   + EP
Sbjct: 668 NPLLMLQGHRNSVISVAVANDHPLGPEYGVFATGSGDCKARIWKYTKKSEP 718

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 70/154 (45%), Gaps = 21/154 (13%)

Query: 37  GKVIT-GALEN-ISVWDLKTSEL-EYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIA 93
           GK+I  G+L+  + +WD +T  L E + S+       +L +     V  + F  +   + 
Sbjct: 544 GKLIAAGSLDRTVRIWDSETGFLVERLDSEN------ELGTGHKDSVYSVVFTRDGHGVV 597

Query: 94  AGYADGVIKLWDLVSK------------TVLLSFNGHKSRITMLKFDKTGTQLISGSEDS 141
           +G  D  +KLW+L S                +++ GHK  +  +   +    ++SGS+D 
Sbjct: 598 SGSLDRSVKLWNLRSANGGSTEGKANTAASEVTYTGHKDFVLSVATTQNDEFILSGSKDR 657

Query: 142 NIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWL 175
            ++ WD  S   L  L+ H+ ++  +   +D+ L
Sbjct: 658 GVLFWDTPSGNPLLMLQGHRNSVISVAVANDHPL 691

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 84/175 (48%), Gaps = 14/175 (8%)

Query: 529 DILSIKISGDDKFLAISLLDNTVKVFFLDSMKF-------------FLSLYGHKLPVLSL 575
           D+ S++ S D + +A    D+ +K++ LD                   +L GH  PV S+
Sbjct: 474 DMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLIGHSGPVYSV 533

Query: 576 DISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFV 635
             S D + ++++S DK +++W LD   C  S   H   +  VKF P  H F + S D   
Sbjct: 534 SFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQTA 593

Query: 636 KYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE-ETDDQVFL 689
           + W  D    ++  A H ++V  +A   NG  V++ S D + R+W+ +T D V L
Sbjct: 594 RLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRL 648

 Score = 79.0 bits (193), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 67/294 (22%), Positives = 125/294 (42%), Gaps = 34/294 (11%)

Query: 406 SNGELKIWNLNTKS---CIRTFECGY--ALTCKFLPGGLLVVVGTREGNLQLFDLASSVL 460
           S   +K+ NL T +   C+ TF        + +F     LV  G ++ +++++ L  + L
Sbjct: 447 SRDAIKLDNLQTSAPSVCMYTFHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPL 506

Query: 461 L------------TTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGT 508
                        TT    H G ++S+  + D + LV+ S DK+++ W       L++  
Sbjct: 507 ESKLPSKSKEASNTTTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVS-- 564

Query: 509 SDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGH 568
              Y    + V D           +K S    + A    D T +++  D +       GH
Sbjct: 565 ---YKGHNHPVWD-----------VKFSPLGHYFATVSHDQTARLWSCDHIYPLRIFAGH 610

Query: 569 KLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFS 628
              V  +    +   ++T S+DK  ++W +  GD  +    H  S++ V   P      +
Sbjct: 611 LNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTT 670

Query: 629 ASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHDHSIRIWE 681
            S+DG +  WD    + I+++  H +S V +L+ +  G  +VS   D S+R+W+
Sbjct: 671 GSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWD 724

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 64/130 (49%), Gaps = 5/130 (3%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           +V  + FH     +  G +D   ++WD+ +   +  F GH + +  +     G  L +GS
Sbjct: 613 DVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGS 672

Query: 139 EDSNIIVWDLVSEVGLYKLRSH-KGTITGLWCDSD-NWLISTSKDGLIKVWDLK---TQQ 193
           ED  IIVWD+ +   + ++R H K  +  L  + + N L+S   D  ++VWDLK    + 
Sbjct: 673 EDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLKKFTNEP 732

Query: 194 CIETHIAHTG 203
            +E    ++G
Sbjct: 733 ALEPEQPYSG 742

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 114/241 (47%), Gaps = 24/241 (9%)

Query: 363 VPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGE-LKIWNLNTKSCI 421
            P E + P S +   ++T  L G    V S+  S DN  L +AS  + +++W+L+T +C+
Sbjct: 504 TPLESKLP-SKSKEASNTTTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCL 562

Query: 422 RTFECGYALTC---KFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVT 478
            +++ G+       KF P G      + +   +L+     +    I A H   +  +   
Sbjct: 563 VSYK-GHNHPVWDVKFSPLGHYFATVSHDQTARLWS-CDHIYPLRIFAGHLNDVDCVAFH 620

Query: 479 NDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGD 538
            +G  ++TGS+DK+ + WD Q    +          ++ + H ++      ++S+ +S D
Sbjct: 621 PNGTYVLTGSSDKTCRMWDIQTGDSV----------RLFLGHTAS------VVSVAVSPD 664

Query: 539 DKFLAISLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSLDISDDTKVIITSSADKNIKIWG 597
            ++L     D  + V+ + + K    + GH K  V SL  + +  ++++  AD+++++W 
Sbjct: 665 GRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWD 724

Query: 598 L 598
           L
Sbjct: 725 L 725

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 71/168 (42%), Gaps = 11/168 (6%)

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKL 157
           D   +LW       L  F GH + +  + F   GT +++GS D    +WD+ +   +   
Sbjct: 590 DQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLF 649

Query: 158 RSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHTGEC---WALGIMTD 213
             H  ++  +    D  WL + S+DG+I VWD+ T + I+    H        +     +
Sbjct: 650 LGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVNSLSFNKEGN 709

Query: 214 FVVTSSADSQLKIWQMDLEGEPGSKLIEKGAFEKQSKQRGLSIEFTTT 261
            +V+  AD  +++W +        K   + A E +    G S +  T+
Sbjct: 710 ILVSGGADQSVRVWDL-------KKFTNEPALEPEQPYSGYSGDMETS 750

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/313 (20%), Positives = 127/313 (40%), Gaps = 34/313 (10%)

Query: 46  NISVWDLKTSELEYVLSDGLPPGSVDLKSS-----KPAEVSYLQFHSETGLIAAGYADGV 100
           +I +W L  + LE      LP  S +  ++         V  + F  +   + +   D  
Sbjct: 495 HIKIWSLDGTPLE----SKLPSKSKEASNTTTLIGHSGPVYSVSFSPDNRYLVSASEDKT 550

Query: 101 IKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSH 160
           ++LW L + T L+S+ GH   +  +KF   G    + S D    +W   S   +Y LR  
Sbjct: 551 VRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQTARLW---SCDHIYPLRIF 607

Query: 161 KGTITGLWC----DSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTD--F 214
            G +  + C     +  ++++ S D   ++WD++T   +   + HT    ++ +  D  +
Sbjct: 608 AGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRW 667

Query: 215 VVTSSADSQLKIWQMDLEGEPGSKLIEKGAFEKQSKQRGLSI--EFTTTSDGVHFFYVQN 272
           + T S D  + +W            I  G   KQ +  G S     +   +G +      
Sbjct: 668 LTTGSEDGVIIVWD-----------IGTGKRIKQMRGHGKSAVNSLSFNKEG-NILVSGG 715

Query: 273 ADKTVEIFRLRKDIEIAKAIKRREKRLTEKGMTEEDIKTNISESYVSFVMHPFQ-VVRSM 331
           AD++V ++ L+K      A++  +      G  E  +  ++ E      + P Q +V S 
Sbjct: 716 ADQSVRVWDLKK-FTNEPALEPEQPYSGYSGDMETSVNQDVKEYGRRRTVFPTQDLVASF 774

Query: 332 YKIKSVAWTLSLS 344
           +  K+  +T+  +
Sbjct: 775 HTKKTPIYTVKFT 787

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 69/169 (40%), Gaps = 20/169 (11%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDL---------------VSKTVLLSFNGHKSRIT 123
           +++ LQF  ++ L+AAG+ D  IK+W L                S T  L   GH   + 
Sbjct: 474 DMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLI--GHSGPVY 531

Query: 124 MLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDG 182
            + F      L+S SED  + +W L +   L   + H   +  + +    ++  + S D 
Sbjct: 532 SVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYFATVSHDQ 591

Query: 183 LIKVWDLKTQQCIETHIAHTG--ECWALGIMTDFVVTSSADSQLKIWQM 229
             ++W       +     H    +C A      +V+T S+D   ++W +
Sbjct: 592 TARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGSSDKTCRMWDI 640

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 58/135 (42%), Gaps = 16/135 (11%)

Query: 112 LLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRS------------ 159
           + +F+     +T L+F +    + +G +DS+I +W L       KL S            
Sbjct: 465 MYTFHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTTLI 524

Query: 160 -HKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHTGECW--ALGIMTDFV 215
            H G +  +    DN +L+S S+D  +++W L T  C+ ++  H    W      +  + 
Sbjct: 525 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLGHYF 584

Query: 216 VTSSADSQLKIWQMD 230
            T S D   ++W  D
Sbjct: 585 ATVSHDQTARLWSCD 599

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 51/101 (50%), Gaps = 2/101 (1%)

Query: 401 LLATASNGELKIWNLNTKSCIRTF--ECGYALTCKFLPGGLLVVVGTREGNLQLFDLASS 458
           +L  +S+   ++W++ T   +R F       ++    P G  +  G+ +G + ++D+ + 
Sbjct: 626 VLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTG 685

Query: 459 VLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQ 499
             +  +    + A+ SL    +G  LV+G AD+S++ WD +
Sbjct: 686 KRIKQMRGHGKSAVNSLSFNKEGNILVSGGADQSVRVWDLK 726

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 128/294 (43%), Gaps = 34/294 (11%)

Query: 406 SNGELKIWNLNTKS---CIRTFE-CGYALTC-KFLPGGLLVVVGTREGNLQLFDLASSVL 460
           S   +K+ NL T +   C+ TF      +TC +F     LV  G ++  ++L+ L  + L
Sbjct: 462 SRDAIKMDNLQTSAPSVCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPL 521

Query: 461 LTTIEA------------AHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGT 508
            + + +             H G ++S+  + D + LV+ S DK+++ W       L++  
Sbjct: 522 ESQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVS-- 579

Query: 509 SDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGH 568
              Y    + V D           +K S    + A    D T +++  D +       GH
Sbjct: 580 ---YKGHNHPVWD-----------VKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGH 625

Query: 569 KLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFS 628
              V  +    +   ++T S+DK  ++W +  GD  +    H  S++ V   P      +
Sbjct: 626 LNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTT 685

Query: 629 ASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHDHSIRIWE 681
            S+DG +  WD    + I+++  H +S V++L+ +  G  +VS   D S+R+W+
Sbjct: 686 GSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWD 739

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 87/188 (46%), Gaps = 18/188 (9%)

Query: 516 MNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKF-------------F 562
           M   H++  E+      ++ S D + +A    D+ +K++ LD                  
Sbjct: 480 MYTFHNTNREM----TCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNT 535

Query: 563 LSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPG 622
           ++L GH  PV S+  S D + ++++S DK +++W LD   C  S   H   +  VKF P 
Sbjct: 536 VTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPL 595

Query: 623 SHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE- 681
            H F + S D   + W  D    ++  A H ++V  +    NG  V++ S D + R+W+ 
Sbjct: 596 GHYFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDI 655

Query: 682 ETDDQVFL 689
           +T D V L
Sbjct: 656 QTGDSVRL 663

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 110/226 (48%), Gaps = 23/226 (10%)

Query: 378 AHTIELQGSRTDVRSIDISDDNALLATASNGE-LKIWNLNTKSCIRTFECGYALTC---K 433
           ++T+ L G    V S+  S DN  L +AS  + +++W+L+T +C+ +++ G+       K
Sbjct: 533 SNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYK-GHNHPVWDVK 591

Query: 434 FLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSI 493
           F P G     G+ +   +L+     +    I A H   +  +    +G  ++TGS+DK+ 
Sbjct: 592 FSPLGHYFATGSHDQTARLWS-CDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTC 650

Query: 494 KFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKV 553
           + WD Q    +          ++ + H ++      ++S+ +S D ++L     D  + V
Sbjct: 651 RMWDIQTGDSV----------RLFLGHTAS------VVSVAVSPDGRWLTTGSEDGVIIV 694

Query: 554 FFLDSMKFFLSLYGH-KLPVLSLDISDDTKVIITSSADKNIKIWGL 598
           + + + K    + GH K  V SL  + +  ++++  AD+++++W L
Sbjct: 695 WDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDL 740

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 73/158 (46%), Gaps = 13/158 (8%)

Query: 46  NISVWDLKTSELEYVLSDGLPPGSVDLKSSK---P--------AEVSYLQFHSETGLIAA 94
           N  VWD+K S L +  + G    +  L S     P         +V  + FH     +  
Sbjct: 584 NHPVWDVKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLT 643

Query: 95  GYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGL 154
           G +D   ++WD+ +   +  F GH + +  +     G  L +GSED  IIVWD+ +   +
Sbjct: 644 GSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRI 703

Query: 155 YKLRSH-KGTITGLWCDSD-NWLISTSKDGLIKVWDLK 190
            ++R H K  +  L  + + N L+S   D  ++VWDLK
Sbjct: 704 KQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 105/250 (42%), Gaps = 30/250 (12%)

Query: 47  ISVWDLKTSELEYVLSDGLPPGSVDLKSS-----KPAEVSYLQFHSETGLIAAGYADGVI 101
           I +W L  + LE      LP  + D  ++         V  + F  +   + +   D  +
Sbjct: 511 IKLWSLDGTPLE----SQLPSKAKDASNTVTLIGHSGPVYSVSFSPDNRYLVSASEDKTV 566

Query: 102 KLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHK 161
           +LW L + T L+S+ GH   +  +KF   G    +GS D    +W   S   +Y LR   
Sbjct: 567 RLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYFATGSHDQTARLW---SCDHIYPLRIFA 623

Query: 162 GTITGLWC----DSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTD--FV 215
           G +  + C     +  ++++ S D   ++WD++T   +   + HT    ++ +  D  ++
Sbjct: 624 GHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWL 683

Query: 216 VTSSADSQLKIWQMDLEGEPGSKLIEKGAFEKQSKQRGLSIEFTTTSDGVHFFYVQ-NAD 274
            T S D  + +W            I  G   KQ +  G S  ++ + +      V   AD
Sbjct: 684 TTGSEDGVIIVWD-----------IGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGAD 732

Query: 275 KTVEIFRLRK 284
           ++V ++ L+K
Sbjct: 733 QSVRVWDLKK 742

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 52/101 (51%), Gaps = 2/101 (1%)

Query: 401 LLATASNGELKIWNLNTKSCIRTF--ECGYALTCKFLPGGLLVVVGTREGNLQLFDLASS 458
           +L  +S+   ++W++ T   +R F       ++    P G  +  G+ +G + ++D+ + 
Sbjct: 641 VLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTG 700

Query: 459 VLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQ 499
             +  +    + A++SL    +G  LV+G AD+S++ WD +
Sbjct: 701 KRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVRVWDLK 741

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 31/135 (22%), Positives = 56/135 (41%), Gaps = 16/135 (11%)

Query: 112 LLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRS------------ 159
           + +F+     +T L+F      + +G +DS I +W L       +L S            
Sbjct: 480 MYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLI 539

Query: 160 -HKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHTGECW--ALGIMTDFV 215
            H G +  +    DN +L+S S+D  +++W L T  C+ ++  H    W      +  + 
Sbjct: 540 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYF 599

Query: 216 VTSSADSQLKIWQMD 230
            T S D   ++W  D
Sbjct: 600 ATGSHDQTARLWSCD 614

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/309 (25%), Positives = 136/309 (44%), Gaps = 26/309 (8%)

Query: 382 ELQGSR----TDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYALT---CK 433
           EL GS+      V  + IS D++++AT S  G+LKI +  T   I+ F+  +        
Sbjct: 173 ELSGSQLVSSRPVSQVAISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVD 232

Query: 434 FLPGGLLVVVGTREGNLQLFDLAS-SVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKS 492
           + P G  +V G   G +++++L + S         HE  +  +     GK + + S D +
Sbjct: 233 WNPDGTALVTGAANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMT 292

Query: 493 IKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVK 552
            + WD + + EL          Q+   H        ++  +    D   L  + LD+   
Sbjct: 293 WRLWDVEKQIEL----------QLQEGH------AKEVYCVAFQKDGSLLCSTGLDSVGL 336

Query: 553 VFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQD 612
           V+ L S K  ++L GH  P+  LD S +   I T SAD  I++W +       +L AH  
Sbjct: 337 VWDLRSGKSIMALEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNS 396

Query: 613 SIMCVKF-LPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSV 671
            +  VKF     H   S+S D  +  + GD +  +  +  H  ++ ++ +S +G  + S 
Sbjct: 397 IVSEVKFDKANGHYLVSSSYDKTLNIYSGDNWTKLSVIQGHTDKILSVDISTDGSHLFSS 456

Query: 672 SHDHSIRIW 680
             D S++ W
Sbjct: 457 GWDRSLKQW 465

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/236 (27%), Positives = 104/236 (44%), Gaps = 27/236 (11%)

Query: 39  VITGALEN-ISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYA 97
           ++TGA    I +W+L             P G++    ++ A V   +FH     +A+   
Sbjct: 240 LVTGAANGEIRIWNLNNDSES-------PAGTLTGHENRVARV---RFHPSGKYVASASF 289

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKL 157
           D   +LWD+  +  L    GH   +  + F K G+ L S   DS  +VWDL S   +  L
Sbjct: 290 DMTWRLWDVEKQIELQLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMAL 349

Query: 158 RSHKGTITGL-WCDSDNWLISTSKDGLIKVWDLKTQQCIETHIAHT---GECWALGIMTD 213
             H   I GL W  +   + + S DG I++WD++    +    AH     E         
Sbjct: 350 EGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKANGH 409

Query: 214 FVVTSSADSQLKIWQMDLEGEPGSKL-IEKGAFEKQSKQRGLSIEFTTTSDGVHFF 268
           ++V+SS D  L I+     G+  +KL + +G  +K      LS++ +T  DG H F
Sbjct: 410 YLVSSSYDKTLNIYS----GDNWTKLSVIQGHTDKI-----LSVDIST--DGSHLF 454

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 96/248 (38%), Gaps = 62/248 (25%)

Query: 397 DDNALLATASNGELKIWNLNTKS----CIRTFECGYALTCKFLPGGLLVVVGTREGNLQL 452
           D  AL+  A+NGE++IWNLN  S       T         +F P G  V   + +   +L
Sbjct: 236 DGTALVTGAANGEIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRL 295

Query: 453 FDLASSVLLTTIEA-----------------------------------------AHEGA 471
           +D+   + L   E                                           H   
Sbjct: 296 WDVEKQIELQLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDLRSGKSIMALEGHIKP 355

Query: 472 IWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDIL 531
           I+ LD + +G  + TGSAD +I+ WD  V++  I G     +P  N +          + 
Sbjct: 356 IYGLDWSPNGYDIATGSADGTIRLWD--VRKVGILGA----LPAHNSI----------VS 399

Query: 532 SIKI-SGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSAD 590
            +K    +  +L  S  D T+ ++  D+      + GH   +LS+DIS D   + +S  D
Sbjct: 400 EVKFDKANGHYLVSSSYDKTLNIYSGDNWTKLSVIQGHTDKILSVDISTDGSHLFSSGWD 459

Query: 591 KNIKIWGL 598
           +++K W L
Sbjct: 460 RSLKQWSL 467

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 68/152 (44%), Gaps = 3/152 (1%)

Query: 533 IKISGDDKFLAISLLDNTVKVFFLDSMKFFLSL-YGHKLPVLSLDISDDTKVIITSSADK 591
           + IS DD  +A       +K+   ++++   +    H   +  +D + D   ++T +A+ 
Sbjct: 188 VAISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPDGTALVTGAANG 247

Query: 592 NIKIWGL--DFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKL 649
            I+IW L  D      +L  H++ +  V+F P      SAS D   + WD +K   +Q  
Sbjct: 248 EIRIWNLNNDSESPAGTLTGHENRVARVRFHPSGKYVASASFDMTWRLWDVEKQIELQLQ 307

Query: 650 AAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
             H  EV+ +A   +G  + S   D    +W+
Sbjct: 308 EGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWD 339

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 80/169 (47%), Gaps = 18/169 (10%)

Query: 72  LKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFN-GHKSRITMLKFDKT 130
           L SS+P  VS +   S+  ++A     G +K+    +  ++ +F+  H S+I  + ++  
Sbjct: 179 LVSSRP--VSQVAISSDDSMVATCSWGGDLKILSTETLEIIKAFDTAHDSKIGGVDWNPD 236

Query: 131 GTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITG--------LWCDSDNWLISTSKDG 182
           GT L++G+ +  I +W+L ++       S  GT+TG         +  S  ++ S S D 
Sbjct: 237 GTALVTGAANGEIRIWNLNNDS-----ESPAGTLTGHENRVARVRFHPSGKYVASASFDM 291

Query: 183 LIKVWDLKTQQCIETHIAHTGECWALGIMTD--FVVTSSADSQLKIWQM 229
             ++WD++ Q  ++    H  E + +    D   + ++  DS   +W +
Sbjct: 292 TWRLWDVEKQIELQLQEGHAKEVYCVAFQKDGSLLCSTGLDSVGLVWDL 340

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 58/124 (46%), Gaps = 5/124 (4%)

Query: 381 IELQGSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYALT--CKF-LP 436
           + L+G    +  +D S +   +AT S +G +++W++     +       ++    KF   
Sbjct: 347 MALEGHIKPIYGLDWSPNGYDIATGSADGTIRLWDVRKVGILGALPAHNSIVSEVKFDKA 406

Query: 437 GGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFW 496
            G  +V  + +  L ++   +   L+ I+  H   I S+D++ DG  L +   D+S+K W
Sbjct: 407 NGHYLVSSSYDKTLNIYSGDNWTKLSVIQG-HTDKILSVDISTDGSHLFSSGWDRSLKQW 465

Query: 497 DFQV 500
             ++
Sbjct: 466 SLKI 469

>KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {ON}
           Anc_6.363 YCR084C
          Length = 665

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 135/323 (41%), Gaps = 56/323 (17%)

Query: 395 ISDDNALLATASNGELKIWNLNTKSCIRTFECG------YALTCKFLPGGLLVVVGTREG 448
           +SDDNA  A +SN   +    N                 Y  +  F P G  +  G  + 
Sbjct: 346 LSDDNANSAVSSNNNDQNAPANVNGANANSGNNTNSNDLYIRSVCFSPDGKFLATGAEDK 405

Query: 449 NLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGT 508
            ++++D+    ++  ++  H+  ++SLD    G +LV+GS D++++ WD +  Q  +   
Sbjct: 406 LIRIWDIQQRKIVMVLQG-HDQDVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSL--- 461

Query: 509 SDKYVPQMNIVHDSTLELGDDILSIKIS-GDDKFLAISLLDNTVKVFFLDSMKFFLSLY- 566
                         TL + D + ++ +S GD KF+A   LD  V+V+  DS   FL    
Sbjct: 462 --------------TLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVW--DSETGFLVERL 505

Query: 567 --------GHKLPVLSLDISDDTKVIITSSADKNIKIWGL--------------DFGDCH 604
                   GHK  V S+  + D   +++ S D+++K+W L                  C 
Sbjct: 506 DSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNLRDNNANSSSNNSNKSNATCD 565

Query: 605 KSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDN 664
            +   H+D ++ V          S SKD  V +WD      +  L  H++ V ++AV++ 
Sbjct: 566 VTYVGHKDFVLSVTTTANDEYILSGSKDRGVLFWDTKSGNPLLMLQGHRNSVISVAVANR 625

Query: 665 G------ERVVSVSHDHSIRIWE 681
                  +   + S D   RIW+
Sbjct: 626 TPLGPKYQVFATGSGDCRARIWK 648

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 106/242 (43%), Gaps = 27/242 (11%)

Query: 468 HEGAIWSLDVTNDGKRLVTGSADKS-----------IKFWDFQVKQELIAGTSDKYVPQM 516
           H   +  +  +NDG+ L TG    S            K  D      + +  +D+  P  
Sbjct: 308 HSSVVCCVKFSNDGEYLATGCNKTSQIYKVSTGELIAKLSDDNANSAVSSNNNDQNAP-A 366

Query: 517 NIVHDSTLEL----GDD--ILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKL 570
           N+   +         +D  I S+  S D KFLA    D  ++++ +   K  + L GH  
Sbjct: 367 NVNGANANSGNNTNSNDLYIRSVCFSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQ 426

Query: 571 PVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA- 629
            V SLD       +++ S D+ ++IW L  G C  +L + +D +  V   PG   F +A 
Sbjct: 427 DVYSLDYFPSGDKLVSGSGDRTVRIWDLKTGQCSLTL-SIEDGVTTVAVSPGDGKFIAAG 485

Query: 630 SKDGFVKYWDGDKFECIQKL-------AAHQSEVWALAVSDNGERVVSVSHDHSIRIWEE 682
           S D  V+ WD +    +++L         H+  V+++  + +G +VVS S D S+++W  
Sbjct: 486 SLDRAVRVWDSETGFLVERLDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNL 545

Query: 683 TD 684
            D
Sbjct: 546 RD 547

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 69/155 (44%), Gaps = 10/155 (6%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   +A G  D +I++WD+  + +++   GH   +  L +  +G +L+SGS D  + 
Sbjct: 391 FSPDGKFLATGAEDKLIRIWDIQQRKIVMVLQGHDQDVYSLDYFPSGDKLVSGSGDRTVR 450

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST-SKDGLIKVWDLKTQQCIET------ 197
           +WDL +      L    G  T      D   I+  S D  ++VWD +T   +E       
Sbjct: 451 IWDLKTGQCSLTLSIEDGVTTVAVSPGDGKFIAAGSLDRAVRVWDSETGFLVERLDSENE 510

Query: 198 -HIAHTGECWALGIMTDF--VVTSSADSQLKIWQM 229
               H    +++    D   VV+ S D  +K+W +
Sbjct: 511 LGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKLWNL 545

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 58/233 (24%), Positives = 95/233 (40%), Gaps = 63/233 (27%)

Query: 38  KVITGALE-NISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDLKT +    LS  DG+   +V     K               IAA
Sbjct: 439 KLVSGSGDRTVRIWDLKTGQCSLTLSIEDGVTTVAVSPGDGK--------------FIAA 484

Query: 95  GYADGVIKLWD-----LVSKTVLLSFN----GHKSRITMLKFDKTGTQLISGSEDSNIIV 145
           G  D  +++WD     LV +  L S N    GHK  +  + F K G +++SGS D ++ +
Sbjct: 485 GSLDRAVRVWDSETGFLVER--LDSENELGTGHKDSVYSVVFTKDGNKVVSGSLDRSVKL 542

Query: 146 WDL--------------------VSEVGLYKLRSHKGTITGLWCDS-DNWLISTSKDGLI 184
           W+L                    V+ VG      HK  +  +   + D +++S SKD  +
Sbjct: 543 WNLRDNNANSSSNNSNKSNATCDVTYVG------HKDFVLSVTTTANDEYILSGSKDRGV 596

Query: 185 KVWDLKTQQCIETHIAHTGECWA--------LGIMTDFVVTSSADSQLKIWQM 229
             WD K+   +     H     +        LG       T S D + +IW+ 
Sbjct: 597 LFWDTKSGNPLLMLQGHRNSVISVAVANRTPLGPKYQVFATGSGDCRARIWKF 649

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score = 83.6 bits (205), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/252 (23%), Positives = 119/252 (47%), Gaps = 17/252 (6%)

Query: 371 TSPTPIKAHTIELQGSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYA 429
           T+P P+ +     +G R +V S+   +DN  + T+S +G +K+W++ + S  RT++    
Sbjct: 63  TNPNPVAS----FEGHRGNVTSLSFQNDNRWMVTSSEDGTIKVWDVRSPSVPRTYKHNAP 118

Query: 430 LT-CKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGS 488
           +      P    ++   R+GN++++DL  +     +    +  + SL +  DG  LV  +
Sbjct: 119 VNEVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPVQSLSLATDGSMLVAAN 178

Query: 489 ADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLD 548
           +  +   W+   + +    ++ K V +    HD+       I  I +S D KFLA    D
Sbjct: 179 SKGNCYVWEMPNRTD---ASNLKPVTKFR-AHDAY------ITRILLSSDVKFLATCSAD 228

Query: 549 NTVKVFFLD-SMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSL 607
           +T +++ +D +     +L GH+  V     S D+  +IT+S+D  +++W L   +  +  
Sbjct: 229 HTARIWSIDDNFNLHTTLDGHQRWVWDCAFSADSAYLITASSDHYVRLWDLSTREIVRQY 288

Query: 608 FAHQDSIMCVKF 619
             H    +CV  
Sbjct: 289 SGHHKGAVCVAL 300

 Score = 72.4 bits (176), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 63/292 (21%), Positives = 124/292 (42%), Gaps = 28/292 (9%)

Query: 383 LQGSRTDVRSIDISDDNALLATASNGELKIWNLNT--KSCIRTFEC--GYALTCKFLPGG 438
           +Q S + V  + I++D  LLA A +  +K++++NT   + + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLTITNDKKLLAAAGHQNVKLYDINTTNPNPVASFEGHRGNVTSLSFQNDN 87

Query: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
             +V  + +G ++++D+ S  +  T +  H   +  + +  +   L++   D +I+ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSVPRTYK--HNAPVNEVAIHPNQGELISCDRDGNIRIWDL 145

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFL-- 556
              Q                 H  T E    + S+ ++ D   L  +       V+ +  
Sbjct: 146 GENQ---------------CTHQLTPEDDTPVQSLSLATDGSMLVAANSKGNCYVWEMPN 190

Query: 557 ----DSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFG-DCHKSLFAHQ 611
                ++K       H   +  + +S D K + T SAD   +IW +D   + H +L  HQ
Sbjct: 191 RTDASNLKPVTKFRAHDAYITRILLSSDVKFLATCSADHTARIWSIDDNFNLHTTLDGHQ 250

Query: 612 DSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD 663
             +    F   S    +AS D +V+ WD    E +++ + H      +A++D
Sbjct: 251 RWVWDCAFSADSAYLITASSDHYVRLWDLSTREIVRQYSGHHKGAVCVALND 302

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 89/213 (41%), Gaps = 14/213 (6%)

Query: 91  LIAAGYADGVIKLWDL--VSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDL 148
           L AAG+ +  +KL+D+   +   + SF GH+  +T L F      +++ SED  I VWD+
Sbjct: 47  LAAAGHQN--VKLYDINTTNPNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKVWDV 104

Query: 149 VSEVGLYKLRSHKGTITGLWCDSDNW-LISTSKDGLIKVWDLKTQQCIETHIAHTG-ECW 206
            S   + +   H   +  +    +   LIS  +DG I++WDL   QC             
Sbjct: 105 RSP-SVPRTYKHNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPVQ 163

Query: 207 ALGIMTD--FVVTSSADSQLKIWQMDLEGEPGSKLIEKGAFEKQSKQRGLSIEFTTTSDG 264
           +L + TD   +V +++     +W+M    +  S L     F          I     S  
Sbjct: 164 SLSLATDGSMLVAANSKGNCYVWEMPNRTD-ASNLKPVTKFRAHDAY----ITRILLSSD 218

Query: 265 VHFFYVQNADKTVEIFRLRKDIEIAKAIKRREK 297
           V F    +AD T  I+ +  +  +   +   ++
Sbjct: 219 VKFLATCSADHTARIWSIDDNFNLHTTLDGHQR 251

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 50/254 (19%), Positives = 107/254 (42%), Gaps = 24/254 (9%)

Query: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
           +++V    +  ++ ++  + V   TI+ + +  +  L +TND K+L+  +  +++K +D 
Sbjct: 3   VILVSAGYDHTIRFWEALTGVCSRTIQHS-DSQVNRLTITND-KKLLAAAGHQNVKLYDI 60

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558
                    + + +                ++ S+    D++++  S  D T+KV+ + S
Sbjct: 61  NTTNPNPVASFEGH--------------RGNVTSLSFQNDNRWMVTSSEDGTIKVWDVRS 106

Query: 559 MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDS-IMCV 617
                + Y H  PV  + I  +   +I+   D NI+IW L    C   L    D+ +  +
Sbjct: 107 PSVPRT-YKHNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPVQSL 165

Query: 618 KFLPGSHNFFSASKDGFVKYW------DGDKFECIQKLAAHQSEVWALAVSDNGERVVSV 671
                     +A+  G    W      D    + + K  AH + +  + +S + + + + 
Sbjct: 166 SLATDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDVKFLATC 225

Query: 672 SHDHSIRIWEETDD 685
           S DH+ RIW   D+
Sbjct: 226 SADHTARIWSIDDN 239

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 84/196 (42%), Gaps = 21/196 (10%)

Query: 45  ENISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLW 104
           +N+ ++D+ T+           P  V         V+ L F ++   +     DG IK+W
Sbjct: 53  QNVKLYDINTTN----------PNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKVW 102

Query: 105 DLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGT- 163
           D+ S +V  ++  H + +  +       +LIS   D NI +WDL      ++L     T 
Sbjct: 103 DVRSPSVPRTYK-HNAPVNEVAIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTP 161

Query: 164 ITGLWCDSD-NWLISTSKDGLIKVWDLKTQ------QCIETHIAHTGECWALGIMTD--F 214
           +  L   +D + L++ +  G   VW++  +      + +    AH      + + +D  F
Sbjct: 162 VQSLSLATDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRAHDAYITRILLSSDVKF 221

Query: 215 VVTSSADSQLKIWQMD 230
           + T SAD   +IW +D
Sbjct: 222 LATCSADHTARIWSID 237

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 55/142 (38%), Gaps = 47/142 (33%)

Query: 134 LISGSEDSNIIVWDLVS--------------------------------EVGLYKLRS-- 159
           L+S   D  I  W+ ++                                 V LY + +  
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLTITNDKKLLAAAGHQNVKLYDINTTN 64

Query: 160 ---------HKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIET--HIAHTGECWA 207
                    H+G +T L   +DN W++++S+DG IKVWD+++     T  H A   E  A
Sbjct: 65  PNPVASFEGHRGNVTSLSFQNDNRWMVTSSEDGTIKVWDVRSPSVPRTYKHNAPVNEV-A 123

Query: 208 LGIMTDFVVTSSADSQLKIWQM 229
           +      +++   D  ++IW +
Sbjct: 124 IHPNQGELISCDRDGNIRIWDL 145

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 44/108 (40%), Gaps = 10/108 (9%)

Query: 67  PGSVDLKSSKP--------AEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVL-LSFNG 117
           P   D  + KP        A ++ +   S+   +A   AD   ++W +     L  + +G
Sbjct: 189 PNRTDASNLKPVTKFRAHDAYITRILLSSDVKFLATCSADHTARIWSIDDNFNLHTTLDG 248

Query: 118 HKSRITMLKFDKTGTQLISGSEDSNIIVWDLVS-EVGLYKLRSHKGTI 164
           H+  +    F      LI+ S D  + +WDL + E+       HKG +
Sbjct: 249 HQRWVWDCAFSADSAYLITASSDHYVRLWDLSTREIVRQYSGHHKGAV 296

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 127/301 (42%), Gaps = 39/301 (12%)

Query: 383 LQGSRTDVRSIDISDDNALLATA-SNGELKIWNLNTKSCIRTFECGYALTCKFLPGGLLV 441
              +  D+  ++ SDD  L AT   +  +KIW+L+          G +L    LP     
Sbjct: 475 FHNTNKDMSCLEFSDDCRLAATGFQDSFIKIWSLD----------GSSLVTNKLPSY--- 521

Query: 442 VVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVK 501
               +E  L   D  SS+L+      H GA++S   + D K L++GS DK+++ W     
Sbjct: 522 ---KKEEILTTGDETSSLLI-----GHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTH 573

Query: 502 QELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKF 561
             L++     Y    + V D           +K S    + A +  D T +++  D +  
Sbjct: 574 TTLVS-----YKGHNHPVWD-----------VKFSPMGHYFATASHDQTARLWSCDHIYP 617

Query: 562 FLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLP 621
                GH   V ++    +   + T SADK  ++W +  GD  +    H   ++     P
Sbjct: 618 LRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTP 677

Query: 622 GSHNFFSASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHDHSIRIW 680
                 +  +DG +  WD    + ++++  H ++ + + + +  G  ++S   DHS+R+W
Sbjct: 678 DGRWLCTGGEDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVW 737

Query: 681 E 681
           +
Sbjct: 738 D 738

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 77/182 (42%), Gaps = 21/182 (11%)

Query: 529 DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLS--------------------LYGH 568
           D+  ++ S D +  A    D+ +K++ LD      +                    L GH
Sbjct: 481 DMSCLEFSDDCRLAATGFQDSFIKIWSLDGSSLVTNKLPSYKKEEILTTGDETSSLLIGH 540

Query: 569 KLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFS 628
              V S   S D K +++ S DK +++W +D      S   H   +  VKF P  H F +
Sbjct: 541 SGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFAT 600

Query: 629 ASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE-ETDDQV 687
           AS D   + W  D    ++  A H ++V  ++   NG  V + S D + R+W+  T D V
Sbjct: 601 ASHDQTARLWSCDHIYPLRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSV 660

Query: 688 FL 689
            L
Sbjct: 661 RL 662

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 54/114 (47%), Gaps = 2/114 (1%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           +V  + FH     +  G AD   ++WD+ +   +  F GH + +        G  L +G 
Sbjct: 627 DVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLCTGG 686

Query: 139 EDSNIIVWDLVSEVGLYKLRSH-KGTITGLWCDSD-NWLISTSKDGLIKVWDLK 190
           ED  I VWD+ +   L ++R H K  I     + + N LIS   D  ++VWDLK
Sbjct: 687 EDGVINVWDIGTGKRLKQMRGHGKNAIHSFSFNKEGNILISGGADHSVRVWDLK 740

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 80/199 (40%), Gaps = 21/199 (10%)

Query: 47  ISVWDLKTSEL----------EYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGY 96
           I +W L  S L          E +L+ G    S+ +  S    V    F  +   + +G 
Sbjct: 503 IKIWSLDGSSLVTNKLPSYKKEEILTTGDETSSLLIGHS--GAVYSTSFSPDNKFLLSGS 560

Query: 97  ADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYK 156
            D  ++LW + + T L+S+ GH   +  +KF   G    + S D    +W   S   +Y 
Sbjct: 561 EDKTVRLWSMDTHTTLVSYKGHNHPVWDVKFSPMGHYFATASHDQTARLW---SCDHIYP 617

Query: 157 LRSHKGTITGL----WCDSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGIMT 212
           LR   G +  +    +  +  ++ + S D   ++WD+ T   +   + HT       +  
Sbjct: 618 LRIFAGHLNDVETVSFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTP 677

Query: 213 D--FVVTSSADSQLKIWQM 229
           D  ++ T   D  + +W +
Sbjct: 678 DGRWLCTGGEDGVINVWDI 696

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 63/155 (40%), Gaps = 25/155 (16%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           ++S L+F  +  L A G+ D  IK+W         S +G       L   K    L +G 
Sbjct: 481 DMSCLEFSDDCRLAATGFQDSFIKIW---------SLDGSSLVTNKLPSYKKEEILTTGD 531

Query: 139 EDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIET 197
           E S++++              H G +       DN +L+S S+D  +++W + T   + +
Sbjct: 532 ETSSLLI-------------GHSGAVYSTSFSPDNKFLLSGSEDKTVRLWSMDTHTTLVS 578

Query: 198 HIAHTGECW--ALGIMTDFVVTSSADSQLKIWQMD 230
           +  H    W      M  +  T+S D   ++W  D
Sbjct: 579 YKGHNHPVWDVKFSPMGHYFATASHDQTARLWSCD 613

>Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON}
           YBR198C (REAL)
          Length = 802

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/301 (19%), Positives = 123/301 (40%), Gaps = 39/301 (12%)

Query: 383 LQGSRTDVRSIDISDDNALLATA-SNGELKIWNLNTKSCIRTFECGYALTCKFLPGGLLV 441
            Q +  D+  ++ SDD  + A    +  +KIW+L+  S                     +
Sbjct: 463 FQNTNKDMSCLNFSDDCRIAAAGFQDSYIKIWSLDGSSL----------------NNPNI 506

Query: 442 VVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVK 501
           ++ +   N +  D     L+      H G ++S   + D K L++GS DK+++ W     
Sbjct: 507 MLNSANNNYRDDDPTCKTLV-----GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTH 561

Query: 502 QELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKF 561
             L++     +                 +  +  S    + A +  D T +++  D +  
Sbjct: 562 TALVSYKGHNH----------------PVWDVNFSPLGHYFATASHDQTARLWSCDHIYP 605

Query: 562 FLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLP 621
                GH   V  +    +   + T S+DK  ++W +  GD  +    H   ++C+   P
Sbjct: 606 LRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSP 665

Query: 622 GSHNFFSASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHDHSIRIW 680
                 + S+DG +  WD    + ++++  H ++ +++L+ S  G  ++S   DHS+R+W
Sbjct: 666 DGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVW 725

Query: 681 E 681
           +
Sbjct: 726 D 726

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 74/180 (41%), Gaps = 12/180 (6%)

Query: 522 STLELGDDILSIKISGDDKFLAISLLD-----------NTVKVFFLDSMKFFLSLYGHKL 570
           S L   DD         D ++ I  LD           N+    + D      +L GH  
Sbjct: 471 SCLNFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMLNSANNNYRDDDPTCKTLVGHSG 530

Query: 571 PVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSAS 630
            V S   S D K +++ S DK +++W +D      S   H   +  V F P  H F +AS
Sbjct: 531 TVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATAS 590

Query: 631 KDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE-ETDDQVFL 689
            D   + W  D    ++  A H ++V  ++   NG  V + S D + R+W+  T D V L
Sbjct: 591 HDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRL 650

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           +V  + FH     +  G +D   ++WD+ +   +  F GH + +  +     G  L +GS
Sbjct: 615 DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGS 674

Query: 139 EDSNIIVWDLVSEVGLYKLRSH-KGTITGL-WCDSDNWLISTSKDGLIKVWDLK 190
           ED  I +WD+ +   L ++R H K  I  L +    N LIS   D  ++VWDLK
Sbjct: 675 EDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 728

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 66/151 (43%), Gaps = 9/151 (5%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   + +G  D  ++LW + + T L+S+ GH   +  + F   G    + S D    
Sbjct: 537 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTAR 596

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDN----WLISTSKDGLIKVWDLKTQQCIETHIA 200
           +W   S   +Y LR   G +  + C S +    ++ + S D   ++WD+ T   +   + 
Sbjct: 597 LW---SCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 653

Query: 201 HTGECWALGIMTD--FVVTSSADSQLKIWQM 229
           HT     + +  D  ++ T S D  + IW +
Sbjct: 654 HTAPVICIAVSPDGRWLSTGSEDGIINIWDI 684

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/220 (21%), Positives = 87/220 (39%), Gaps = 21/220 (9%)

Query: 92  IAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSE 151
            A    D   +LW       L  F GH + +  + F   G  + +GS D    +WD+ + 
Sbjct: 586 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 645

Query: 152 VGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHTGEC-WALG 209
             +     H   +  +    D  WL + S+DG+I +WD+ T + ++    H     ++L 
Sbjct: 646 DSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLS 705

Query: 210 IMT--DFVVTSSADSQLKIWQM-----DLEGEPGSKLIE-----KGAFEKQSKQRGLSIE 257
                + +++  AD  +++W +     +   EP    I        +  +  K+ G    
Sbjct: 706 YSKEGNVLISGGADHSVRVWDLKKATTEPSAEPDEPFIGYLGDVTASINQDIKEYGRRRT 765

Query: 258 FTTTSDGVHFFYVQNADKTVEIFRL---RKDIEIAKAIKR 294
              TSD V  FY     K   +F++   R ++ +A    R
Sbjct: 766 VIPTSDLVASFYT----KKTPVFKVKFSRSNLAVAGGAFR 801

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/239 (21%), Positives = 103/239 (43%), Gaps = 31/239 (12%)

Query: 365 YEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNA-LLATASNGELKIWNLNTKSCIRT 423
           Y   DPT  T        L G    V S   S DN  LL+ + +  +++W+++T + + +
Sbjct: 515 YRDDDPTCKT--------LVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVS 566

Query: 424 FECGYALTC---KFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480
           ++ G+        F P G      + +   +L+     +    I A H   +  +    +
Sbjct: 567 YK-GHNHPVWDVNFSPLGHYFATASHDQTARLWS-CDHIYPLRIFAGHLNDVDCVSFHPN 624

Query: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDK 540
           G  + TGS+DK+ + WD      +          ++ + H +       ++ I +S D +
Sbjct: 625 GCYVFTGSSDKTCRMWDVSTGDSV----------RLFLGHTAP------VICIAVSPDGR 668

Query: 541 FLAISLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSLDISDDTKVIITSSADKNIKIWGL 598
           +L+    D  + ++ + + K    + GH K  + SL  S +  V+I+  AD ++++W L
Sbjct: 669 WLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 727

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/174 (20%), Positives = 67/174 (38%), Gaps = 23/174 (13%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKT------VLLSFN--------------GH 118
           ++S L F  +  + AAG+ D  IK+W L   +      +L S N              GH
Sbjct: 469 DMSCLNFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMLNSANNNYRDDDPTCKTLVGH 528

Query: 119 KSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLIS 177
              +    F      L+SGSED  + +W + +   L   + H   +  + +    ++  +
Sbjct: 529 SGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFAT 588

Query: 178 TSKDGLIKVWDLKTQQCIETHIAHTG--ECWALGIMTDFVVTSSADSQLKIWQM 229
            S D   ++W       +     H    +C +      +V T S+D   ++W +
Sbjct: 589 ASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDV 642

>NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {ON}
           Anc_6.363
          Length = 793

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 106/222 (47%), Gaps = 17/222 (7%)

Query: 468 HEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELG 527
           H   +  +  + DG+ L TG  +K+ + +      ELIA  SD      N+  DS     
Sbjct: 442 HSSVVCCVKFSYDGEFLATG-CNKTTQVYRVSTG-ELIAKLSDD-----NVKLDSNSTST 494

Query: 528 D-DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIIT 586
           D  I S+  S D KFLA    D  ++++ +   K  + L GH+  V SLD   D + +++
Sbjct: 495 DLYIRSVCFSPDGKFLATGAEDKLIRIWDIQEGKIVMVLKGHEQDVYSLDYFPDGQKLVS 554

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA-SKDGFVKYWDGDKFEC 645
            S D+ ++IW L  G C  +L + +D +  V   P    F +A S D  V+ WD      
Sbjct: 555 GSGDRTVRIWDLRTGQCSLTL-SIEDGVTTVAVSPHDGRFIAAGSLDRAVRVWDSTTGFL 613

Query: 646 IQKL-------AAHQSEVWALAVSDNGERVVSVSHDHSIRIW 680
           +++L         HQ  V+++  + +G  VVS S D S+++W
Sbjct: 614 VERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLW 655

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/351 (22%), Positives = 141/351 (40%), Gaps = 79/351 (22%)

Query: 390 VRSIDISDDNALLATASNGELKIWNLNTKSCI-------------RTFECGYALTCKFLP 436
           V  +  S D   LAT  N   +++ ++T   I              T    Y  +  F P
Sbjct: 446 VCCVKFSYDGEFLATGCNKTTQVYRVSTGELIAKLSDDNVKLDSNSTSTDLYIRSVCFSP 505

Query: 437 GGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFW 496
            G  +  G  +  ++++D+    ++  ++  HE  ++SLD   DG++LV+GS D++++ W
Sbjct: 506 DGKFLATGAEDKLIRIWDIQEGKIVMVLKG-HEQDVYSLDYFPDGQKLVSGSGDRTVRIW 564

Query: 497 DFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDD-KFLAISLLDNTVKVFF 555
           D +  Q  +                 TL + D + ++ +S  D +F+A   LD  V+V+ 
Sbjct: 565 DLRTGQCSL-----------------TLSIEDGVTTVAVSPHDGRFIAAGSLDRAVRVW- 606

Query: 556 LDSMKFFLSLY---------GHKLPVLSLDISDDTKVIITSSADKNIKIWGLDF------ 600
            DS   FL            GH+  V S+  + D   +++ S DK++K+W L        
Sbjct: 607 -DSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLWNLGNDVNSNN 665

Query: 601 ------------------------GDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVK 636
                                     C  +   H+D ++ V          S SKD  V 
Sbjct: 666 NGNDSSSNGTNNNNNSNRASNGTSATCEVTYVGHKDFVLSVTTSQNDEYILSGSKDRGVL 725

Query: 637 YWDGDKFECIQKLAAHQSEVWALAVSDN---GER---VVSVSHDHSIRIWE 681
           +WD      +  L  H++ V ++AV++    G +     + S D   RIW+
Sbjct: 726 FWDKKSGNPLLMLQGHKNSVISVAVANGYPLGPKYNVFATGSGDCKARIWK 776

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 88/202 (43%), Gaps = 17/202 (8%)

Query: 41  TGALENISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQ---FHSETGLIAAGYA 97
           TG  +   V+ + T EL   LSD     +V L S+  +   Y++   F  +   +A G  
Sbjct: 460 TGCNKTTQVYRVSTGELIAKLSDD----NVKLDSNSTSTDLYIRSVCFSPDGKFLATGAE 515

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKL 157
           D +I++WD+    +++   GH+  +  L +   G +L+SGS D  + +WDL +      L
Sbjct: 516 DKLIRIWDIQEGKIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIWDLRTGQCSLTL 575

Query: 158 RSHKGTITGLWCDSDNWLIST-SKDGLIKVWDLKTQQCIET-------HIAHTGECWALG 209
               G  T      D   I+  S D  ++VWD  T   +E           H    +++ 
Sbjct: 576 SIEDGVTTVAVSPHDGRFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHQDSVYSVV 635

Query: 210 IMTDF--VVTSSADSQLKIWQM 229
              D   VV+ S D  +K+W +
Sbjct: 636 FTRDGNEVVSGSLDKSVKLWNL 657

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 74/166 (44%), Gaps = 14/166 (8%)

Query: 530 ILSIKISGDDKFLAISLLDNTVKVFFL-----------DSMKFFLSLYGHKLPVLSLDIS 578
           +  +K S D +FLA    + T +V+ +           D++K   +     L + S+  S
Sbjct: 446 VCCVKFSYDGEFLATGC-NKTTQVYRVSTGELIAKLSDDNVKLDSNSTSTDLYIRSVCFS 504

Query: 579 DDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYW 638
            D K + T + DK I+IW +  G     L  H+  +  + + P      S S D  V+ W
Sbjct: 505 PDGKFLATGAEDKLIRIWDIQEGKIVMVLKGHEQDVYSLDYFPDGQKLVSGSGDRTVRIW 564

Query: 639 DGDKFECIQKLAAHQSEVWALAVSDNGERVVSV-SHDHSIRIWEET 683
           D    +C   L+     V  +AVS +  R ++  S D ++R+W+ T
Sbjct: 565 DLRTGQCSLTLSIEDG-VTTVAVSPHDGRFIAAGSLDRAVRVWDST 609

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/240 (19%), Positives = 91/240 (37%), Gaps = 63/240 (26%)

Query: 38  KVITGALE-NISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDL+T +    LS  DG+   +V     +               IAA
Sbjct: 551 KLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPHDGR--------------FIAA 596

Query: 95  GYADGVIKLWDLVSKTVLLSFN-------GHKSRITMLKFDKTGTQLISGSEDSNIIVWD 147
           G  D  +++WD  +  ++   +       GH+  +  + F + G +++SGS D ++ +W+
Sbjct: 597 GSLDRAVRVWDSTTGFLVERLDSENELGTGHQDSVYSVVFTRDGNEVVSGSLDKSVKLWN 656

Query: 148 L------------------------------VSEVGLYKLRSHKGTITGLWC-DSDNWLI 176
           L                               S         HK  +  +    +D +++
Sbjct: 657 LGNDVNSNNNGNDSSSNGTNNNNNSNRASNGTSATCEVTYVGHKDFVLSVTTSQNDEYIL 716

Query: 177 STSKDGLIKVWDLKTQQCIETHIAH--------TGECWALGIMTDFVVTSSADSQLKIWQ 228
           S SKD  +  WD K+   +     H            + LG   +   T S D + +IW+
Sbjct: 717 SGSKDRGVLFWDKKSGNPLLMLQGHKNSVISVAVANGYPLGPKYNVFATGSGDCKARIWK 776

>NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 65/301 (21%), Positives = 124/301 (41%), Gaps = 34/301 (11%)

Query: 383 LQGSRTDVRSIDISDDNALLATA-SNGELKIWNLNTKSCIRTFECGYALTCKFLPGGLLV 441
              +  D+ S+D S+D+ L A    +  +K+W+L+  S  +  +                
Sbjct: 515 FHNTNRDMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGD---------------- 558

Query: 442 VVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVK 501
           V  +   +    D  S     T    H GA++S   + D K L++GS DK+++ W     
Sbjct: 559 VSSSPSPSATTADKYSKDFTNTTLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTN 618

Query: 502 QELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKF 561
             L++     Y    + V D           +K S    + A +  D T +++  D +  
Sbjct: 619 TTLVS-----YKGHNHPVWD-----------VKFSPLGHYFATASHDQTARLWSCDHIYP 662

Query: 562 FLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLP 621
                GH   V  +    +   + T S+DK  ++W +  GD  +    H   ++     P
Sbjct: 663 LRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSP 722

Query: 622 GSHNFFSASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHDHSIRIW 680
                 + S+DG +  WD    + ++ +  H ++ +++L+ S  G  +VS   DHS+R+W
Sbjct: 723 DGRWLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVW 782

Query: 681 E 681
           +
Sbjct: 783 D 783

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 81/187 (43%), Gaps = 26/187 (13%)

Query: 529 DILSIKISGDDKFLAISLLDNTVKVFFLD--SMKFF-----------------------L 563
           D+ S+  S D +  A    D+ +K++ LD  S+K +                        
Sbjct: 521 DMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKYSKDFTNT 580

Query: 564 SLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGS 623
           +L GH   V S   S D K +I+ S DK +++W LD      S   H   +  VKF P  
Sbjct: 581 TLIGHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLG 640

Query: 624 HNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE-E 682
           H F +AS D   + W  D    ++  A H S+V  ++   NG  V + S D + R+W+  
Sbjct: 641 HYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVS 700

Query: 683 TDDQVFL 689
           T D V L
Sbjct: 701 TGDSVRL 707

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 68/151 (45%), Gaps = 9/151 (5%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   + +G  D  ++LW L + T L+S+ GH   +  +KF   G    + S D    
Sbjct: 594 FSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFSPLGHYFATASHDQTAR 653

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDN----WLISTSKDGLIKVWDLKTQQCIETHIA 200
           +W   S   +Y LR   G ++ + C S +    ++ + S D   ++WD+ T   +   + 
Sbjct: 654 LW---SCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 710

Query: 201 HTGECWALGIMTD--FVVTSSADSQLKIWQM 229
           HT    +  +  D  ++ T S D  + +W +
Sbjct: 711 HTAPVISTAVSPDGRWLSTGSEDGIINVWDI 741

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 56/115 (48%), Gaps = 2/115 (1%)

Query: 78  AEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISG 137
           ++V  + FH     +  G +D   ++WD+ +   +  F GH + +        G  L +G
Sbjct: 671 SDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISTAVSPDGRWLSTG 730

Query: 138 SEDSNIIVWDLVSEVGLYKLRSH-KGTITGL-WCDSDNWLISTSKDGLIKVWDLK 190
           SED  I VWD+ +   L  +R H K  I  L +    N L+S+  D  ++VWDLK
Sbjct: 731 SEDGIINVWDIGTGKRLKLMRGHGKNAIYSLSYSKEGNVLVSSGADHSVRVWDLK 785

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 78/194 (40%), Gaps = 14/194 (7%)

Query: 92  IAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSE 151
            A    D   +LW       L  F GH S +  + F   G  + +GS D    +WD+ + 
Sbjct: 643 FATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 702

Query: 152 VGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHTGEC-WALG 209
             +     H   +       D  WL + S+DG+I VWD+ T + ++    H     ++L 
Sbjct: 703 DSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKLMRGHGKNAIYSLS 762

Query: 210 IMT--DFVVTSSADSQLKIWQM-DLEGEPGSKLIEK---------GAFEKQSKQRGLSIE 257
                + +V+S AD  +++W +     EP ++  E           +  +  K+ G    
Sbjct: 763 YSKEGNVLVSSGADHSVRVWDLKKATAEPSAEPEEPFVGYLGDVTASINQDIKEYGRRRT 822

Query: 258 FTTTSDGVHFFYVQ 271
              TSD +  FY +
Sbjct: 823 IVPTSDLLASFYTR 836

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/182 (20%), Positives = 66/182 (36%), Gaps = 34/182 (18%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDL----------------------------VSKT 110
           +++ L F  ++ L A G+ D  IKLW L                             + T
Sbjct: 521 DMTSLDFSEDSRLAAGGFQDSYIKLWSLDGSSLKKYGDVSSSPSPSATTADKYSKDFTNT 580

Query: 111 VLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WC 169
            L+   GH   +    F      LISGSED  + +W L +   L   + H   +  + + 
Sbjct: 581 TLI---GHSGAVYSTSFSPDNKYLISGSEDKTVRLWSLDTNTTLVSYKGHNHPVWDVKFS 637

Query: 170 DSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTG--ECWALGIMTDFVVTSSADSQLKIW 227
              ++  + S D   ++W       +     H    +C +      +V T S+D   ++W
Sbjct: 638 PLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMW 697

Query: 228 QM 229
            +
Sbjct: 698 DV 699

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 82.8 bits (203), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 114/269 (42%), Gaps = 26/269 (9%)

Query: 438 GLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWD 497
           G  +  G   G++++    +  +  +I+AAHEG I  LD   DG  L++G  D  +K WD
Sbjct: 184 GQQLATGCWGGSIKVVSCETLGIAKSIDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWD 243

Query: 498 FQVKQ-ELIAGTSD-----KYVPQMNIVHDSTLEL-------------------GDDILS 532
                 E + G +      K  P   +   ++ +L                      + +
Sbjct: 244 MTSNSFEELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQEGHSKAVYT 303

Query: 533 IKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKN 592
           I    D   LA + LD    ++ L S +  + L GH   +  +D S +   + T+ AD  
Sbjct: 304 IAFQSDGALLASAGLDAVCAIWDLRSGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGT 363

Query: 593 IKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFF-SASKDGFVKYWDGDKFECIQKLAA 651
           +++W +       +L AHQ + + VKF   +  F  S   D  V  ++ D ++ +  L  
Sbjct: 364 VRVWDIRNVGTESALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFNADNWQKLASLEG 423

Query: 652 HQSEVWALAVSDNGERVVSVSHDHSIRIW 680
           H   V+ + ++++G  + S   D S++ W
Sbjct: 424 HTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 70/165 (42%), Gaps = 15/165 (9%)

Query: 39  VITGALEN-ISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYA 97
           +++G  +N + +WD+ ++  E +                   VS ++ H    L A+   
Sbjct: 230 LLSGGGDNLVKLWDMTSNSFEEL-------------RGHAGRVSRVKVHPSGRLAASASF 276

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKL 157
           D    LWDL  K  L    GH   +  + F   G  L S   D+   +WDL S   + KL
Sbjct: 277 DLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKL 336

Query: 158 RSHKGTITGL-WCDSDNWLISTSKDGLIKVWDLKTQQCIETHIAH 201
             H G I+G+ W  +   L +   DG ++VWD++        +AH
Sbjct: 337 EGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAH 381

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 76/161 (47%), Gaps = 4/161 (2%)

Query: 72  LKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTG 131
           + ++   ++  L +H +   + +G  D ++KLWD+ S +      GH  R++ +K   +G
Sbjct: 210 IDAAHEGKIGGLDWHPDGNHLLSGGGDNLVKLWDMTSNS-FEELRGHAGRVSRVKVHPSG 268

Query: 132 TQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK-DGLIKVWDLK 190
               S S D   I+WDL  +V L     H   +  +   SD  L++++  D +  +WDL+
Sbjct: 269 RLAASASFDLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLR 328

Query: 191 TQQCIETHIAHTGECWALGIMTDF--VVTSSADSQLKIWQM 229
           + + I     H G    +    +   + T+ AD  +++W +
Sbjct: 329 SGEPIMKLEGHAGAISGVDWSPNGYQLATAGADGTVRVWDI 369

 Score = 58.5 bits (140), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 98/222 (44%), Gaps = 27/222 (12%)

Query: 382 ELQGSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYA---LTCKFLPG 437
           EL+G    V  + +     L A+AS +    +W+L  K  ++  E G++    T  F   
Sbjct: 251 ELRGHAGRVSRVKVHPSGRLAASASFDLTWILWDLERKVELQLQE-GHSKAVYTIAFQSD 309

Query: 438 GLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWD 497
           G L+     +    ++DL S   +  +E  H GAI  +D + +G +L T  AD +++ WD
Sbjct: 310 GALLASAGLDAVCAIWDLRSGEPIMKLEG-HAGAISGVDWSPNGYQLATAGADGTVRVWD 368

Query: 498 FQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS---GDDKFLAISLLDNTVKVF 554
            +                 N+  +S L L   + ++ +     +  FL     D  V +F
Sbjct: 369 IR-----------------NVGTESAL-LAHQVAALDVKFKKNNGTFLVSCGHDRLVNIF 410

Query: 555 FLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIW 596
             D+ +   SL GH   V ++DI++D   I +   D+++K W
Sbjct: 411 NADNWQKLASLEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 76/176 (43%), Gaps = 4/176 (2%)

Query: 56  ELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSF 115
           +L ++L D      + L+      V  + F S+  L+A+   D V  +WDL S   ++  
Sbjct: 277 DLTWILWDLERKVELQLQEGHSKAVYTIAFQSDGALLASAGLDAVCAIWDLRSGEPIMKL 336

Query: 116 NGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDN-- 173
            GH   I+ + +   G QL +   D  + VWD+ +      L +H+     +    +N  
Sbjct: 337 EGHAGAISGVDWSPNGYQLATAGADGTVRVWDIRNVGTESALLAHQVAALDVKFKKNNGT 396

Query: 174 WLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTD--FVVTSSADSQLKIW 227
           +L+S   D L+ +++    Q + +   HT   + + I  D   + +   D  LK W
Sbjct: 397 FLVSCGHDRLVNIFNADNWQKLASLEGHTDRVFTVDITEDGSTIYSGGKDRSLKQW 452

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/286 (24%), Positives = 127/286 (44%), Gaps = 53/286 (18%)

Query: 428 YALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTG 487
           Y  +  F P G  +  G  +  ++++D+    ++  ++  HE  ++SLD   +G++LV+G
Sbjct: 389 YIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKG-HEQDVYSLDYFPNGEKLVSG 447

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDD-KFLAISL 546
           S D++++ WD +  Q  +                 TL +   + ++ +S +D KF+A   
Sbjct: 448 SGDRTVRIWDLRTGQCSL-----------------TLSIEYGVTTVAVSPNDGKFIAAGS 490

Query: 547 LDNTVKVFFLDSMKFFLSLY---------GHKLPVLSLDISDDTKVIITSSADKNIKIWG 597
           LD  V+V+  DS   FL            GH+  V S+  + D   +++ S DK +K+W 
Sbjct: 491 LDRAVRVW--DSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWN 548

Query: 598 L-----------DFGD----CHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDK 642
           +           D G     C  +   H+D ++ V          S SKD  + +WD + 
Sbjct: 549 MRHSGNSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKES 608

Query: 643 FECIQKLAAHQSEVWALAVSDNGERV-------VSVSHDHSIRIWE 681
              +  L  H++ V ++AV+ NG  +        + S D   RIW+
Sbjct: 609 GNPLLMLQGHRNSVISVAVA-NGSALGPKYNVFATGSGDCKARIWK 653

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 105/224 (46%), Gaps = 14/224 (6%)

Query: 468 HEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNI---VHDSTL 524
           H   +  +  +NDG+ L TG  +K+ + +      ELIA  SD  V   +       ST 
Sbjct: 327 HSSVVCCVKFSNDGQFLATG-CNKTTQIYRVS-DGELIAKLSDDSVTSPDTSSATSGSTP 384

Query: 525 ELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVI 584
                I S+  S D +FLA    D  ++++ +   K  + L GH+  V SLD   + + +
Sbjct: 385 STDLYIRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKL 444

Query: 585 ITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA-SKDGFVKYWDGDKF 643
           ++ S D+ ++IW L  G C  +L + +  +  V   P    F +A S D  V+ WD    
Sbjct: 445 VSGSGDRTVRIWDLRTGQCSLTL-SIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTG 503

Query: 644 ECIQKL-------AAHQSEVWALAVSDNGERVVSVSHDHSIRIW 680
             +++L         H+  V+++  + +G  VVS S D ++++W
Sbjct: 504 FLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLW 547

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 71/279 (25%), Positives = 127/279 (45%), Gaps = 46/279 (16%)

Query: 390 VRSIDISDDNALLATASNGEL-KIWNLNTKSCIRTFECGY---ALTCKFLPGGLLVVVGT 445
           +RS+  S D   LAT +  +L +IW++  +  +   + G+     +  + P G  +V G+
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLK-GHEQDVYSLDYFPNGEKLVSGS 448

Query: 446 REGNLQLFDLASSVLLTTIEAAHEGAIWSLDVT-NDGKRLVTGSADKSIKFWDFQVKQEL 504
            +  ++++DL +     T+    E  + ++ V+ NDGK +  GS D++++ WD       
Sbjct: 449 GDRTVRIWDLRTGQCSLTLSI--EYGVTTVAVSPNDGKFIAAGSLDRAVRVWD------- 499

Query: 505 IAGTSDKYVPQMNIVHDSTLELG----DDILSIKISGDDKFLAISLLDNTVKVFFLD--- 557
              T+   V ++    DS  ELG    D + S+  + D   +    LD TVK++ +    
Sbjct: 500 --STTGFLVERL----DSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWNMRHSG 553

Query: 558 ------------SMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHK 605
                       S    ++  GHK  VLS+  S D K I++ S D+ I  W  + G+   
Sbjct: 554 NSNNESNDKGSASATCEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKESGNPLL 613

Query: 606 SLFAHQDSIMCVKFLPGS-----HNFFS-ASKDGFVKYW 638
            L  H++S++ V    GS     +N F+  S D   + W
Sbjct: 614 MLQGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIW 652

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 96/222 (43%), Gaps = 16/222 (7%)

Query: 39  VITGALENISVWDLKTSELEYVLSDGL---PPGSVDLKSSKPAEVSYLQ---FHSETGLI 92
           + TG  +   ++ +   EL   LSD     P  S     S P+   Y++   F  +   +
Sbjct: 343 LATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSVCFSPDGEFL 402

Query: 93  AAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEV 152
           A G  D +I++WD+  + +++   GH+  +  L +   G +L+SGS D  + +WDL +  
Sbjct: 403 ATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSGDRTVRIWDLRTGQ 462

Query: 153 GLYKLRSHKGTITGLWCDSDNWLIST-SKDGLIKVWDLKTQQCIET-------HIAHTGE 204
               L    G  T     +D   I+  S D  ++VWD  T   +E           H   
Sbjct: 463 CSLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDSTTGFLVERLDSENELGTGHRDS 522

Query: 205 CWALGIMTDF--VVTSSADSQLKIWQMDLEGEPGSKLIEKGA 244
            +++    D   VV+ S D  +K+W M   G   ++  +KG+
Sbjct: 523 VYSVVFTRDGNEVVSGSLDKTVKLWNMRHSGNSNNESNDKGS 564

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 53/113 (46%), Gaps = 2/113 (1%)

Query: 572 VLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASK 631
           + S+  S D + + T + DK I+IW +        L  H+  +  + + P      S S 
Sbjct: 390 IRSVCFSPDGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEKLVSGSG 449

Query: 632 DGFVKYWDGDKFECIQKLAAHQSEVWALAVSDN-GERVVSVSHDHSIRIWEET 683
           D  V+ WD    +C   L+     V  +AVS N G+ + + S D ++R+W+ T
Sbjct: 450 DRTVRIWDLRTGQCSLTLSIEYG-VTTVAVSPNDGKFIAAGSLDRAVRVWDST 501

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 90/226 (39%), Gaps = 50/226 (22%)

Query: 38  KVITGALEN-ISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDL+T +    LS   G+   +V     K               IAA
Sbjct: 443 KLVSGSGDRTVRIWDLRTGQCSLTLSIEYGVTTVAVSPNDGK--------------FIAA 488

Query: 95  GYADGVIKLWDLVSKTVLLSFN-------GHKSRITMLKFDKTGTQLISGSEDSNIIVWD 147
           G  D  +++WD  +  ++   +       GH+  +  + F + G +++SGS D  + +W+
Sbjct: 489 GSLDRAVRVWDSTTGFLVERLDSENELGTGHRDSVYSVVFTRDGNEVVSGSLDKTVKLWN 548

Query: 148 LVSEVGLYKLRSHKGTITGLWCD-----------------SDNWLISTSKDGLIKVWDLK 190
           +          + KG+ +   C+                  D +++S SKD  I  WD +
Sbjct: 549 MRHSGNSNNESNDKGSASAT-CEVTYVGHKDFVLSVTTSQDDKYILSGSKDRGILFWDKE 607

Query: 191 TQQCIETHIAH--------TGECWALGIMTDFVVTSSADSQLKIWQ 228
           +   +     H             ALG   +   T S D + +IW+
Sbjct: 608 SGNPLLMLQGHRNSVISVAVANGSALGPKYNVFATGSGDCKARIWK 653

>TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {ON}
           Anc_6.363 YCR084C
          Length = 663

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 120/297 (40%), Gaps = 61/297 (20%)

Query: 428 YALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTG 487
           Y  +  F P G  +  G  +  ++++D+    ++  +   HE  I+SLD    G ++V+G
Sbjct: 368 YIRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVMILNG-HEQDIYSLDYFPSGDKIVSG 426

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLL 547
           S D++++ WD    Q L+                 TL + D + ++ +S D KF+A   L
Sbjct: 427 SGDRTVRIWDLNTGQCLL-----------------TLSIEDGVTTVAVSPDGKFIAAGSL 469

Query: 548 DNTVKV------FFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLD-- 599
           D  V+V      F ++ +       GH+  V S+  + D K +++ S DK +K+W L   
Sbjct: 470 DRAVRVWDAETGFLVERLDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNLKQQ 529

Query: 600 -----------------------------FGDCHKSLFAHQDSIMCVKFLPGSHNFFSAS 630
                                           C  +   H+D ++ V          S S
Sbjct: 530 TTSSNDASKINQNSNSHLDSKINKSNNNNSSTCEVTYMGHKDFVLSVATTNDDQMILSGS 589

Query: 631 KDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD------NGERVVSVSHDHSIRIWE 681
           KD  V +WD      +  L  H++ V ++AV++      N     + S D   RIW+
Sbjct: 590 KDRSVLFWDTKSGNPLLMLQGHRNSVISVAVANGIPLGPNYGIFATGSGDCKARIWK 646

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 63/269 (23%), Positives = 127/269 (47%), Gaps = 40/269 (14%)

Query: 383 LQGSRTDVRSID-ISDDNALLATASNGELKIWNLNTKSCIRTFECGYALTCKFL-PGGLL 440
           L G   D+ S+D     + +++ + +  ++IW+LNT  C+ T      +T   + P G  
Sbjct: 404 LNGHEQDIYSLDYFPSGDKIVSGSGDRTVRIWDLNTGQCLLTLSIEDGVTTVAVSPDGKF 463

Query: 441 VVVGTREGNLQLFDLASSVLLTTIEA-----AHEGAIWSLDVTNDGKRLVTGSADKSIKF 495
           +  G+ +  ++++D  +  L+  +++      HE +++S+  T DGK +V+GS DK++K 
Sbjct: 464 IAAGSLDRAVRVWDAETGFLVERLDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKL 523

Query: 496 WDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFF 555
           W+   KQ+    TS     ++N   +S L+                 + +   +T +V +
Sbjct: 524 WNL--KQQT---TSSNDASKINQNSNSHLDSK------------INKSNNNNSSTCEVTY 566

Query: 556 LDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 615
           +          GHK  VLS+  ++D ++I++ S D+++  W    G+    L  H++S++
Sbjct: 567 M----------GHKDFVLSVATTNDDQMILSGSKDRSVLFWDTKSGNPLLMLQGHRNSVI 616

Query: 616 CVKF---LPGSHN---FFSASKDGFVKYW 638
            V     +P   N   F + S D   + W
Sbjct: 617 SVAVANGIPLGPNYGIFATGSGDCKARIW 645

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 72/153 (47%), Gaps = 8/153 (5%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   +A G  D +I++WD+  K +++  NGH+  I  L +  +G +++SGS D  + 
Sbjct: 374 FSPDGKFLATGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDYFPSGDKIVSGSGDRTVR 433

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIET------H 198
           +WDL +   L  L    G  T        ++ + S D  ++VWD +T   +E        
Sbjct: 434 IWDLNTGQCLLTLSIEDGVTTVAVSPDGKFIAAGSLDRAVRVWDAETGFLVERLDSNELG 493

Query: 199 IAHTGECWALGIMTD--FVVTSSADSQLKIWQM 229
             H    +++    D   VV+ S D  +K+W +
Sbjct: 494 TGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNL 526

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 56/112 (50%), Gaps = 1/112 (0%)

Query: 570 LPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA 629
           L + S+  S D K + T + D+ I+IW +        L  H+  I  + + P      S 
Sbjct: 367 LYIRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDYFPSGDKIVSG 426

Query: 630 SKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
           S D  V+ WD +  +C+  L+  +  V  +AVS +G+ + + S D ++R+W+
Sbjct: 427 SGDRTVRIWDLNTGQCLLTLSI-EDGVTTVAVSPDGKFIAAGSLDRAVRVWD 477

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%)

Query: 614 IMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSH 673
           I  V F P      + ++D  ++ WD    + +  L  H+ ++++L    +G+++VS S 
Sbjct: 369 IRSVCFSPDGKFLATGAEDRLIRIWDITLKKIVMILNGHEQDIYSLDYFPSGDKIVSGSG 428

Query: 674 DHSIRIWEETDDQVFL 689
           D ++RIW+    Q  L
Sbjct: 429 DRTVRIWDLNTGQCLL 444

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 51/246 (20%), Positives = 91/246 (36%), Gaps = 64/246 (26%)

Query: 38  KVITGALE-NISVWDLKTSELEYVLS--DGLPPGSVDLKSSKPAEVSYLQFHSETGLIAA 94
           K+++G+ +  + +WDL T +    LS  DG               V+ +    +   IAA
Sbjct: 422 KIVSGSGDRTVRIWDLNTGQCLLTLSIEDG---------------VTTVAVSPDGKFIAA 466

Query: 95  GYADGVIKLWDLVSKTVLLSFN------GHKSRITMLKFDKTGTQLISGSEDSNIIVWDL 148
           G  D  +++WD  +  ++   +      GH+  +  + F K G  ++SGS D  + +W+L
Sbjct: 467 GSLDRAVRVWDAETGFLVERLDSNELGTGHEDSVYSVVFTKDGKNVVSGSLDKTVKLWNL 526

Query: 149 VSEVGLYKLRS-------------------------------HKGTITGLWCDSDNWLI- 176
             +       S                               HK  +  +   +D+ +I 
Sbjct: 527 KQQTTSSNDASKINQNSNSHLDSKINKSNNNNSSTCEVTYMGHKDFVLSVATTNDDQMIL 586

Query: 177 STSKDGLIKVWDLKTQQCIETHIAHTGECWA--------LGIMTDFVVTSSADSQLKIWQ 228
           S SKD  +  WD K+   +     H     +        LG       T S D + +IW+
Sbjct: 587 SGSKDRSVLFWDTKSGNPLLMLQGHRNSVISVAVANGIPLGPNYGIFATGSGDCKARIWK 646

Query: 229 MDLEGE 234
             L G+
Sbjct: 647 YKLLGD 652

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 65/162 (40%), Gaps = 41/162 (25%)

Query: 37  GKVIT-GALEN-ISVWDLKTSEL-EYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIA 93
           GK I  G+L+  + VWD +T  L E + S+ L  G  D        V  + F  +   + 
Sbjct: 461 GKFIAAGSLDRAVRVWDAETGFLVERLDSNELGTGHED-------SVYSVVFTKDGKNVV 513

Query: 94  AGYADGVIKLWDLVSKTVL-------------------------------LSFNGHKSRI 122
           +G  D  +KLW+L  +T                                 +++ GHK  +
Sbjct: 514 SGSLDKTVKLWNLKQQTTSSNDASKINQNSNSHLDSKINKSNNNNSSTCEVTYMGHKDFV 573

Query: 123 TMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTI 164
             +        ++SGS+D +++ WD  S   L  L+ H+ ++
Sbjct: 574 LSVATTNDDQMILSGSKDRSVLFWDTKSGNPLLMLQGHRNSV 615

>TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.534
           YPR178W
          Length = 477

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 124/283 (43%), Gaps = 36/283 (12%)

Query: 432 CKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADK 491
            K  P   L+  G+ +G + + D  +    T  +AAH G I  ++ +ND   L TG  D 
Sbjct: 194 VKLAPQSKLLASGSWDGAISIVDNMNLERKTHFQAAHVGKIGGIEWSNDEAYLFTGGEDC 253

Query: 492 SIKFWDFQVKQELIA---------GTSD-------KYVPQMNIVHDSTLELGD------- 528
            +K + ++ K +L +           SD       KY+   +   D+T  L D       
Sbjct: 254 LVKVFGYE-KNDLTSIDTLKGHQGRVSDVKLHPLGKYLGSSSF--DNTWRLWDIEKKKEI 310

Query: 529 --------DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDD 580
                   +I S+    D    A +  D+   ++ L S K  ++L GH  P+ SLD + +
Sbjct: 311 LLQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPN 370

Query: 581 TKVIITSSADKNIKIWGLDFGDCH-KSLFAHQDSIMCVKFLPGSHNF-FSASKDGFVKYW 638
              + T S D  IKIW L   + +  S+FAH++ +  V++   +  F FSA  D  +K  
Sbjct: 371 GYQLATGSGDGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIH 430

Query: 639 DGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
           D   +E +  L  H  ++  L  S     +VS   D +++IW+
Sbjct: 431 DSKTYESVATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIWD 473

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 81/164 (49%), Gaps = 5/164 (3%)

Query: 72  LKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTG 131
           L+     E+  L FH++  L A    D +  +WDL S   +++  GH   I  L +   G
Sbjct: 312 LQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPNG 371

Query: 132 TQLISGSEDSNIIVWDLVS-EVGLYKLRSHKGTITGLWCDSDN--WLISTSKDGLIKVWD 188
            QL +GS D  I +WDL + E     + +HK  +T +  + +N  ++ S   D LIK+ D
Sbjct: 372 YQLATGSGDGTIKIWDLRNKESNCASIFAHKNLVTSVQYEKNNGGFVFSAGYDKLIKIHD 431

Query: 189 LKTQQCIETHIAHTGECWALGI--MTDFVVTSSADSQLKIWQMD 230
            KT + + T   HT +   L    +++ +V+S  D  +KIW  D
Sbjct: 432 SKTYESVATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIWDND 475

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 104/238 (43%), Gaps = 25/238 (10%)

Query: 365 YEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSCIRTF 424
           YEK D TS   +K H    QG  +DV+   +     L +++ +   ++W++  K  I   
Sbjct: 260 YEKNDLTSIDTLKGH----QGRVSDVKLHPLG--KYLGSSSFDNTWRLWDIEKKKEI-LL 312

Query: 425 ECGYA---LTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDG 481
           + G++    +  F   G L      +    ++DL S   +  +   H   I+SLD   +G
Sbjct: 313 QEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWDLRSGKNIMNL-IGHAKPIYSLDWAPNG 371

Query: 482 KRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKF 541
            +L TGS D +IK WD + K+   A          N+V     E            +  F
Sbjct: 372 YQLATGSGDGTIKIWDLRNKESNCASI----FAHKNLVTSVQYE----------KNNGGF 417

Query: 542 LAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLD 599
           +  +  D  +K+    + +   +L GH   +L+LD S  + +I++S  D+ +KIW  D
Sbjct: 418 VFSAGYDKLIKIHDSKTYESVATLEGHTEKILTLDTSPISNLIVSSGWDRTVKIWDND 475

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 56/127 (44%), Gaps = 1/127 (0%)

Query: 69  SVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFD 128
           S+D        VS ++ H     + +   D   +LWD+  K  +L   GH   I  L F 
Sbjct: 267 SIDTLKGHQGRVSDVKLHPLGKYLGSSSFDNTWRLWDIEKKKEILLQEGHSKEIFSLAFH 326

Query: 129 KTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGLIKVW 187
             G+   +   DS  ++WDL S   +  L  H   I  L W  +   L + S DG IK+W
Sbjct: 327 TDGSLTATAGFDSIGMIWDLRSGKNIMNLIGHAKPIYSLDWAPNGYQLATGSGDGTIKIW 386

Query: 188 DLKTQQC 194
           DL+ ++ 
Sbjct: 387 DLRNKES 393

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 75/163 (46%), Gaps = 5/163 (3%)

Query: 72  LKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSK--TVLLSFNGHKSRITMLKFDK 129
            +++   ++  +++ ++   +  G  D ++K++       T + +  GH+ R++ +K   
Sbjct: 226 FQAAHVGKIGGIEWSNDEAYLFTGGEDCLVKVFGYEKNDLTSIDTLKGHQGRVSDVKLHP 285

Query: 130 TGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSK-DGLIKVWD 188
            G  L S S D+   +WD+  +  +     H   I  L   +D  L +T+  D +  +WD
Sbjct: 286 LGKYLGSSSFDNTWRLWDIEKKKEILLQEGHSKEIFSLAFHTDGSLTATAGFDSIGMIWD 345

Query: 189 LKTQQCIETHIAHTGECWALGIMTDF--VVTSSADSQLKIWQM 229
           L++ + I   I H    ++L    +   + T S D  +KIW +
Sbjct: 346 LRSGKNIMNLIGHAKPIYSLDWAPNGYQLATGSGDGTIKIWDL 388

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/218 (26%), Positives = 99/218 (45%), Gaps = 12/218 (5%)

Query: 469 EGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTS----DKYVPQMNIVHDSTL 524
           E  + SLD ++D     TG  D  IK W  +       GTS    ++   Q+N +  + +
Sbjct: 705 EKNMSSLDFSSDYTLAATGFQDSYIKIWSLE-------GTSINENEQNYSQINSIFKTLV 757

Query: 525 ELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISD-DTKV 583
              D + S+  S  ++FL     D T +++  D+ K  +S  GH+ P+  ++ S     +
Sbjct: 758 GHSDAVYSVNFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNL 817

Query: 584 IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKF 643
             T+S+D   ++W  D     + L  H   + CV F P     F+ S D   + WD    
Sbjct: 818 FATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSG 877

Query: 644 ECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
           + ++    H S V A AVS +G  + + + D +I +W+
Sbjct: 878 DSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVWD 915

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/234 (22%), Positives = 109/234 (46%), Gaps = 18/234 (7%)

Query: 449 NLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGT 508
           N Q +   +S+  T +   H  A++S++ +   + L++GS DK+ + W     + L++  
Sbjct: 742 NEQNYSQINSIFKTLV--GHSDAVYSVNFSPCNRFLLSGSGDKTARLWSTDTYKGLVS-- 797

Query: 509 SDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGH 568
              Y      + D         ++   +G++ F A +  DNT +V+  D +     L GH
Sbjct: 798 ---YKGHEKPIWD---------VNFSPTGNNLF-ATASSDNTARVWSCDRVYPVRILAGH 844

Query: 569 KLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFS 628
              V  +    + + + T S+DK  ++W L  GD  +    H  ++      P      +
Sbjct: 845 LSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLST 904

Query: 629 ASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHDHSIRIWE 681
           A++DG +  WD    + ++ +  H ++ +++L+ +  G  +VS   D+S+R+W+
Sbjct: 905 ANEDGTITVWDIGSGKKLKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWD 958

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 58/115 (50%), Gaps = 2/115 (1%)

Query: 78  AEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISG 137
           ++V  + FH     +  G +D   ++WDL S   +  F GH S +T       G  L + 
Sbjct: 846 SDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLSTA 905

Query: 138 SEDSNIIVWDLVSEVGLYKLRSH-KGTITGL-WCDSDNWLISTSKDGLIKVWDLK 190
           +ED  I VWD+ S   L  +R H K +I  L +  + N L+S+  D  ++VWD+K
Sbjct: 906 NEDGTITVWDIGSGKKLKSMRGHGKNSIYSLSYNKTGNILVSSGADNSVRVWDIK 960

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 71/151 (47%), Gaps = 10/151 (6%)

Query: 87  SETG--LIAAGYADGVIKLW--DLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSN 142
           S TG  L A   +D   ++W  D V    +L+  GH S +  + F   G  + +GS D  
Sbjct: 811 SPTGNNLFATASSDNTARVWSCDRVYPVRILA--GHLSDVDCVSFHPNGQYVFTGSSDKT 868

Query: 143 IIVWDLVSEVGLYKLRSHKGTITGLWCDSD-NWLISTSKDGLIKVWDLKTQQCIETHIAH 201
             +WDL S   +     H   +T      D  WL + ++DG I VWD+ + + +++   H
Sbjct: 869 SRMWDLSSGDSVRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIGSGKKLKSMRGH 928

Query: 202 -TGECWALGI--MTDFVVTSSADSQLKIWQM 229
                ++L      + +V+S AD+ +++W +
Sbjct: 929 GKNSIYSLSYNKTGNILVSSGADNSVRVWDI 959

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 68/182 (37%), Gaps = 17/182 (9%)

Query: 65  LPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVS-------------KTV 111
           LP  S+   ++    +S L F S+  L A G+ D  IK+W L                ++
Sbjct: 693 LPSVSMYTYTNTEKNMSSLDFSSDYTLAATGFQDSYIKIWSLEGTSINENEQNYSQINSI 752

Query: 112 LLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTI--TGLWC 169
             +  GH   +  + F      L+SGS D    +W   +  GL   + H+  I       
Sbjct: 753 FKTLVGHSDAVYSVNFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSP 812

Query: 170 DSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTG--ECWALGIMTDFVVTSSADSQLKIW 227
             +N   + S D   +VW       +     H    +C +      +V T S+D   ++W
Sbjct: 813 TGNNLFATASSDNTARVWSCDRVYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMW 872

Query: 228 QM 229
            +
Sbjct: 873 DL 874

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/213 (21%), Positives = 88/213 (41%), Gaps = 20/213 (9%)

Query: 80  VSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLI-SGS 138
           V  + F      + +G  D   +LW   +   L+S+ GH+  I  + F  TG  L  + S
Sbjct: 763 VYSVNFSPCNRFLLSGSGDKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNLFATAS 822

Query: 139 EDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDS----DNWLISTSKDGLIKVWDLKTQQC 194
            D+   VW       +Y +R   G ++ + C S      ++ + S D   ++WDL +   
Sbjct: 823 SDNTARVWSCDR---VYPVRILAGHLSDVDCVSFHPNGQYVFTGSSDKTSRMWDLSSGDS 879

Query: 195 IETHIAHTGECWALGIMTD--FVVTSSADSQLKIWQMDLEGEPGSKLIEKGAFEKQSKQR 252
           +   I H+    A  +  D  ++ T++ D  + +W +      G KL    +     K  
Sbjct: 880 VRLFIGHSSAVTATAVSPDGRWLSTANEDGTITVWDIG----SGKKL---KSMRGHGKNS 932

Query: 253 GLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKD 285
             S+ +  T +         AD +V ++ ++K+
Sbjct: 933 IYSLSYNKTGN---ILVSSGADNSVRVWDIKKN 962

>Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/309 (21%), Positives = 123/309 (39%), Gaps = 56/309 (18%)

Query: 383 LQGSRTDVRSIDISDDNALLATA-SNGELKIWNL-----NTKSCIRTFECGYA---LTCK 433
            Q +  D+  +D SDD  + A    +  +KIW+L     N  + +   E  Y     TCK
Sbjct: 462 FQNTNKDMSCLDFSDDCRVAAAGFQDSYIKIWSLDGSSLNNPNIVLNNETNYKDDDPTCK 521

Query: 434 FLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSI 493
            L G                              H G ++S   + D K L++GS DK++
Sbjct: 522 TLVG------------------------------HSGTVYSTSFSPDNKYLLSGSEDKTV 551

Query: 494 KFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKV 553
           + W       L++     Y    + V D           +  S    + A +  D T ++
Sbjct: 552 RLWSMDTHTALVS-----YKGHNHPVWD-----------VNFSPLGHYFATASHDQTARL 595

Query: 554 FFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDS 613
           +  D +       GH   V  +    +   + T S+DK  ++W +  GD  +    H   
Sbjct: 596 WSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAP 655

Query: 614 IMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVS 672
           ++ +   P      + S+DG +  WD    + ++++  H ++ +++L+ S  G  ++S  
Sbjct: 656 VISIAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGG 715

Query: 673 HDHSIRIWE 681
            DHS+R+W+
Sbjct: 716 ADHSVRVWD 724

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 59/127 (46%), Gaps = 1/127 (0%)

Query: 564 SLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGS 623
           +L GH   V S   S D K +++ S DK +++W +D      S   H   +  V F P  
Sbjct: 522 TLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLG 581

Query: 624 HNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE-E 682
           H F +AS D   + W  D    ++  A H ++V  ++   NG  + + S D + R+W   
Sbjct: 582 HYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVS 641

Query: 683 TDDQVFL 689
           T D V L
Sbjct: 642 TGDSVRL 648

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           +V  + FH     +  G +D   ++W++ +   +  F GH + +  +     G  L +GS
Sbjct: 613 DVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLGHTAPVISIAVSPDGRWLSTGS 672

Query: 139 EDSNIIVWDLVSEVGLYKLRSH-KGTITGL-WCDSDNWLISTSKDGLIKVWDLK 190
           ED  I VWD+ +   L ++R H K  I  L +    N LIS   D  ++VWDLK
Sbjct: 673 EDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLK 726

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 67/151 (44%), Gaps = 9/151 (5%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   + +G  D  ++LW + + T L+S+ GH   +  + F   G    + S D    
Sbjct: 535 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTAR 594

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDN----WLISTSKDGLIKVWDLKTQQCIETHIA 200
           +W   S   +Y LR   G +  + C S +    +L + S D   ++W++ T   +   + 
Sbjct: 595 LW---SCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSVRLFLG 651

Query: 201 HTGECWALGIMTD--FVVTSSADSQLKIWQM 229
           HT    ++ +  D  ++ T S D  + +W +
Sbjct: 652 HTAPVISIAVSPDGRWLSTGSEDGIINVWDI 682

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 82/206 (39%), Gaps = 18/206 (8%)

Query: 92  IAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSE 151
            A    D   +LW       L  F GH + +  + F   G  L +GS D    +W++ + 
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTG 643

Query: 152 VGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHTGEC-WALG 209
             +     H   +  +    D  WL + S+DG+I VWD+ T + ++    H     ++L 
Sbjct: 644 DSVRLFLGHTAPVISIAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLS 703

Query: 210 IMT--DFVVTSSADSQLKIWQM-----DLEGEPGSKLIE-----KGAFEKQSKQRGLSIE 257
                + +++  AD  +++W +     +   EP    I        +  +  K+ G    
Sbjct: 704 YSKEGNVLISGGADHSVRVWDLKKATTEPSAEPDEPFIGYLGDVTASINQDIKEYGRRRT 763

Query: 258 FTTTSDGVHFFYVQNADKTVEIFRLR 283
              TSD V  FY     K   +F+++
Sbjct: 764 VIPTSDLVASFYT----KKTPVFKVK 785

 Score = 55.5 bits (132), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 55/251 (21%), Positives = 108/251 (43%), Gaps = 31/251 (12%)

Query: 353 TNSNTIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNA-LLATASNGELK 411
            N N +      Y+  DPT  T        L G    V S   S DN  LL+ + +  ++
Sbjct: 501 NNPNIVLNNETNYKDDDPTCKT--------LVGHSGTVYSTSFSPDNKYLLSGSEDKTVR 552

Query: 412 IWNLNTKSCIRTFECGYALTC---KFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAH 468
           +W+++T + + +++ G+        F P G      + +   +L+     +    I A H
Sbjct: 553 LWSMDTHTALVSYK-GHNHPVWDVNFSPLGHYFATASHDQTARLWS-CDHIYPLRIFAGH 610

Query: 469 EGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGD 528
              +  +    +G  L TGS+DK+ + W+      +          ++ + H +      
Sbjct: 611 LNDVDCVSFHPNGCYLFTGSSDKTCRMWNVSTGDSV----------RLFLGHTAP----- 655

Query: 529 DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSLDISDDTKVIITS 587
            ++SI +S D ++L+    D  + V+ + + K    + GH K  + SL  S +  V+I+ 
Sbjct: 656 -VISIAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISG 714

Query: 588 SADKNIKIWGL 598
            AD ++++W L
Sbjct: 715 GADHSVRVWDL 725

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/173 (18%), Positives = 65/173 (37%), Gaps = 22/173 (12%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTV-------------------LLSFNGHK 119
           ++S L F  +  + AAG+ D  IK+W L   ++                     +  GH 
Sbjct: 468 DMSCLDFSDDCRVAAAGFQDSYIKIWSLDGSSLNNPNIVLNNETNYKDDDPTCKTLVGHS 527

Query: 120 SRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLIST 178
             +    F      L+SGSED  + +W + +   L   + H   +  + +    ++  + 
Sbjct: 528 GTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATA 587

Query: 179 SKDGLIKVWDLKTQQCIETHIAHTG--ECWALGIMTDFVVTSSADSQLKIWQM 229
           S D   ++W       +     H    +C +      ++ T S+D   ++W +
Sbjct: 588 SHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWNV 640

>KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 826

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 81/175 (46%), Gaps = 14/175 (8%)

Query: 529 DILSIKISGDDKFLAISLLDNTVKVFFLDSMKF-------------FLSLYGHKLPVLSL 575
           ++  ++ S D +  A    D+T+KV++LD                   +L GH  PV S+
Sbjct: 500 NMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSV 559

Query: 576 DISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFV 635
             S D + ++++S DK +++W LD   C      H   +  VKF P  H F +AS D   
Sbjct: 560 AFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTA 619

Query: 636 KYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE-ETDDQVFL 689
           + W  D    ++  + H ++V       NG  V + S D + R+W+ +T D V L
Sbjct: 620 RLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRL 674

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 102/236 (43%), Gaps = 9/236 (3%)

Query: 450 LQLFDLASSVLLTTIEAAHE--GAIWSLDVTNDGKRLVTGSADKSIKFW--DFQVKQELI 505
           +QL +L +S     +   H   G +  ++ ++D +    G  D +IK W  D    Q ++
Sbjct: 477 IQLKNLQTSAPSVCMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSIL 536

Query: 506 AGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSL 565
              +        +V  S       + S+  S D+++L  +  D TV+++ LD+    +  
Sbjct: 537 PSKAKDQSNSATLVGHS-----GPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCY 591

Query: 566 YGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN 625
            GH  PV  +  S      IT+S D+  ++W  D     +    H + + C  F P    
Sbjct: 592 KGHNHPVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCY 651

Query: 626 FFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
            F+ S D   + WD    + ++    H S V AL VS +G  + + S D +I +W+
Sbjct: 652 VFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWD 707

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/294 (18%), Positives = 120/294 (40%), Gaps = 34/294 (11%)

Query: 406 SNGELKIWNLNTKS---CIRTFE-CGYALTC-KFLPGGLLVVVGTREGNLQLFDLASSVL 460
           S   +++ NL T +   C+ TF      +TC +F     L   G ++  ++++ L  S L
Sbjct: 473 SRDSIQLKNLQTSAPSVCMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPL 532

Query: 461 LTTIEA------------AHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGT 508
            + + +             H G ++S+  + D + L++ S DK+++ W       L+   
Sbjct: 533 QSILPSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYK 592

Query: 509 SDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGH 568
              +                 +  +K S    +   +  D T +++  D +       GH
Sbjct: 593 GHNH----------------PVWYVKFSPLGHYFITASHDQTARLWSCDHIYPLRIFSGH 636

Query: 569 KLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFS 628
              V       +   + T S+DK  ++W +  GD  +    H   +  ++  P      +
Sbjct: 637 LNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTT 696

Query: 629 ASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHDHSIRIWE 681
            S+DG +  WD    + I+++  H ++ ++++  +  G  +V+   D S+R+W+
Sbjct: 697 GSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWD 750

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 84/194 (43%), Gaps = 18/194 (9%)

Query: 47  ISVWDLKTSELEYVLSDGLPPGSVDLKSS-----KPAEVSYLQFHSETGLIAAGYADGVI 101
           I VW L  S L+ +L    P  + D  +S         V  + F  +   + +   D  +
Sbjct: 522 IKVWYLDGSPLQSIL----PSKAKDQSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTV 577

Query: 102 KLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHK 161
           +LW L + T L+ + GH   +  +KF   G   I+ S D    +W   S   +Y LR   
Sbjct: 578 RLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFITASHDQTARLW---SCDHIYPLRIFS 634

Query: 162 GTITGLWCDSDN----WLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTD--FV 215
           G +  + C + +    ++ + S D   ++WD++T   +   + HT    AL +  D  ++
Sbjct: 635 GHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWL 694

Query: 216 VTSSADSQLKIWQM 229
            T S D  + +W +
Sbjct: 695 TTGSEDGTIIVWDI 708

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 57/108 (52%), Gaps = 2/108 (1%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           FH     +  G +D   ++WD+ +   +  F GH S +T L+    G  L +GSED  II
Sbjct: 645 FHPNGCYVFTGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTII 704

Query: 145 VWDLVSEVGLYKLRSH-KGTITGLWCDSD-NWLISTSKDGLIKVWDLK 190
           VWD+ +   + +++ H K  I  +  + + N L++   D  ++VWD+K
Sbjct: 705 VWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 107/227 (47%), Gaps = 23/227 (10%)

Query: 377 KAHTIELQGSRTDVRSIDISDDNALLATASNGE-LKIWNLNTKSCIRTFECGYALTC--- 432
           ++++  L G    V S+  S DN  L +AS  + +++W+L+T +C+  ++ G+       
Sbjct: 543 QSNSATLVGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYK-GHNHPVWYV 601

Query: 433 KFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKS 492
           KF P G   +  + +   +L+     +    I + H   +       +G  + TGS+DK+
Sbjct: 602 KFSPLGHYFITASHDQTARLWS-CDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKT 660

Query: 493 IKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVK 552
            + WD Q    +          ++ + H S       + ++++S D ++L     D T+ 
Sbjct: 661 CRMWDIQTGDSV----------RLFLGHTSP------VTALEVSPDGRWLTTGSEDGTII 704

Query: 553 VFFLDSMKFFLSLYGH-KLPVLSLDISDDTKVIITSSADKNIKIWGL 598
           V+ + + K    + GH K P+ S+  + +   ++T  AD+++++W +
Sbjct: 705 VWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDI 751

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/102 (23%), Positives = 52/102 (50%), Gaps = 4/102 (3%)

Query: 401 LLATASNGELKIWNLNTKSCIRTFECGYALTCKFL---PGGLLVVVGTREGNLQLFDLAS 457
           +   +S+   ++W++ T   +R F  G+      L   P G  +  G+ +G + ++D+ +
Sbjct: 652 VFTGSSDKTCRMWDIQTGDSVRLF-LGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGT 710

Query: 458 SVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQ 499
              +  ++   +  I+S+    +G  LVTG AD+S++ WD +
Sbjct: 711 GKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSVRVWDIK 752

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 55/136 (40%), Gaps = 16/136 (11%)

Query: 111 VLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDL-------------VSEVGLYKL 157
            + +F+     +T ++F        +G +DS I VW L               +     L
Sbjct: 490 CMYTFHNTNGNMTCVEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATL 549

Query: 158 RSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHTGECW--ALGIMTDF 214
             H G +  +    DN +L+S S+D  +++W L T  C+  +  H    W      +  +
Sbjct: 550 VGHSGPVYSVAFSPDNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHY 609

Query: 215 VVTSSADSQLKIWQMD 230
            +T+S D   ++W  D
Sbjct: 610 FITASHDQTARLWSCD 625

>NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON}
           Anc_7.534
          Length = 474

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 91/380 (23%), Positives = 163/380 (42%), Gaps = 57/380 (15%)

Query: 320 FVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEYYSVPYEKRDPTSPTPIKAH 379
           F++ P+ + RSM +++S+         L   +    NT    +   EK            
Sbjct: 134 FIL-PYSIDRSMKRLQSMK-----ERALNFDIGKEINTRRQLNQHLEK------------ 175

Query: 380 TIELQGSR-TDVRSID---ISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYALTCKF 434
            ++L GS+   +R I    +  DNAL AT S  G++KI +  T   I   E G+      
Sbjct: 176 -MQLVGSQIVSIRPISKVCLMSDNALCATGSWAGDIKILDTKTLDVISGIENGHDGKI-- 232

Query: 435 LPGGLL-------VVVGTREGNLQL--FDLASSVL--LTTIEAAHEGAIWSLDVTNDGKR 483
             GGL        +V G  +  +++  FD    ++  LT ++  H G + ++D    G+ 
Sbjct: 233 --GGLAWNSTNTHLVSGADDCLVKIHSFDPDVKIIKELTALQG-HTGRVVNVDFHPSGRF 289

Query: 484 LVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLA 543
           + + S D + + WD + + EL          Q    H      G ++ S+    D   L 
Sbjct: 290 VASASFDMTWRLWDIESETEL----------QFQEGH------GKEVYSLSFQNDGALLC 333

Query: 544 ISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDC 603
              LDN   V+ + + K  ++L GH  P+ S+D S D   I T   D  I IW +     
Sbjct: 334 SGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTE 393

Query: 604 HKSLFAHQDSIMCVKFLPGS-HNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVS 662
              L AH + +  V+F   + H   S   D  ++ +  D +  ++ L  H  ++  + +S
Sbjct: 394 TTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVKTLEGHTDKILDVDIS 453

Query: 663 DNGERVVSVSHDHSIRIWEE 682
           ++ + +VS   D S+++W++
Sbjct: 454 EDAQLIVSSGWDRSLKLWKQ 473

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 70/166 (42%), Gaps = 22/166 (13%)

Query: 78  AEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISG 137
             V  + FH     +A+   D   +LWD+ S+T L    GH   +  L F   G  L SG
Sbjct: 276 GRVVNVDFHPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSG 335

Query: 138 SEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST-SKDGLIKVWDLKTQQCIE 196
             D+  IVWD+ +   +  L+ H   I  +    D + I+T   DG+I +WD++      
Sbjct: 336 GLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDIRKTTETT 395

Query: 197 THIAH------------TGECWALGIMTDFVVTSSADSQLKIWQMD 230
             +AH            TG C         +V+   D Q++I+  D
Sbjct: 396 RLLAHNNIVTGVRFQKSTGHC---------LVSCGYDKQIRIYSSD 432

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 72/156 (46%), Gaps = 4/156 (2%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           EV  L F ++  L+ +G  D    +WD+ +   +++  GH   I  + +   G  + +G 
Sbjct: 319 EVYSLSFQNDGALLCSGGLDNAAIVWDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGG 378

Query: 139 EDSNIIVWDLVSEVGLYKLRSHKGTITGLWCD--SDNWLISTSKDGLIKVWDLKTQQCIE 196
            D  I +WD+       +L +H   +TG+     + + L+S   D  I+++       ++
Sbjct: 379 GDGVINIWDIRKTTETTRLLAHNNIVTGVRFQKSTGHCLVSCGYDKQIRIYSSDNWIQVK 438

Query: 197 THIAHTGECWALGIMTD--FVVTSSADSQLKIWQMD 230
           T   HT +   + I  D   +V+S  D  LK+W+ +
Sbjct: 439 TLEGHTDKILDVDISEDAQLIVSSGWDRSLKLWKQE 474

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 71/165 (43%), Gaps = 7/165 (4%)

Query: 72  LKSSKPAEVSYLQFHSETGLIAAGYADGVIKL--WDLVSKTV--LLSFNGHKSRITMLKF 127
           +++    ++  L ++S    + +G  D ++K+  +D   K +  L +  GH  R+  + F
Sbjct: 224 IENGHDGKIGGLAWNSTNTHLVSGADDCLVKIHSFDPDVKIIKELTALQGHTGRVVNVDF 283

Query: 128 DKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLI-STSKDGLIKV 186
             +G  + S S D    +WD+ SE  L     H   +  L   +D  L+ S   D    V
Sbjct: 284 HPSGRFVASASFDMTWRLWDIESETELQFQEGHGKEVYSLSFQNDGALLCSGGLDNAAIV 343

Query: 187 WDLKTQQCIETHIAHTGECWALGIMTD--FVVTSSADSQLKIWQM 229
           WD++T + I     H    +++    D   + T   D  + IW +
Sbjct: 344 WDVRTGKSIMNLQGHAKPIYSVDWSPDGYHIATGGGDGVINIWDI 388

>TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.544
           YBR198C
          Length = 812

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/305 (21%), Positives = 129/305 (42%), Gaps = 39/305 (12%)

Query: 383 LQGSRTDVRSIDISDDNALLATA-SNGELKIWNLNTKSCIRTFECGYALTCKFLPGGL-- 439
              +  D+ S++ SDD  L +T   +  +KIW+L+          G +L  KF       
Sbjct: 451 FHNTNQDMTSLEFSDDCRLASTGFQDSYIKIWSLD----------GTSLNTKFTQANKDR 500

Query: 440 -LVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
             + +  R       +L+++++       H G ++S   + D + L++GS DK+++ W  
Sbjct: 501 NRITITDRSLTHMDNELSATLI------GHSGTVYSTSFSPDNRYLISGSEDKTVRLWSL 554

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558
                L++     +                 I  ++ S    + A +  D T +++  D 
Sbjct: 555 DTHTALVSYKGHNHP----------------IWDVQFSPLGHYFATASHDQTARLWSCDH 598

Query: 559 MKFFLSLY-GHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCV 617
           + F L ++ GH   V  +    +   + T S+DK  ++W +  GD  +    H  +++  
Sbjct: 599 I-FPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVST 657

Query: 618 KFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHDHS 676
              P      + S DG +  WD    + ++ L  H ++ V++L  S  G  +VS   D S
Sbjct: 658 AVSPDGRWLTTGSDDGTINVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQS 717

Query: 677 IRIWE 681
           +R+W+
Sbjct: 718 VRVWD 722

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 61/127 (48%), Gaps = 1/127 (0%)

Query: 564 SLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGS 623
           +L GH   V S   S D + +I+ S DK +++W LD      S   H   I  V+F P  
Sbjct: 520 TLIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFSPLG 579

Query: 624 HNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE-E 682
           H F +AS D   + W  D    ++  A H ++V  ++   NG  V + S D + R+W+  
Sbjct: 580 HYFATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDIS 639

Query: 683 TDDQVFL 689
           T D V L
Sbjct: 640 TGDSVRL 646

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 54/113 (47%), Gaps = 2/113 (1%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           +V  + FH     +  G +D   ++WD+ +   +  F GH S +        G  L +GS
Sbjct: 611 DVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGS 670

Query: 139 EDSNIIVWDLVSEVGLYKLRSH-KGTITGL-WCDSDNWLISTSKDGLIKVWDL 189
           +D  I VWD+ S   L  LR H K  +  L +    N L+S+  D  ++VWDL
Sbjct: 671 DDGTINVWDIGSGKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 101/221 (45%), Gaps = 23/221 (10%)

Query: 383 LQGSRTDVRSIDISDDNALLATASNGE-LKIWNLNTKSCIRTFECGYALT---CKFLPGG 438
           L G    V S   S DN  L + S  + +++W+L+T + + +++ G+       +F P G
Sbjct: 521 LIGHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTALVSYK-GHNHPIWDVQFSPLG 579

Query: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
                 + +   +L+     +    I A H   +  +    +G  + TGS+DK+ + WD 
Sbjct: 580 HYFATASHDQTARLWS-CDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDI 638

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558
                +          ++ + H S       ++S  +S D ++L     D T+ V+ + S
Sbjct: 639 STGDSV----------RLFLGHTSA------VVSTAVSPDGRWLTTGSDDGTINVWDIGS 682

Query: 559 MKFFLSLYGH-KLPVLSLDISDDTKVIITSSADKNIKIWGL 598
            K   SL GH K  V SL  S +  ++++S AD+++++W L
Sbjct: 683 GKRLKSLRGHGKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 67/151 (44%), Gaps = 9/151 (5%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   + +G  D  ++LW L + T L+S+ GH   I  ++F   G    + S D    
Sbjct: 533 FSPDNRYLISGSEDKTVRLWSLDTHTALVSYKGHNHPIWDVQFSPLGHYFATASHDQTAR 592

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDN----WLISTSKDGLIKVWDLKTQQCIETHIA 200
           +W   S   ++ LR   G +  + C S +    ++ + S D   ++WD+ T   +   + 
Sbjct: 593 LW---SCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKTCRMWDISTGDSVRLFLG 649

Query: 201 HTGECWALGIMTD--FVVTSSADSQLKIWQM 229
           HT    +  +  D  ++ T S D  + +W +
Sbjct: 650 HTSAVVSTAVSPDGRWLTTGSDDGTINVWDI 680

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 63/151 (41%), Gaps = 4/151 (2%)

Query: 83  LQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSN 142
           +QF       A    D   +LW       L  F GH + +  + F   G  + +GS D  
Sbjct: 573 VQFSPLGHYFATASHDQTARLWSCDHIFPLRIFAGHLNDVDCVSFHPNGYYVFTGSSDKT 632

Query: 143 IIVWDLVSEVGLYKLRSHKGTITGLWCDSD-NWLISTSKDGLIKVWDLKTQQCIETHIAH 201
             +WD+ +   +     H   +       D  WL + S DG I VWD+ + + +++   H
Sbjct: 633 CRMWDISTGDSVRLFLGHTSAVVSTAVSPDGRWLTTGSDDGTINVWDIGSGKRLKSLRGH 692

Query: 202 -TGECWALGIMT--DFVVTSSADSQLKIWQM 229
                ++L      + +V+S AD  +++W +
Sbjct: 693 GKNAVYSLTYSKEGNLLVSSGADQSVRVWDL 723

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 70/158 (44%), Gaps = 23/158 (14%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSF---NGHKSRITMLKFDKTGTQLI 135
           +++ L+F  +  L + G+ D  IK+W L   ++   F   N  ++RIT+   D++ T + 
Sbjct: 457 DMTSLEFSDDCRLASTGFQDSYIKIWSLDGTSLNTKFTQANKDRNRITIT--DRSLTHM- 513

Query: 136 SGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQC 194
                 N +   L+          H GT+       DN +LIS S+D  +++W L T   
Sbjct: 514 -----DNELSATLI---------GHSGTVYSTSFSPDNRYLISGSEDKTVRLWSLDTHTA 559

Query: 195 IETHIAHTGECW--ALGIMTDFVVTSSADSQLKIWQMD 230
           + ++  H    W      +  +  T+S D   ++W  D
Sbjct: 560 LVSYKGHNHPIWDVQFSPLGHYFATASHDQTARLWSCD 597

>Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON}
           YBR198C (REAL)
          Length = 800

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 96/216 (44%), Gaps = 17/216 (7%)

Query: 467 AHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLEL 526
            H G +++   + D K L++GS DK+++ W       L++     Y    + V D     
Sbjct: 525 GHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVS-----YKGHNHPVWD----- 574

Query: 527 GDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIIT 586
                 +  S    + A +  D T +++  D +       GH   V  +    +   + T
Sbjct: 575 ------VNFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFT 628

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECI 646
            S+DK  ++W +  GD  +    H   ++C+   P      + S+DG +  WD    + +
Sbjct: 629 GSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRL 688

Query: 647 QKLAAH-QSEVWALAVSDNGERVVSVSHDHSIRIWE 681
           +++  H ++ +++L+ S  G  ++S   DHS+R+W+
Sbjct: 689 KQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWD 724

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 60/127 (47%), Gaps = 1/127 (0%)

Query: 564 SLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGS 623
           +L GH   V +   S D K +++ S DK +++W +D      S   H   +  V F P  
Sbjct: 522 TLVGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLG 581

Query: 624 HNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE-E 682
           H F +AS D   + W  D    ++  A H ++V  ++   NG  V + S D + R+W+  
Sbjct: 582 HYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVS 641

Query: 683 TDDQVFL 689
           T D V L
Sbjct: 642 TGDSVRL 648

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 75/164 (45%), Gaps = 7/164 (4%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           +V  + FH     +  G +D   ++WD+ +   +  F GH + +  +     G  L +GS
Sbjct: 613 DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVICIAVSPDGRWLSTGS 672

Query: 139 EDSNIIVWDLVSEVGLYKLRSH-KGTITGL-WCDSDNWLISTSKDGLIKVWDLKTQQCIE 196
           ED  I +WD+ +   L ++R H K  I  L +    N LIS   D  ++VWDLK      
Sbjct: 673 EDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDLKKAT--- 729

Query: 197 THIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLI 240
           T  +   E   +G + D  VT+S +  +K +       P S L+
Sbjct: 730 TEPSAEPEEPFIGYLGD--VTASINQDIKEYGRRRTVIPTSDLV 771

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 66/151 (43%), Gaps = 9/151 (5%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   + +G  D  ++LW + + T L+S+ GH   +  + F   G    + S D    
Sbjct: 535 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFATASHDQTAR 594

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDN----WLISTSKDGLIKVWDLKTQQCIETHIA 200
           +W   S   +Y LR   G +  + C S +    ++ + S D   ++WD+ T   +   + 
Sbjct: 595 LW---SCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 651

Query: 201 HTGECWALGIMTD--FVVTSSADSQLKIWQM 229
           HT     + +  D  ++ T S D  + IW +
Sbjct: 652 HTAPVICIAVSPDGRWLSTGSEDGIINIWDI 682

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 82/206 (39%), Gaps = 18/206 (8%)

Query: 92  IAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSE 151
            A    D   +LW       L  F GH + +  + F   G  + +GS D    +WD+ + 
Sbjct: 584 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 643

Query: 152 VGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHTGEC-WALG 209
             +     H   +  +    D  WL + S+DG+I +WD+ T + ++    H     ++L 
Sbjct: 644 DSVRLFLGHTAPVICIAVSPDGRWLSTGSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLS 703

Query: 210 IMT--DFVVTSSADSQLKIWQM-----DLEGEPGSKLIE-----KGAFEKQSKQRGLSIE 257
                + +++  AD  +++W +     +   EP    I        +  +  K+ G    
Sbjct: 704 YSKEGNVLISGGADHSVRVWDLKKATTEPSAEPEEPFIGYLGDVTASINQDIKEYGRRRT 763

Query: 258 FTTTSDGVHFFYVQNADKTVEIFRLR 283
              TSD V  FY     K   +F+++
Sbjct: 764 VIPTSDLVASFYT----KKTPVFKVK 785

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 102/235 (43%), Gaps = 31/235 (13%)

Query: 369 DPTSPTPIKAHTIELQGSRTDVRSIDISDDNA-LLATASNGELKIWNLNTKSCIRTFECG 427
           DPT  T        L G    V +   S DN  LL+ + +  +++W+++T + + +++ G
Sbjct: 517 DPTCKT--------LVGHSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYK-G 567

Query: 428 YALTC---KFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRL 484
           +        F P G      + +   +L+     +    I A H   +  +    +G  +
Sbjct: 568 HNHPVWDVNFSPLGHYFATASHDQTARLWS-CDHIYPLRIFAGHLNDVDCVSFHPNGCYV 626

Query: 485 VTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAI 544
            TGS+DK+ + WD      +          ++ + H +       ++ I +S D ++L+ 
Sbjct: 627 FTGSSDKTCRMWDVSTGDSV----------RLFLGHTAP------VICIAVSPDGRWLST 670

Query: 545 SLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSLDISDDTKVIITSSADKNIKIWGL 598
              D  + ++ + + K    + GH K  + SL  S +  V+I+  AD ++++W L
Sbjct: 671 GSEDGIINIWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHSVRVWDL 725

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/175 (18%), Positives = 65/175 (37%), Gaps = 24/175 (13%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLL---------------------SFNG 117
           ++S L F  +  + AAG+ D  IK+W L   ++                       +  G
Sbjct: 466 DMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIMPNINNSDHKDADDPTCKTLVG 525

Query: 118 HKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLI 176
           H   +    F      L+SGSED  + +W + +   L   + H   +  + +    ++  
Sbjct: 526 HSGTVYATSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVNFSPLGHYFA 585

Query: 177 STSKDGLIKVWDLKTQQCIETHIAHTG--ECWALGIMTDFVVTSSADSQLKIWQM 229
           + S D   ++W       +     H    +C +      +V T S+D   ++W +
Sbjct: 586 TASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDV 640

>NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {ON}
           Anc_8.544
          Length = 822

 Score = 81.6 bits (200), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 61/284 (21%), Positives = 116/284 (40%), Gaps = 38/284 (13%)

Query: 420 CIRTFEC--GYALTCKFLPGGLLVVVGTREGNLQLFDLASSVL----------------- 460
           C+ TF    G   + +F     LV  G ++  ++L+ L  S L                 
Sbjct: 479 CMYTFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMN 538

Query: 461 --LTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNI 518
              +T    H GA++S   + D + L++GS DK+++ W       L++     Y    + 
Sbjct: 539 DNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVS-----YKGHNHP 593

Query: 519 VHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDIS 578
           V D           ++ S    + A +  D T +++  D +       GH   V  +   
Sbjct: 594 VWD-----------VQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFH 642

Query: 579 DDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYW 638
            +   + T S+DK  ++W +  GD  +    H   ++C    P      + S+DG +  W
Sbjct: 643 PNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLW 702

Query: 639 DGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHDHSIRIWE 681
           D    + ++ +  H ++ + +L+    G  +VS   DHS+R+W+
Sbjct: 703 DIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWD 746

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 80/181 (44%), Gaps = 21/181 (11%)

Query: 530 ILSIKISGDDKFLAISLLDNTVKVFFLD--SMKFF------------------LSLYGHK 569
           + S++ S D + +A    D+ +K++ LD  S+K                     +L GH 
Sbjct: 490 MTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLIGHS 549

Query: 570 LPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSA 629
             V S   S D + +++ S DK +++W  D      S   H   +  V+F P  H F +A
Sbjct: 550 GAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATA 609

Query: 630 SKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE-ETDDQVF 688
           S D   + W  D    ++  A H S+V  ++   NG  V + S D + R+W+  T D V 
Sbjct: 610 SHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVR 669

Query: 689 L 689
           L
Sbjct: 670 L 670

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 56/115 (48%), Gaps = 2/115 (1%)

Query: 78  AEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISG 137
           ++V  + FH     +  G +D   ++WD+ +   +  F GH + +        G  L +G
Sbjct: 634 SDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATG 693

Query: 138 SEDSNIIVWDLVSEVGLYKLRSH-KGTITGL-WCDSDNWLISTSKDGLIKVWDLK 190
           SED  I +WD+ +   L  +R H K  I  L +C   N L+S   D  ++VWDLK
Sbjct: 694 SEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK 748

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 67/165 (40%), Gaps = 5/165 (3%)

Query: 83  LQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSN 142
           +QF       A    D   +LW       L  F GH S +  + F   G  + +GS D  
Sbjct: 597 VQFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLSDVDCVSFHPNGCYVFTGSSDKT 656

Query: 143 IIVWDLVSEVGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAH 201
             +WD+ +   +     H   +       D  WL + S+DG+I +WD+ T + ++    H
Sbjct: 657 CRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWLATGSEDGIINLWDIGTAKRLKVMRGH 716

Query: 202 TGEC---WALGIMTDFVVTSSADSQLKIWQMDLE-GEPGSKLIEK 242
                   +     + +V+  AD  +++W +     EPG +  E+
Sbjct: 717 GKNAIHSLSYCKEGNVLVSGGADHSVRVWDLKKSTAEPGPEPEEQ 761

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 84/197 (42%), Gaps = 17/197 (8%)

Query: 47  ISVWDLKTSELEYVL---SDGLPPGSVDLKSS-----KPAEVSYLQFHSETGLIAAGYAD 98
           I +W L  S L+ +    +D +  G ++  +S         V    F  +   + +G  D
Sbjct: 511 IKLWSLDGSSLKQIQEKSADSINTGDMNDNTSTTLIGHSGAVYSTSFSPDNRYLLSGSED 570

Query: 99  GVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLR 158
             ++LW   + T L+S+ GH   +  ++F   G    + S D    +W   S   +Y LR
Sbjct: 571 KTVRLWSTDTYTSLVSYKGHNHPVWDVQFSPLGHYFATASHDQTARLW---SCDHIYPLR 627

Query: 159 SHKGTITGLWCDSDN----WLISTSKDGLIKVWDLKTQQCIETHIAHTGE--CWALGIMT 212
              G ++ + C S +    ++ + S D   ++WD+ T   +   + HT    C A+    
Sbjct: 628 IFAGHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDG 687

Query: 213 DFVVTSSADSQLKIWQM 229
            ++ T S D  + +W +
Sbjct: 688 RWLATGSEDGIINLWDI 704

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 57/118 (48%), Gaps = 3/118 (2%)

Query: 385 GSRTDVRSIDISDDNALLATASNGE-LKIWNLNTKSCIRTF--ECGYALTCKFLPGGLLV 441
           G  +DV  +    +   + T S+ +  ++W+++T   +R F       L     P G  +
Sbjct: 631 GHLSDVDCVSFHPNGCYVFTGSSDKTCRMWDISTGDSVRLFLGHTAPVLCTAVSPDGRWL 690

Query: 442 VVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQ 499
             G+ +G + L+D+ ++  L  +    + AI SL    +G  LV+G AD S++ WD +
Sbjct: 691 ATGSEDGIINLWDIGTAKRLKVMRGHGKNAIHSLSYCKEGNVLVSGGADHSVRVWDLK 748

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 62/156 (39%), Gaps = 26/156 (16%)

Query: 101 IKLWDL---VSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDL--------- 148
           IKL +L   +    + +F+     +T L+F +    + +G +DS I +W L         
Sbjct: 466 IKLDNLQAALPSVCMYTFHNTNGGMTSLQFSEDSRLVAAGFQDSYIKLWSLDGSSLKQIQ 525

Query: 149 -----------VSEVGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIE 196
                      +++     L  H G +       DN +L+S S+D  +++W   T   + 
Sbjct: 526 EKSADSINTGDMNDNTSTTLIGHSGAVYSTSFSPDNRYLLSGSEDKTVRLWSTDTYTSLV 585

Query: 197 THIAHTGECW--ALGIMTDFVVTSSADSQLKIWQMD 230
           ++  H    W      +  +  T+S D   ++W  D
Sbjct: 586 SYKGHNHPVWDVQFSPLGHYFATASHDQTARLWSCD 621

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 63/294 (21%), Positives = 123/294 (41%), Gaps = 34/294 (11%)

Query: 406 SNGELKIWNLNTKS---CIRTFE-CGYALTC-KFLPGGLLVVVGTREGNLQLFDLASSVL 460
           S   +K+ NL + +   C+ TF      +TC +F     L   G ++  ++L+ L  + L
Sbjct: 396 SRDAIKLDNLQSAAPSVCMYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPL 455

Query: 461 LTTIEA------------AHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGT 508
            + + +             H G ++S   + D K L++ S DK+++ W       L++  
Sbjct: 456 DSKLPSKQREKINNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVS-- 513

Query: 509 SDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGH 568
              Y    + V D           +  S    + A +  D T +++  D +       GH
Sbjct: 514 ---YKGHNHPVWD-----------VSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGH 559

Query: 569 KLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFS 628
              V  +    +   + T S DK  ++W +  GD  +    H   ++     P      +
Sbjct: 560 LNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLST 619

Query: 629 ASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHDHSIRIWE 681
            S+DG +  WD    + ++++  H ++ V++L+ S  G  +VS   DHS+R+W+
Sbjct: 620 GSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWD 673

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 76/175 (43%), Gaps = 14/175 (8%)

Query: 529 DILSIKISGDDKFLAISLLDNTVKVFFLDSMKF-------------FLSLYGHKLPVLSL 575
           D+  ++ S D    A    D+ +K++ LD                   +L GH   V S 
Sbjct: 423 DMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLIGHSGTVYST 482

Query: 576 DISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFV 635
             S D K ++++S DK +++W +D      S   H   +  V F P  H F +AS D   
Sbjct: 483 SFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTA 542

Query: 636 KYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE-ETDDQVFL 689
           + W  D    ++  A H ++V  ++   NG  V + S D + R+W+  T D V L
Sbjct: 543 RLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRL 597

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 61/142 (42%), Gaps = 4/142 (2%)

Query: 92  IAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSE 151
            A    D   +LW       L  F GH + +  + F   GT + +GS D    +WD+ + 
Sbjct: 533 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTG 592

Query: 152 VGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAH-TGECWALG 209
             +     H   +       D  WL + S+DG+I VWD+ T + ++    H     ++L 
Sbjct: 593 DSVRLFLGHTAPVISTAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLS 652

Query: 210 IMTD--FVVTSSADSQLKIWQM 229
              +   +V+  AD  +++W +
Sbjct: 653 YSKEGTVLVSGGADHSVRVWDL 674

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 53/114 (46%), Gaps = 2/114 (1%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           +V  + FH     +  G  D   ++WD+ +   +  F GH + +        G  L +GS
Sbjct: 562 DVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWLSTGS 621

Query: 139 EDSNIIVWDLVSEVGLYKLRSH-KGTITGL-WCDSDNWLISTSKDGLIKVWDLK 190
           ED  I VWD+ +   L ++R H K  +  L +      L+S   D  ++VWDLK
Sbjct: 622 EDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWDLK 675

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 69/151 (45%), Gaps = 5/151 (3%)

Query: 383 LQGSRTDVRSIDISDDNALLATASNGE-LKIWNLNTKSCIRTF--ECGYALTCKFLPGGL 439
             G   DV  +    +   + T S  +  ++W++ T   +R F       ++    P G 
Sbjct: 556 FAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLGHTAPVISTAVSPDGR 615

Query: 440 LVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQ 499
            +  G+ +G + ++D+ +   L  +    + A++SL  + +G  LV+G AD S++ WD  
Sbjct: 616 WLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGTVLVSGGADHSVRVWD-- 673

Query: 500 VKQELIAGTSDKYVPQMNIVHDSTLELGDDI 530
           +K+      ++   P  +   D+T  + +DI
Sbjct: 674 LKRSTAEPNTEPEQPFTSYFGDATTSVNNDI 704

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 64/151 (42%), Gaps = 9/151 (5%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   + +   D  ++LW + + + L+S+ GH   +  + F   G    + S D    
Sbjct: 484 FSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHDQTAR 543

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDS----DNWLISTSKDGLIKVWDLKTQQCIETHIA 200
           +W   S   +Y LR   G +  + C S      ++ + S D   ++WD+ T   +   + 
Sbjct: 544 LW---SCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDIGTGDSVRLFLG 600

Query: 201 HTGECWALGIMTD--FVVTSSADSQLKIWQM 229
           HT    +  +  D  ++ T S D  + +W +
Sbjct: 601 HTAPVISTAVSPDGRWLSTGSEDGIINVWDI 631

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 66/170 (38%), Gaps = 22/170 (12%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDL----------------VSKTVLLSFNGHKSRI 122
           +++ L+F  +  L AAG+ D  IKLW L                ++ T L+   GH   +
Sbjct: 423 DMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSKLPSKQREKINNTTLI---GHSGTV 479

Query: 123 TMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKD 181
               F      L+S SED  + +W + +   L   + H   +  + +    ++  + S D
Sbjct: 480 YSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHNHPVWDVSFSPLGHYFATASHD 539

Query: 182 GLIKVWDLKTQQCIETHIAHTG--ECWALGIMTDFVVTSSADSQLKIWQM 229
              ++W       +     H    +C +      +V T S D   ++W +
Sbjct: 540 QTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGTYVFTGSTDKTCRMWDI 589

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 63/150 (42%), Gaps = 19/150 (12%)

Query: 100 VIKLWDLVSKT---VLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYK 156
            IKL +L S      + +F+     +T L+F    T   +G +DS I +W L       K
Sbjct: 399 AIKLDNLQSAAPSVCMYTFHNTNRDMTCLEFSDDATLAAAGFQDSYIKLWSLDGTPLDSK 458

Query: 157 LRS-------------HKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHT 202
           L S             H GT+       DN +L+S S+D  +++W + T   + ++  H 
Sbjct: 459 LPSKQREKINNTTLIGHSGTVYSTSFSPDNKYLLSASEDKTVRLWSMDTYSSLVSYKGHN 518

Query: 203 GECW--ALGIMTDFVVTSSADSQLKIWQMD 230
              W  +   +  +  T+S D   ++W  D
Sbjct: 519 HPVWDVSFSPLGHYFATASHDQTARLWSCD 548

>CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa]
           {ON} similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198c Transcription initiation factor TFIID 90
          Length = 806

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/301 (22%), Positives = 122/301 (40%), Gaps = 41/301 (13%)

Query: 383 LQGSRTDVRSIDISDDNALLATA-SNGELKIWNLNTKSCIRTFECGYALTCKFLPGGLLV 441
              +  D+ S++ SDD  L A    +  +KIW+L+  S I           K+       
Sbjct: 469 FHNTNRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINP---------KY------- 512

Query: 442 VVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVK 501
                  +   FD  S     +    H G ++S   + D   LV+GS DK++K W     
Sbjct: 513 -------SSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTH 565

Query: 502 QELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKF 561
             L+      Y    + V D           +K S    + A +  D T +++  D +  
Sbjct: 566 TALV-----NYKGHNHPVWD-----------VKFSPLGHYFASASHDQTARLWACDHIYP 609

Query: 562 FLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLP 621
                GH   V ++    +   + T S+DK  ++W +  GD  +    H   ++  +  P
Sbjct: 610 LRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSP 669

Query: 622 GSHNFFSASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHDHSIRIW 680
                 + S+DG +  WD    + I+++  H ++ V +L+ +  G  ++S   DHS+R+W
Sbjct: 670 DGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVW 729

Query: 681 E 681
           +
Sbjct: 730 D 730

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/180 (27%), Positives = 76/180 (42%), Gaps = 19/180 (10%)

Query: 529 DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLY------------------GHKL 570
           D+ S++ S D +  A    D+ +K++ LD        Y                  GH  
Sbjct: 475 DMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSG 534

Query: 571 PVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSAS 630
            V S   S D   +++ S DK +K+W +D      +   H   +  VKF P  H F SAS
Sbjct: 535 TVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASAS 594

Query: 631 KDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE-ETDDQVFL 689
            D   + W  D    ++  A H ++V  ++   NG  V + S D + R+W+  T D V L
Sbjct: 595 HDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRL 654

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 82/183 (44%), Gaps = 23/183 (12%)

Query: 46  NISVWDLKTSELEYVLS-------------DGLPPGSVDLKSSKPAEVSYLQFHSETGLI 92
           N  VWD+K S L +  +             D + P  + + +    +V  + FH     +
Sbjct: 575 NHPVWDVKFSPLGHYFASASHDQTARLWACDHIYP--LRIFAGHTNDVDTVSFHPNGCYV 632

Query: 93  AAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEV 152
             G +D   ++WD+ +   +  F GH + +   +    G  L +GSED  I +WD+ +  
Sbjct: 633 FTGSSDKTCRMWDVSTGDSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGK 692

Query: 153 GLYKLRSH-KGTITGLWCDSD-NWLISTSKDGLIKVWDLK---TQQCIETHI---AHTGE 204
            + ++R H K  +  L  + + N LIS   D  ++VWD+K   T+Q  E      AH G+
Sbjct: 693 RIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDVKHGTTEQGPEPEQPFNAHVGD 752

Query: 205 CWA 207
             A
Sbjct: 753 ITA 755

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 64/151 (42%), Gaps = 9/151 (5%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   + +G  D  +KLW + + T L+++ GH   +  +KF   G    S S D    
Sbjct: 541 FSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTAR 600

Query: 145 VWDLVSEVGLYKLRSHKGTITGL----WCDSDNWLISTSKDGLIKVWDLKTQQCIETHIA 200
           +W       +Y LR   G    +    +  +  ++ + S D   ++WD+ T   +   + 
Sbjct: 601 LWACDH---IYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 657

Query: 201 HTGECWALGIMTD--FVVTSSADSQLKIWQM 229
           HT    +  +  D  ++ T S D  + +W +
Sbjct: 658 HTAPVLSTQVSPDGRWLATGSEDGVICLWDI 688

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 59/142 (41%), Gaps = 4/142 (2%)

Query: 92  IAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSE 151
            A+   D   +LW       L  F GH + +  + F   G  + +GS D    +WD+ + 
Sbjct: 590 FASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTG 649

Query: 152 VGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHTGEC---WA 207
             +     H   +       D  WL + S+DG+I +WD+ T + I+    H        +
Sbjct: 650 DSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLS 709

Query: 208 LGIMTDFVVTSSADSQLKIWQM 229
                + +++  AD  +++W +
Sbjct: 710 FNKEGNVLISGGADHSVRVWDV 731

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/172 (19%), Positives = 68/172 (39%), Gaps = 21/172 (12%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVL------------------LSFNGHKS 120
           +++ L+F  +  L AAG+ D  IK+W L   +++                   +  GH  
Sbjct: 475 DMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSG 534

Query: 121 RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTS 179
            +    F      L+SGSED  + +W + +   L   + H   +  + +    ++  S S
Sbjct: 535 TVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASAS 594

Query: 180 KDGLIKVWDLKTQQCIETHIAHTGECWALGIMTD--FVVTSSADSQLKIWQM 229
            D   ++W       +     HT +   +    +  +V T S+D   ++W +
Sbjct: 595 HDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDV 646

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 61/155 (39%), Gaps = 24/155 (15%)

Query: 100 VIKLWDL---VSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDL-------- 148
            IKL +L   +    + +F+     +T L+F        +G +DS I +W L        
Sbjct: 451 AIKLDNLQAALPSVCMYTFHNTNRDMTSLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINP 510

Query: 149 ---VSEVGLYK-------LRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIET 197
               S+   +        L  H GT+       DN +L+S S+D  +K+W + T   +  
Sbjct: 511 KYSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPDNMYLVSGSEDKTVKLWSMDTHTALVN 570

Query: 198 HIAHTGECW--ALGIMTDFVVTSSADSQLKIWQMD 230
           +  H    W      +  +  ++S D   ++W  D
Sbjct: 571 YKGHNHPVWDVKFSPLGHYFASASHDQTARLWACD 605

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 102/231 (44%), Gaps = 22/231 (9%)

Query: 459 VLLTTIEAAHEGAIWSLDVTNDGKR--LVTGSADKSIKFWDFQVKQELIAGTSDKYVPQM 516
           VL  T+E  H G + SL  T+ G+   L++ S DK++  W      +        +    
Sbjct: 8   VLRGTLEG-HNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHS 65

Query: 517 NIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLD 576
           +IV D TL           + D  +   +  D T++++ + + + +    GHK  V+S+D
Sbjct: 66  HIVQDCTL-----------TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVD 114

Query: 577 ISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPG------SHNFFSAS 630
           I     +II+ S DK IK+W +  G C  +L  H D +  V+ +P       S    SA 
Sbjct: 115 IDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAG 173

Query: 631 KDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
            D  VK W+ ++F+       H S +  L  S +G  + S   D  I +W 
Sbjct: 174 NDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 84/194 (43%), Gaps = 24/194 (12%)

Query: 477 VTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS 536
           +T DG   ++ S DK+++ WD          T + Y  Q  + H S      D++S+ I 
Sbjct: 73  LTADGAYALSASWDKTLRLWDV--------ATGETY--QRFVGHKS------DVMSVDID 116

Query: 537 GDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDI------SDDTKVIITSSAD 590
                +     D T+KV+ +   +   +L GH   V  + +       DD+  II++  D
Sbjct: 117 KKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGND 175

Query: 591 KNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLA 650
           K +K W L+          H  +I  +   P      SA KDG +  W+    + +  L+
Sbjct: 176 KMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLS 235

Query: 651 AHQSEVWALAVSDN 664
           A Q EV++LA S N
Sbjct: 236 A-QDEVFSLAFSPN 248

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 61/141 (43%), Gaps = 10/141 (7%)

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKL 157
           D  ++LWD+ +      F GHKS +  +  DK  + +ISGS D  I VW +  +  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 158 RSHKGTITGLWC-------DSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGI 210
             H   ++ +         D    +IS   D ++K W+L   Q     I H      L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 211 MTDFVVTSSA--DSQLKIWQM 229
             D  + +SA  D ++ +W +
Sbjct: 205 SPDGTLIASAGKDGEIMLWNL 225

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 2/106 (1%)

Query: 91  LIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVS 150
           +I+AG  D ++K W+L    +   F GH S I  L     GT + S  +D  I++W+L +
Sbjct: 169 IISAGN-DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAA 227

Query: 151 EVGLYKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIE 196
           +  +Y L +     +  +  +  WL + +  G IKV+ L  Q  ++
Sbjct: 228 KKAMYTLSAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 65/159 (40%), Gaps = 27/159 (16%)

Query: 363 VPYEKRDPTSPTPIKAHT---------------IELQGSRTDVRSIDISDDNALLATAS- 406
           VP EK D  S T I A                  +  G  +++ ++  S D  L+A+A  
Sbjct: 157 VPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGK 216

Query: 407 NGELKIWNLNTKSCIRTFEC-GYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTI- 464
           +GE+ +WNL  K  + T        +  F P    +   T  G +++F L    L+  + 
Sbjct: 217 DGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLR 275

Query: 465 -------EAAHEGAIWSLDVTNDGKRLVTGSADKSIKFW 496
                  +AA   A+ SL  + DG+ L  G  D  I+ W
Sbjct: 276 PEFAGYSKAAEPHAV-SLAWSADGQTLFAGYTDNVIRVW 313

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 2/89 (2%)

Query: 114 SFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSD- 172
           SF GH   +        G   +S S D  + +WD+ +     +   HK  +  +  D   
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 173 NWLISTSKDGLIKVWDLKTQQCIETHIAH 201
           + +IS S+D  IKVW +K  QC+ T + H
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGH 147

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 102/231 (44%), Gaps = 22/231 (9%)

Query: 459 VLLTTIEAAHEGAIWSLDVTNDGKR--LVTGSADKSIKFWDFQVKQELIAGTSDKYVPQM 516
           VL  T+E  H G + SL  T+ G+   L++ S DK++  W      +        +    
Sbjct: 8   VLRGTLEG-HNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHS 65

Query: 517 NIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLD 576
           +IV D TL           + D  +   +  D T++++ + + + +    GHK  V+S+D
Sbjct: 66  HIVQDCTL-----------TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVD 114

Query: 577 ISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPG------SHNFFSAS 630
           I     +II+ S DK IK+W +  G C  +L  H D +  V+ +P       S    SA 
Sbjct: 115 IDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAG 173

Query: 631 KDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
            D  VK W+ ++F+       H S +  L  S +G  + S   D  I +W 
Sbjct: 174 NDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 84/194 (43%), Gaps = 24/194 (12%)

Query: 477 VTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS 536
           +T DG   ++ S DK+++ WD          T + Y  Q  + H S      D++S+ I 
Sbjct: 73  LTADGAYALSASWDKTLRLWDV--------ATGETY--QRFVGHKS------DVMSVDID 116

Query: 537 GDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDI------SDDTKVIITSSAD 590
                +     D T+KV+ +   +   +L GH   V  + +       DD+  II++  D
Sbjct: 117 KKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGND 175

Query: 591 KNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLA 650
           K +K W L+          H  +I  +   P      SA KDG +  W+    + +  L+
Sbjct: 176 KMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLS 235

Query: 651 AHQSEVWALAVSDN 664
           A Q EV++LA S N
Sbjct: 236 A-QDEVFSLAFSPN 248

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 61/141 (43%), Gaps = 10/141 (7%)

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKL 157
           D  ++LWD+ +      F GHKS +  +  DK  + +ISGS D  I VW +  +  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 158 RSHKGTITGLWC-------DSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGI 210
             H   ++ +         D    +IS   D ++K W+L   Q     I H      L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 211 MTDFVVTSSA--DSQLKIWQM 229
             D  + +SA  D ++ +W +
Sbjct: 205 SPDGTLIASAGKDGEIMLWNL 225

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 2/106 (1%)

Query: 91  LIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVS 150
           +I+AG  D ++K W+L    +   F GH S I  L     GT + S  +D  I++W+L +
Sbjct: 169 IISAGN-DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAA 227

Query: 151 EVGLYKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIE 196
           +  +Y L +     +  +  +  WL + +  G IKV+ L  Q  ++
Sbjct: 228 KKAMYTLSAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 65/159 (40%), Gaps = 27/159 (16%)

Query: 363 VPYEKRDPTSPTPIKAHT---------------IELQGSRTDVRSIDISDDNALLATAS- 406
           VP EK D  S T I A                  +  G  +++ ++  S D  L+A+A  
Sbjct: 157 VPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGK 216

Query: 407 NGELKIWNLNTKSCIRTFEC-GYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTI- 464
           +GE+ +WNL  K  + T        +  F P    +   T  G +++F L    L+  + 
Sbjct: 217 DGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLR 275

Query: 465 -------EAAHEGAIWSLDVTNDGKRLVTGSADKSIKFW 496
                  +AA   A+ SL  + DG+ L  G  D  I+ W
Sbjct: 276 PEFAGYSKAAEPHAV-SLAWSADGQTLFAGYTDNVIRVW 313

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 2/89 (2%)

Query: 114 SFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSD- 172
           SF GH   +        G   +S S D  + +WD+ +     +   HK  +  +  D   
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 173 NWLISTSKDGLIKVWDLKTQQCIETHIAH 201
           + +IS S+D  IKVW +K  QC+ T + H
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGH 147

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 102/231 (44%), Gaps = 22/231 (9%)

Query: 459 VLLTTIEAAHEGAIWSLDVTNDGKR--LVTGSADKSIKFWDFQVKQELIAGTSDKYVPQM 516
           VL  T+E  H G + SL  T+ G+   L++ S DK++  W      +        +    
Sbjct: 8   VLRGTLEG-HNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHS 65

Query: 517 NIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLD 576
           +IV D TL           + D  +   +  D T++++ + + + +    GHK  V+S+D
Sbjct: 66  HIVQDCTL-----------TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVD 114

Query: 577 ISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPG------SHNFFSAS 630
           I     +II+ S DK IK+W +  G C  +L  H D +  V+ +P       S    SA 
Sbjct: 115 IDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAG 173

Query: 631 KDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
            D  VK W+ ++F+       H S +  L  S +G  + S   D  I +W 
Sbjct: 174 NDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 84/194 (43%), Gaps = 24/194 (12%)

Query: 477 VTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS 536
           +T DG   ++ S DK+++ WD          T + Y  Q  + H S      D++S+ I 
Sbjct: 73  LTADGAYALSASWDKTLRLWDV--------ATGETY--QRFVGHKS------DVMSVDID 116

Query: 537 GDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDI------SDDTKVIITSSAD 590
                +     D T+KV+ +   +   +L GH   V  + +       DD+  II++  D
Sbjct: 117 KKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGND 175

Query: 591 KNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLA 650
           K +K W L+          H  +I  +   P      SA KDG +  W+    + +  L+
Sbjct: 176 KMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLS 235

Query: 651 AHQSEVWALAVSDN 664
           A Q EV++LA S N
Sbjct: 236 A-QDEVFSLAFSPN 248

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 61/141 (43%), Gaps = 10/141 (7%)

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKL 157
           D  ++LWD+ +      F GHKS +  +  DK  + +ISGS D  I VW +  +  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 158 RSHKGTITGLWC-------DSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGI 210
             H   ++ +         D    +IS   D ++K W+L   Q     I H      L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 211 MTDFVVTSSA--DSQLKIWQM 229
             D  + +SA  D ++ +W +
Sbjct: 205 SPDGTLIASAGKDGEIMLWNL 225

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 2/106 (1%)

Query: 91  LIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVS 150
           +I+AG  D ++K W+L    +   F GH S I  L     GT + S  +D  I++W+L +
Sbjct: 169 IISAGN-DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAA 227

Query: 151 EVGLYKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIE 196
           +  +Y L +     +  +  +  WL + +  G IKV+ L  Q  ++
Sbjct: 228 KKAMYTLSAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 65/159 (40%), Gaps = 27/159 (16%)

Query: 363 VPYEKRDPTSPTPIKAHT---------------IELQGSRTDVRSIDISDDNALLATAS- 406
           VP EK D  S T I A                  +  G  +++ ++  S D  L+A+A  
Sbjct: 157 VPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGK 216

Query: 407 NGELKIWNLNTKSCIRTFEC-GYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTI- 464
           +GE+ +WNL  K  + T        +  F P    +   T  G +++F L    L+  + 
Sbjct: 217 DGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLR 275

Query: 465 -------EAAHEGAIWSLDVTNDGKRLVTGSADKSIKFW 496
                  +AA   A+ SL  + DG+ L  G  D  I+ W
Sbjct: 276 PEFAGYSKAAEPHAV-SLAWSADGQTLFAGYTDNVIRVW 313

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 2/89 (2%)

Query: 114 SFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSD- 172
           SF GH   +        G   +S S D  + +WD+ +     +   HK  +  +  D   
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 173 NWLISTSKDGLIKVWDLKTQQCIETHIAH 201
           + +IS S+D  IKVW +K  QC+ T + H
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGH 147

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 102/231 (44%), Gaps = 22/231 (9%)

Query: 459 VLLTTIEAAHEGAIWSLDVTNDGKR--LVTGSADKSIKFWDFQVKQELIAGTSDKYVPQM 516
           VL  T+E  H G + SL  T+ G+   L++ S DK++  W      +        +    
Sbjct: 8   VLRGTLEG-HNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKGHS 65

Query: 517 NIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLD 576
           +IV D TL           + D  +   +  D T++++ + + + +    GHK  V+S+D
Sbjct: 66  HIVQDCTL-----------TADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVD 114

Query: 577 ISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPG------SHNFFSAS 630
           I     +II+ S DK IK+W +  G C  +L  H D +  V+ +P       S    SA 
Sbjct: 115 IDKKASMIISGSRDKTIKVWTIK-GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAG 173

Query: 631 KDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
            D  VK W+ ++F+       H S +  L  S +G  + S   D  I +W 
Sbjct: 174 NDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWN 224

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 84/194 (43%), Gaps = 24/194 (12%)

Query: 477 VTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS 536
           +T DG   ++ S DK+++ WD          T + Y  Q  + H S      D++S+ I 
Sbjct: 73  LTADGAYALSASWDKTLRLWDV--------ATGETY--QRFVGHKS------DVMSVDID 116

Query: 537 GDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDI------SDDTKVIITSSAD 590
                +     D T+KV+ +   +   +L GH   V  + +       DD+  II++  D
Sbjct: 117 KKASMIISGSRDKTIKVWTIKG-QCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGND 175

Query: 591 KNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLA 650
           K +K W L+          H  +I  +   P      SA KDG +  W+    + +  L+
Sbjct: 176 KMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAAKKAMYTLS 235

Query: 651 AHQSEVWALAVSDN 664
           A Q EV++LA S N
Sbjct: 236 A-QDEVFSLAFSPN 248

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 61/141 (43%), Gaps = 10/141 (7%)

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKL 157
           D  ++LWD+ +      F GHKS +  +  DK  + +ISGS D  I VW +  +  L  L
Sbjct: 86  DKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGSRDKTIKVWTIKGQC-LATL 144

Query: 158 RSHKGTITGLWC-------DSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGI 210
             H   ++ +         D    +IS   D ++K W+L   Q     I H      L  
Sbjct: 145 LGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTA 204

Query: 211 MTDFVVTSSA--DSQLKIWQM 229
             D  + +SA  D ++ +W +
Sbjct: 205 SPDGTLIASAGKDGEIMLWNL 225

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 2/106 (1%)

Query: 91  LIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVS 150
           +I+AG  D ++K W+L    +   F GH S I  L     GT + S  +D  I++W+L +
Sbjct: 169 IISAGN-DKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGKDGEIMLWNLAA 227

Query: 151 EVGLYKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIE 196
           +  +Y L +     +  +  +  WL + +  G IKV+ L  Q  ++
Sbjct: 228 KKAMYTLSAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVD 272

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 65/159 (40%), Gaps = 27/159 (16%)

Query: 363 VPYEKRDPTSPTPIKAHT---------------IELQGSRTDVRSIDISDDNALLATAS- 406
           VP EK D  S T I A                  +  G  +++ ++  S D  L+A+A  
Sbjct: 157 VPNEKADDDSVTIISAGNDKMVKAWNLNQFQIEADFIGHNSNINTLTASPDGTLIASAGK 216

Query: 407 NGELKIWNLNTKSCIRTFEC-GYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTI- 464
           +GE+ +WNL  K  + T        +  F P    +   T  G +++F L    L+  + 
Sbjct: 217 DGEIMLWNLAAKKAMYTLSAQDEVFSLAFSPNRYWLAAATATG-IKVFSLDPQYLVDDLR 275

Query: 465 -------EAAHEGAIWSLDVTNDGKRLVTGSADKSIKFW 496
                  +AA   A+ SL  + DG+ L  G  D  I+ W
Sbjct: 276 PEFAGYSKAAEPHAV-SLAWSADGQTLFAGYTDNVIRVW 313

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 2/89 (2%)

Query: 114 SFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSD- 172
           SF GH   +        G   +S S D  + +WD+ +     +   HK  +  +  D   
Sbjct: 60  SFKGHSHIVQDCTLTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKA 119

Query: 173 NWLISTSKDGLIKVWDLKTQQCIETHIAH 201
           + +IS S+D  IKVW +K  QC+ T + H
Sbjct: 120 SMIISGSRDKTIKVWTIK-GQCLATLLGH 147

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 104/226 (46%), Gaps = 20/226 (8%)

Query: 461 LTTIE-AAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIV 519
           +TT++   H GAI+S   + D K LV+ S DK+I+ W    +  L+      Y    + V
Sbjct: 544 ITTVKLVGHSGAIYSTSFSPDNKLLVSASEDKTIRLWSMDTRTTLVT-----YKGHNHPV 598

Query: 520 HDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLY-GHKLPVLSLDIS 578
            D           ++ S    + A +  D T +++  D + F L ++ GH   V  +   
Sbjct: 599 WD-----------VQFSPVGHYFATASHDQTARLWSCDHI-FPLRIFSGHISDVDCVTFH 646

Query: 579 DDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYW 638
            +   I T S+DK  ++W +  G+  +    H   I+ V   P      + S+DG +  W
Sbjct: 647 PNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIW 706

Query: 639 DGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHDHSIRIWEET 683
           D    + ++KL  H +S V +L+ +     +VS   D+S+RIW+ T
Sbjct: 707 DIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLT 752

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 109/256 (42%), Gaps = 26/256 (10%)

Query: 450 LQLFDLASSV----LLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWD-----FQV 500
           + L+DL +++    + T +   +E  + SL  +ND +    G  D  IK W       + 
Sbjct: 454 VPLYDLKTALPSVCMFTFLNTNNE--MLSLSYSNDCRLAAAGFKDSYIKVWSLDGTTLES 511

Query: 501 KQELIAGTSDKYVPQM---NIVHDSTLELGDDILSIKISG------------DDKFLAIS 545
           K   I  +  +   +    N +++ T      I ++K+ G            D+K L  +
Sbjct: 512 KATKIQPSKSQAALRAGLDNKINEKTRSQETPITTVKLVGHSGAIYSTSFSPDNKLLVSA 571

Query: 546 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHK 605
             D T++++ +D+    ++  GH  PV  +  S       T+S D+  ++W  D     +
Sbjct: 572 SEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARLWSCDHIFPLR 631

Query: 606 SLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNG 665
               H   + CV F P     F+ S D   + WD    E ++    H + + ++AV+ +G
Sbjct: 632 IFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDG 691

Query: 666 ERVVSVSHDHSIRIWE 681
            R+ + S D  I IW+
Sbjct: 692 LRLATGSEDGVIHIWD 707

 Score = 62.4 bits (150), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 75/165 (45%), Gaps = 10/165 (6%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +  L+ +   D  I+LW + ++T L+++ GH   +  ++F   G    + S D    
Sbjct: 561 FSPDNKLLVSASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTAR 620

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWC----DSDNWLISTSKDGLIKVWDLKTQQCIETHIA 200
           +W   S   ++ LR   G I+ + C     +  ++ + S D   ++WD+ T + +   I 
Sbjct: 621 LW---SCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIG 677

Query: 201 HTGECWALGIMTD--FVVTSSADSQLKIWQMDLEGEPGSKLIEKG 243
           HT    ++ +  D   + T S D  + IW +   G+   KLI  G
Sbjct: 678 HTAPILSVAVAPDGLRLATGSEDGVIHIWDIGT-GKSLKKLIGHG 721

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 78  AEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISG 137
           ++V  + FH     I  G +D   ++WD+ +   +  F GH + I  +     G +L +G
Sbjct: 638 SDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATG 697

Query: 138 SEDSNIIVWDLVSEVGLYKLRSH-KGTITGL-WCDSDNWLISTSKDGLIKVWDL 189
           SED  I +WD+ +   L KL  H K  +  L +    N L+S   D  +++WDL
Sbjct: 698 SEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDL 751

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 66/151 (43%), Gaps = 4/151 (2%)

Query: 83  LQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSN 142
           +QF       A    D   +LW       L  F+GH S +  + F   G  + +GS D  
Sbjct: 601 VQFSPVGHYFATASHDQTARLWSCDHIFPLRIFSGHISDVDCVTFHPNGCYIFTGSSDKT 660

Query: 143 IIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLIST-SKDGLIKVWDLKTQQCIETHIAH 201
             +WD+ +   +     H   I  +    D   ++T S+DG+I +WD+ T + ++  I H
Sbjct: 661 CRMWDITTGESVRLFIGHTAPILSVAVAPDGLRLATGSEDGVIHIWDIGTGKSLKKLIGH 720

Query: 202 TGEC---WALGIMTDFVVTSSADSQLKIWQM 229
                   +    ++ +V+  +D+ ++IW +
Sbjct: 721 GKSAVNSLSYNKESNILVSGGSDNSVRIWDL 751

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 77/175 (44%), Gaps = 22/175 (12%)

Query: 71  DLKSSKPA-----------EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHK 119
           DLK++ P+           E+  L + ++  L AAG+ D  IK+W L   T+       +
Sbjct: 458 DLKTALPSVCMFTFLNTNNEMLSLSYSNDCRLAAAGFKDSYIKVWSLDGTTL-------E 510

Query: 120 SRITMLKFDKTGTQLISGSEDS-NIIVWDLVSEVGLYKLRSHKGTITGLWCDSDN-WLIS 177
           S+ T ++  K+   L +G ++  N       + +   KL  H G I       DN  L+S
Sbjct: 511 SKATKIQPSKSQAALRAGLDNKINEKTRSQETPITTVKLVGHSGAIYSTSFSPDNKLLVS 570

Query: 178 TSKDGLIKVWDLKTQQCIETHIAHTGECW--ALGIMTDFVVTSSADSQLKIWQMD 230
            S+D  I++W + T+  + T+  H    W      +  +  T+S D   ++W  D
Sbjct: 571 ASEDKTIRLWSMDTRTTLVTYKGHNHPVWDVQFSPVGHYFATASHDQTARLWSCD 625

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/121 (23%), Positives = 56/121 (46%), Gaps = 3/121 (2%)

Query: 383 LQGSRTDVRSIDISDDNALLATASNGE-LKIWNLNTKSCIRTF--ECGYALTCKFLPGGL 439
             G  +DV  +    +   + T S+ +  ++W++ T   +R F       L+    P GL
Sbjct: 633 FSGHISDVDCVTFHPNGCYIFTGSSDKTCRMWDITTGESVRLFIGHTAPILSVAVAPDGL 692

Query: 440 LVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQ 499
            +  G+ +G + ++D+ +   L  +    + A+ SL    +   LV+G +D S++ WD  
Sbjct: 693 RLATGSEDGVIHIWDIGTGKSLKKLIGHGKSAVNSLSYNKESNILVSGGSDNSVRIWDLT 752

Query: 500 V 500
           V
Sbjct: 753 V 753

>YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}
           TAF5Subunit (90 kDa) of TFIID and SAGA complexes,
           involved in RNA polymerase II transcription initiation
           and in chromatin modification
          Length = 798

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/307 (20%), Positives = 120/307 (39%), Gaps = 54/307 (17%)

Query: 383 LQGSRTDVRSIDISDDNALLATA-SNGELKIWNLNTKSCIRTFECGYAL------TCKFL 435
            Q +  D+  +D SDD  + A    +  +KIW+L+  S                 TCK L
Sbjct: 462 FQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTL 521

Query: 436 PGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKF 495
            G                              H G ++S   + D K L++GS DK+++ 
Sbjct: 522 VG------------------------------HSGTVYSTSFSPDNKYLLSGSEDKTVRL 551

Query: 496 WDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFF 555
           W       L++     Y    + V D           +  S    + A +  D T +++ 
Sbjct: 552 WSMDTHTALVS-----YKGHNHPVWD-----------VSFSPLGHYFATASHDQTARLWS 595

Query: 556 LDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 615
            D +       GH   V  +    +   + T S+DK  ++W +  GD  +    H   ++
Sbjct: 596 CDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVI 655

Query: 616 CVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHD 674
            +   P      + S+DG +  WD    + ++++  H ++ +++L+ S  G  ++S   D
Sbjct: 656 SIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGAD 715

Query: 675 HSIRIWE 681
           H++R+W+
Sbjct: 716 HTVRVWD 722

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 75/179 (41%), Gaps = 18/179 (10%)

Query: 529 DILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFL-----------------SLYGHKLP 571
           D+  +  S D +  A    D+ +K++ LD                       +L GH   
Sbjct: 468 DMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGT 527

Query: 572 VLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASK 631
           V S   S D K +++ S DK +++W +D      S   H   +  V F P  H F +AS 
Sbjct: 528 VYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASH 587

Query: 632 DGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE-ETDDQVFL 689
           D   + W  D    ++  A H ++V  ++   NG  V + S D + R+W+  T D V L
Sbjct: 588 DQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRL 646

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           +V  + FH     +  G +D   ++WD+ +   +  F GH + +  +     G  L +GS
Sbjct: 611 DVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGS 670

Query: 139 EDSNIIVWDLVSEVGLYKLRSH-KGTITGL-WCDSDNWLISTSKDGLIKVWDLK 190
           ED  I VWD+ +   L ++R H K  I  L +    N LIS   D  ++VWDLK
Sbjct: 671 EDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLK 724

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/207 (22%), Positives = 87/207 (42%), Gaps = 21/207 (10%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   + +G  D  ++LW + + T L+S+ GH   +  + F   G    + S D    
Sbjct: 533 FSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTAR 592

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDN----WLISTSKDGLIKVWDLKTQQCIETHIA 200
           +W   S   +Y LR   G +  + C S +    ++ + S D   ++WD+ T   +   + 
Sbjct: 593 LW---SCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG 649

Query: 201 HTGECWALGIMTD--FVVTSSADSQLKIWQMDLEGEPGSKLIEKGAFEKQSKQRGLSIEF 258
           HT    ++ +  D  ++ T S D  + +W            I  G   KQ +  G +  +
Sbjct: 650 HTAPVISIAVCPDGRWLSTGSEDGIINVWD-----------IGTGKRLKQMRGHGKNAIY 698

Query: 259 T-TTSDGVHFFYVQNADKTVEIFRLRK 284
           + + S   +      AD TV ++ L+K
Sbjct: 699 SLSYSKEGNVLISGGADHTVRVWDLKK 725

 Score = 51.6 bits (122), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 51/235 (21%), Positives = 101/235 (42%), Gaps = 31/235 (13%)

Query: 369 DPTSPTPIKAHTIELQGSRTDVRSIDISDDNA-LLATASNGELKIWNLNTKSCIRTFECG 427
           DPT  T        L G    V S   S DN  LL+ + +  +++W+++T + + +++ G
Sbjct: 515 DPTCKT--------LVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYK-G 565

Query: 428 YALTC---KFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRL 484
           +        F P G      + +   +L+     +    I A H   +  +    +G  +
Sbjct: 566 HNHPVWDVSFSPLGHYFATASHDQTARLWS-CDHIYPLRIFAGHLNDVDCVSFHPNGCYV 624

Query: 485 VTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAI 544
            TGS+DK+ + WD      +          ++ + H +       ++SI +  D ++L+ 
Sbjct: 625 FTGSSDKTCRMWDVSTGDSV----------RLFLGHTAP------VISIAVCPDGRWLST 668

Query: 545 SLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSLDISDDTKVIITSSADKNIKIWGL 598
              D  + V+ + + K    + GH K  + SL  S +  V+I+  AD  +++W L
Sbjct: 669 GSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDL 723

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/171 (19%), Positives = 65/171 (38%), Gaps = 20/171 (11%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLL-----------------SFNGHKSR 121
           ++S L F  +  + AAG+ D  IK+W L   ++                   +  GH   
Sbjct: 468 DMSCLDFSDDCRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGT 527

Query: 122 ITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSK 180
           +    F      L+SGSED  + +W + +   L   + H   +  + +    ++  + S 
Sbjct: 528 VYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASH 587

Query: 181 DGLIKVWDLKTQQCIETHIAHTG--ECWALGIMTDFVVTSSADSQLKIWQM 229
           D   ++W       +     H    +C +      +V T S+D   ++W +
Sbjct: 588 DQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDV 638

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/255 (21%), Positives = 106/255 (41%), Gaps = 29/255 (11%)

Query: 440 LVVVGTREGNLQLFDLASSVLLTTIEA------------AHEGAIWSLDVTNDGKRLVTG 487
           L   G ++  ++LF L  S L    +              H G ++S   + D + LV+ 
Sbjct: 510 LAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLVGHSGTVYSTSFSPDNRYLVSS 569

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLL 547
           S DK+++ W       L++     Y    + V D           +K S    + A +  
Sbjct: 570 SEDKTVRLWSLDTHSALVS-----YKGHNHPVWD-----------VKFSPLGHYFATASH 613

Query: 548 DNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSL 607
           D+T +++  D +       GH   V  +    +   + T S+DK  ++W +  GDC +  
Sbjct: 614 DHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLF 673

Query: 608 FAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGE 666
                 ++     P      + S+DG +  WD    + ++++  H ++ +++LA    G 
Sbjct: 674 LGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGN 733

Query: 667 RVVSVSHDHSIRIWE 681
            ++S   DHS+R+W+
Sbjct: 734 ALISGGADHSVRVWD 748

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/166 (27%), Positives = 75/166 (45%), Gaps = 13/166 (7%)

Query: 529 DILSIKISGDDKFLAISLLDNTVKVFFLDSMKF-------------FLSLYGHKLPVLSL 575
           D+ S++ S D +  A    D+ +K+F LD                   +L GH   V S 
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLVGHSGTVYST 557

Query: 576 DISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFV 635
             S D + +++SS DK +++W LD      S   H   +  VKF P  H F +AS D   
Sbjct: 558 SFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASHDHTA 617

Query: 636 KYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
           + W  D    ++  A H ++V  ++   NG  + + S D + R+W+
Sbjct: 618 RLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWD 663

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 55/114 (48%), Gaps = 2/114 (1%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           +V  + FH     +  G +D   ++WD+ +   +  F G  + +        G  L +GS
Sbjct: 637 DVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLGLTAPVISTCVSPDGRWLSTGS 696

Query: 139 EDSNIIVWDLVSEVGLYKLRSH-KGTITGL-WCDSDNWLISTSKDGLIKVWDLK 190
           ED  I VWD+ +   L ++R H K  I  L +C   N LIS   D  ++VWDLK
Sbjct: 697 EDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDLK 750

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 66/151 (43%), Gaps = 9/151 (5%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   + +   D  ++LW L + + L+S+ GH   +  +KF   G    + S D    
Sbjct: 559 FSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASHDHTAR 618

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDN----WLISTSKDGLIKVWDLKTQQCIETHIA 200
           +W   S   +Y LR   G +  + C S +    +L + S D   ++WD+ T  C+   + 
Sbjct: 619 LW---SCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLFLG 675

Query: 201 HTGECWALGIMTD--FVVTSSADSQLKIWQM 229
            T    +  +  D  ++ T S D  + +W +
Sbjct: 676 LTAPVISTCVSPDGRWLSTGSEDGIINVWDI 706

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 58/121 (47%), Gaps = 9/121 (7%)

Query: 385 GSRTDVRSIDISDDNALLATASNGE-LKIWNLNTKSCIRTFECGYALTCKFL-----PGG 438
           G   DV  +    +   L T S+ +  ++W++ T  C+R F     LT   +     P G
Sbjct: 633 GHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATGDCVRLF---LGLTAPVISTCVSPDG 689

Query: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
             +  G+ +G + ++D+ +   L  +    + AI+SL    +G  L++G AD S++ WD 
Sbjct: 690 RWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLAYCKEGNALISGGADHSVRVWDL 749

Query: 499 Q 499
           +
Sbjct: 750 K 750

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 89/221 (40%), Gaps = 23/221 (10%)

Query: 92  IAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSE 151
            A    D   +LW       L  F GH + +  + F   G  L +GS D    +WD+ + 
Sbjct: 608 FATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDIATG 667

Query: 152 --VGLYKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIETHIAH-TGECWAL 208
             V L+ L      I+        WL + S+DG+I VWD+ T + ++    H     ++L
Sbjct: 668 DCVRLF-LGLTAPVISTCVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSL 726

Query: 209 GIMT--DFVVTSSADSQLKIWQM-----DLEGEPGSKLIE-----KGAFEKQSKQRGLSI 256
                 + +++  AD  +++W +     +   EP    +       G+  +  K+ G   
Sbjct: 727 AYCKEGNALISGGADHSVRVWDLKKATTESGPEPEQAFVGYLGDVTGSINQDIKEYGRRR 786

Query: 257 EFTTTSDGVHFFYVQNADKTVEIFRL---RKDIEIAKAIKR 294
               T+D V  FY     K   +F++   R ++ +A    R
Sbjct: 787 TVIPTNDLVASFYT----KKTPVFKVKFTRSNLALAGGAYR 823

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 35/171 (20%), Positives = 67/171 (39%), Gaps = 24/171 (14%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLW-----------------DLVSKTVLLSFNGHKSR 121
           +++ L+F  +  L AAG+ D  IKL+                 D  SKT++    GH   
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKLFSLDGSPLGNRYDPDLPEDATSKTLV----GHSGT 553

Query: 122 ITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSK 180
           +    F      L+S SED  + +W L +   L   + H   +  + +    ++  + S 
Sbjct: 554 VYSTSFSPDNRYLVSSSEDKTVRLWSLDTHSALVSYKGHNHPVWDVKFSPLGHYFATASH 613

Query: 181 DGLIKVWDLKTQQCIETHIAHTG--ECWALGIMTDFVVTSSADSQLKIWQM 229
           D   ++W       +     H    +C +      ++ T S+D   ++W +
Sbjct: 614 DHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 664

>Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 76.3 bits (186), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 114/252 (45%), Gaps = 17/252 (6%)

Query: 371 TSPTPIKAHTIELQGSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYA 429
           T+P P+ +     +G R +V S+    DN  + T+S +G +K+W++ + S  R ++    
Sbjct: 63  TNPNPVAS----FEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAP 118

Query: 430 LTCKFL-PGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGS 488
           +    + P    ++   R+GN++++DL  +     +    + ++ SL + +DG  L   +
Sbjct: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAAN 178

Query: 489 ADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLD 548
           +  +   W+   + +     +    P       ST      I  I +S D K LA    D
Sbjct: 179 SKGNCYVWEMPNRTD-----ASHLKPVTKFRAHSTY-----ITRILLSSDVKHLATCSAD 228

Query: 549 NTVKVFFLDS-MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSL 607
           +T +V+ +D   K   +L GH+  V     S D+  ++T+S+D  +++W L   +  +  
Sbjct: 229 HTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQY 288

Query: 608 FAHQDSIMCVKF 619
             H    +CV  
Sbjct: 289 GGHHKGAVCVAL 300

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 60/292 (20%), Positives = 122/292 (41%), Gaps = 28/292 (9%)

Query: 383 LQGSRTDVRSIDISDDNALLATASNGELKIWNLNT--KSCIRTFEC--GYALTCKFLPGG 438
           +Q S + V  ++I++D  LLATA +  ++++++ T   + + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
             +V  + +G ++++D+ S  +    +  H   +  + +  +   L++   D +I+ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558
              Q                 H  T E    + S+ ++ D   LA +       V+ + +
Sbjct: 146 GENQ---------------CTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPN 190

Query: 559 ------MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFG-DCHKSLFAHQ 611
                 +K       H   +  + +S D K + T SAD   ++W +D       +L  HQ
Sbjct: 191 RTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQ 250

Query: 612 DSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD 663
             +    F   S    +AS D +V+ WD    E +++   H      +A++D
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/254 (19%), Positives = 109/254 (42%), Gaps = 24/254 (9%)

Query: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
           +++V    +  ++ ++  + V   TI+ + +  +  L++TND K+L+  +  ++++ +D 
Sbjct: 3   VILVSAGYDHTIRFWEALTGVCSRTIQHS-DSQVNRLEITND-KKLLATAGHQNVRLYDI 60

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558
           +        + + +                ++ S+    D++++  S  D T+KV+ + S
Sbjct: 61  RTTNPNPVASFEGH--------------RGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS 106

Query: 559 MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQD-SIMCV 617
                + Y H  PV  + I  +   +I+   D NI+IW L    C   L    D S+  +
Sbjct: 107 PSIPRN-YKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSL 165

Query: 618 KFLPGSHNFFSASKDGFVKYW------DGDKFECIQKLAAHQSEVWALAVSDNGERVVSV 671
                     +A+  G    W      D    + + K  AH + +  + +S + + + + 
Sbjct: 166 SMASDGSMLAAANSKGNCYVWEMPNRTDASHLKPVTKFRAHSTYITRILLSSDVKHLATC 225

Query: 672 SHDHSIRIWEETDD 685
           S DH+ R+W   DD
Sbjct: 226 SADHTARVWSIDDD 239

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 65/123 (52%), Gaps = 7/123 (5%)

Query: 78  AEVSYLQFHSETGLIA-AGYADGVIKLWDL--VSKTVLLSFNGHKSRITMLKFDKTGTQL 134
           ++V+ L+  ++  L+A AG+ +  ++L+D+   +   + SF GH+  +T + F +    +
Sbjct: 33  SQVNRLEITNDKKLLATAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWM 90

Query: 135 ISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNW-LISTSKDGLIKVWDLKTQQ 193
           ++ SED  I VWD+ S   + +   H   +  +    +   LIS  +DG I++WDL   Q
Sbjct: 91  VTSSEDGTIKVWDVRSP-SIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149

Query: 194 CIE 196
           C  
Sbjct: 150 CTH 152

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 81/195 (41%), Gaps = 26/195 (13%)

Query: 47  ISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDL 106
           I VWD+++           P    + K + P  V+ +  H   G + +   DG I++WDL
Sbjct: 99  IKVWDVRS-----------PSIPRNYKHNAP--VNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 107 VSKTVLLSFNGHK-SRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVG------LYKLRS 159
                         + +  L     G+ L + +   N  VW++ +         + K R+
Sbjct: 146 GENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNRTDASHLKPVTKFRA 205

Query: 160 HKGTITGLWCDSD-NWLISTSKDGLIKVW----DLKTQQCIETHIAHTGECWALGIMTDF 214
           H   IT +   SD   L + S D   +VW    D K +  ++ H     +C A    + +
Sbjct: 206 HSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC-AFSADSAY 264

Query: 215 VVTSSADSQLKIWQM 229
           +VT+S+D  +++W +
Sbjct: 265 LVTASSDHYVRLWDL 279

>KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {ON}
           Anc_2.431 YMR116C
          Length = 319

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 102/234 (43%), Gaps = 22/234 (9%)

Query: 459 VLLTTIEAAHEGAIWSLDVTNDGKR--LVTGSADKSIKFWDFQVKQELIAGTSDKYVPQM 516
           VL  T+E  H G + SL  T+ G+   LV+ S DK++  W      + +      +    
Sbjct: 8   VLRGTLEG-HNGWVTSL-ATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKGHS 65

Query: 517 NIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLD 576
           +IV D TL           + D  +   +  D T++++ + + + F    GHK  V+S+ 
Sbjct: 66  HIVQDVTL-----------TPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVA 114

Query: 577 ISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN------FFSAS 630
           I     +II+ S DK+IK+W +  G C  +L  H D +  V+  P   +        SA 
Sbjct: 115 IDRKASMIISGSRDKSIKVWTIK-GQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAG 173

Query: 631 KDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEETD 684
            D  VK W+ ++F+       H   V  +  S +G  + S   D  I +W   D
Sbjct: 174 NDKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLAD 227

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 65/141 (46%), Gaps = 10/141 (7%)

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKL 157
           D  ++LW++ +      F GHKS +  +  D+  + +ISGS D +I VW +  +  L  L
Sbjct: 86  DKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGSRDKSIKVWTIKGQC-LATL 144

Query: 158 RSHKGTITGLWC---DSDN----WLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGI 210
             H   ++ +     D D+     +IS   D ++K W+L   Q     + H G    +  
Sbjct: 145 LGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNLNQFQIEADFVGHNGNVNTITA 204

Query: 211 MTDFVVTSSA--DSQLKIWQM 229
             D  + +SA  D ++ +W +
Sbjct: 205 SPDGSLIASAGKDGEIMLWNL 225

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 51/106 (48%), Gaps = 2/106 (1%)

Query: 91  LIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVS 150
           +I+AG  D ++K W+L    +   F GH   +  +     G+ + S  +D  I++W+L  
Sbjct: 169 VISAGN-DKMVKAWNLNQFQIEADFVGHNGNVNTITASPDGSLIASAGKDGEIMLWNLAD 227

Query: 151 EVGLYKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIE 196
           +V +Y L +        +  +  WL + +  G IKV+ L  Q  I+
Sbjct: 228 KVPMYTLNAQDEVFALAFSPNRYWLAAATASG-IKVFSLDPQALID 272

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 2/89 (2%)

Query: 114 SFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSD- 172
           SF GH   +  +     G   +S S D  + +W++ +     +   HK  +  +  D   
Sbjct: 60  SFKGHSHIVQDVTLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKA 119

Query: 173 NWLISTSKDGLIKVWDLKTQQCIETHIAH 201
           + +IS S+D  IKVW +K  QC+ T + H
Sbjct: 120 SMIISGSRDKSIKVWTIK-GQCLATLLGH 147

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 54/122 (44%), Gaps = 12/122 (9%)

Query: 385 GSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFEC-GYALTCKFLPGGLLVV 442
           G   +V +I  S D +L+A+A  +GE+ +WNL  K  + T           F P    + 
Sbjct: 194 GHNGNVNTITASPDGSLIASAGKDGEIMLWNLADKVPMYTLNAQDEVFALAFSPNRYWLA 253

Query: 443 VGTREGNLQLFDLASSVLLTTI--------EAAHEGAIWSLDVTNDGKRLVTGSADKSIK 494
             T  G +++F L    L+  +        +AA   A+ SL  + DG+ L  G  D  I+
Sbjct: 254 AATASG-IKVFSLDPQALIDDLRPEFAGYNKAAEPHAV-SLTWSADGQTLFAGYTDNVIR 311

Query: 495 FW 496
            W
Sbjct: 312 VW 313

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/136 (20%), Positives = 58/136 (42%), Gaps = 12/136 (8%)

Query: 106 LVSKTVLL---SFNGHKSRITMLKFDKTGTQL-ISGSEDSNIIVWDLVSE-----VGLYK 156
           + S  VL+   +  GH   +T L        L +S S D  +I W L  +     V +  
Sbjct: 1   MASNEVLVLRGTLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRS 60

Query: 157 LRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGI--MTD 213
            + H   +  +    D  + +S S D  +++W++ T +  +  + H  +  ++ I     
Sbjct: 61  FKGHSHIVQDVTLTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKAS 120

Query: 214 FVVTSSADSQLKIWQM 229
            +++ S D  +K+W +
Sbjct: 121 MIISGSRDKSIKVWTI 136

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 74/316 (23%), Positives = 126/316 (39%), Gaps = 29/316 (9%)

Query: 378 AHTIELQG-------SRTDVRSIDISDDNALLATAS-NGELKI---WNLNTKSCIRTFEC 426
           AH +E  G       S   + S+  S D+  LA  S +G +K     +LN KS +     
Sbjct: 162 AHQLENIGLLGSQIASSRPISSVKFSPDDKHLAVGSWDGGIKTISAGSLNIKSSVENAHT 221

Query: 427 GYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIE-AAHEGAIWSLDVTNDGKRLV 485
           G      +   G L+  G  +G ++LF + S  L    +   HE  +        G+ + 
Sbjct: 222 GKVGEVDWNSSGDLLATGGEDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHPFGRYIA 281

Query: 486 TGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAIS 545
           + S D + + WD +   EL+                     G ++  +    D   L  +
Sbjct: 282 SASFDNTWRLWDAETNHELLLQEGH----------------GKEVFCLAFQSDGSLLCSA 325

Query: 546 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHK 605
            LD T  ++ + S    + L GH  P+ S+D S     + T+S D  + IW +   +  +
Sbjct: 326 GLDCTGMIWDIRSGNCAMVLSGHTKPIYSVDWSPRGFEVATASGDGTVNIWDIRKTNQPQ 385

Query: 606 SLFAHQDSIMCVKFLPGSHNFF-SASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDN 664
            L AH   +  ++F   +  F  S   D  +  + GD +  I  L  H  ++ AL +  +
Sbjct: 386 VLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVYSGDSWNKITILKGHTDKILALDLGTH 445

Query: 665 GERVVSVSHDHSIRIW 680
              VVS   D S++ W
Sbjct: 446 DGSVVSAGWDRSVKSW 461

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 80/180 (44%), Gaps = 9/180 (5%)

Query: 65  LPPGSVDLKSS----KPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTV--LLSFNGH 118
           +  GS+++KSS       +V  + ++S   L+A G  DG++KL+ + S  +  +    GH
Sbjct: 205 ISAGSLNIKSSVENAHTGKVGEVDWNSSGDLLATGGEDGLVKLFTVQSGELRQVADLQGH 264

Query: 119 KSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLI-S 177
           + R+   +F   G  + S S D+   +WD  +   L     H   +  L   SD  L+ S
Sbjct: 265 ERRVAGCRFHPFGRYIASASFDNTWRLWDAETNHELLLQEGHGKEVFCLAFQSDGSLLCS 324

Query: 178 TSKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTDF--VVTSSADSQLKIWQMDLEGEP 235
              D    +WD+++  C      HT   +++        V T+S D  + IW +    +P
Sbjct: 325 AGLDCTGMIWDIRSGNCAMVLSGHTKPIYSVDWSPRGFEVATASGDGTVNIWDIRKTNQP 384

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 52/125 (41%), Gaps = 1/125 (0%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
            V+  +FH     IA+   D   +LWD  +   LL   GH   +  L F   G+ L S  
Sbjct: 267 RVAGCRFHPFGRYIASASFDNTWRLWDAETNHELLLQEGHGKEVFCLAFQSDGSLLCSAG 326

Query: 139 EDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGLIKVWDLKTQQCIET 197
            D   ++WD+ S      L  H   I  + W      + + S DG + +WD++     + 
Sbjct: 327 LDCTGMIWDIRSGNCAMVLSGHTKPIYSVDWSPRGFEVATASGDGTVNIWDIRKTNQPQV 386

Query: 198 HIAHT 202
            +AH 
Sbjct: 387 LLAHN 391

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 70/163 (42%), Gaps = 4/163 (2%)

Query: 72  LKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTG 131
           L+     EV  L F S+  L+ +   D    +WD+ S    +  +GH   I  + +   G
Sbjct: 302 LQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNCAMVLSGHTKPIYSVDWSPRG 361

Query: 132 TQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDN--WLISTSKDGLIKVWDL 189
            ++ + S D  + +WD+        L +H   ++G+  +  N  +L+S   D  I V+  
Sbjct: 362 FEVATASGDGTVNIWDIRKTNQPQVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVYSG 421

Query: 190 KTQQCIETHIAHTGECWA--LGIMTDFVVTSSADSQLKIWQMD 230
            +   I     HT +  A  LG     VV++  D  +K W +D
Sbjct: 422 DSWNKITILKGHTDKILALDLGTHDGSVVSAGWDRSVKSWNVD 464

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/221 (23%), Positives = 93/221 (42%), Gaps = 19/221 (8%)

Query: 382 ELQGSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFEC-GYALTC-KFLPGG 438
           +LQG    V           +A+AS +   ++W+  T   +   E  G  + C  F   G
Sbjct: 260 DLQGHERRVAGCRFHPFGRYIASASFDNTWRLWDAETNHELLLQEGHGKEVFCLAFQSDG 319

Query: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
            L+     +    ++D+ S      + + H   I+S+D +  G  + T S D ++  WD 
Sbjct: 320 SLLCSAGLDCTGMIWDIRSGNCAMVL-SGHTKPIYSVDWSPRGFEVATASGDGTVNIWDI 378

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558
           +   +          PQ+ + H+S +     I   K +G  KFL     D  + V+  DS
Sbjct: 379 RKTNQ----------PQVLLAHNSIVS---GIRFEKHNG--KFLMSCGYDKNINVYSGDS 423

Query: 559 MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLD 599
                 L GH   +L+LD+      ++++  D+++K W +D
Sbjct: 424 WNKITILKGHTDKILALDLGTHDGSVVSAGWDRSVKSWNVD 464

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 61/150 (40%), Gaps = 8/150 (5%)

Query: 536 SGDDKFLAISLLDNTVKVFFLDS--MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNI 593
           SGD   LA    D  VK+F + S  ++    L GH+  V         + I ++S D   
Sbjct: 232 SGD--LLATGGEDGLVKLFTVQSGELRQVADLQGHERRVAGCRFHPFGRYIASASFDNTW 289

Query: 594 KIWGLDFGDCHKSLF--AHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAA 651
           ++W  D    H+ L    H   + C+ F        SA  D     WD     C   L+ 
Sbjct: 290 RLW--DAETNHELLLQEGHGKEVFCLAFQSDGSLLCSAGLDCTGMIWDIRSGNCAMVLSG 347

Query: 652 HQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
           H   ++++  S  G  V + S D ++ IW+
Sbjct: 348 HTKPIYSVDWSPRGFEVATASGDGTVNIWD 377

>TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {ON}
           Anc_8.544 YBR198C
          Length = 831

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 64/295 (21%), Positives = 127/295 (43%), Gaps = 39/295 (13%)

Query: 389 DVRSIDISDDNALLATA-SNGELKIWNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTRE 447
           D+ S++ SDD  L A    + ++KI++L+          G +L  K      L     + 
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLD----------GSSLNSK------LTESNKKT 541

Query: 448 GNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAG 507
             L   D ++S L+      H G ++S   + D + LV+GS DK+++ W       L++ 
Sbjct: 542 NKLLNNDESTSTLI-----GHSGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVS- 595

Query: 508 TSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYG 567
               Y    + V D           ++ S    + A +  D+T +++  D +       G
Sbjct: 596 ----YKGHNHPVWD-----------VEFSPLGHYFATASHDHTARLWSCDHIYPLRIFAG 640

Query: 568 HKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFF 627
           H   V  +    +   + T S+DK  ++W +  GD  +        +M     P      
Sbjct: 641 HLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLS 700

Query: 628 SASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHDHSIRIWE 681
           + S+DG +  WD    + ++++  H ++ +++L+ +  G  ++S   DHS+R+W+
Sbjct: 701 TGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWD 755

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 78/182 (42%), Gaps = 21/182 (11%)

Query: 529 DILSIKISGDDKFLAISLLDNTVKVFFLDSMKF--------------------FLSLYGH 568
           D+ S++ S D +  A    D+ +K+F LD                          +L GH
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLIGH 557

Query: 569 KLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFS 628
              V S   S D + +++ S DK +++W +D      S   H   +  V+F P  H F +
Sbjct: 558 SGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFAT 617

Query: 629 ASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE-ETDDQV 687
           AS D   + W  D    ++  A H ++V  ++   NG  + + S D + R+W+  T D V
Sbjct: 618 ASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSV 677

Query: 688 FL 689
            L
Sbjct: 678 RL 679

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 54/114 (47%), Gaps = 2/114 (1%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           +V  + FH     +  G +D   ++WD+ +   +  F G  + +        G  L +GS
Sbjct: 644 DVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLGLTAPVMSTSVSPDGRWLSTGS 703

Query: 139 EDSNIIVWDLVSEVGLYKLRSH-KGTITGL-WCDSDNWLISTSKDGLIKVWDLK 190
           ED  I VWD+ +   L ++R H K  I  L +    N LIS   D  ++VWDLK
Sbjct: 704 EDGVINVWDIGTGKRLKQMRGHGKNAIYSLSYNKEGNVLISGGADHSVRVWDLK 757

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 66/151 (43%), Gaps = 9/151 (5%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +   + +G  D  ++LW + + T L+S+ GH   +  ++F   G    + S D    
Sbjct: 566 FSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFATASHDHTAR 625

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWCDSDN----WLISTSKDGLIKVWDLKTQQCIETHIA 200
           +W   S   +Y LR   G +  + C S +    +L + S D   ++WD+ T   +   + 
Sbjct: 626 LW---SCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTGDSVRLFLG 682

Query: 201 HTGECWALGIMTD--FVVTSSADSQLKIWQM 229
            T    +  +  D  ++ T S D  + +W +
Sbjct: 683 LTAPVMSTSVSPDGRWLSTGSEDGVINVWDI 713

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 63/143 (44%), Gaps = 6/143 (4%)

Query: 92  IAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVS- 150
            A    D   +LW       L  F GH + +  + F   G  L +GS D    +WD+ + 
Sbjct: 615 FATASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDITTG 674

Query: 151 -EVGLYKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTGEC-WAL 208
             V L+   +     T +  D   WL + S+DG+I VWD+ T + ++    H     ++L
Sbjct: 675 DSVRLFLGLTAPVMSTSVSPDG-RWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAIYSL 733

Query: 209 GIMT--DFVVTSSADSQLKIWQM 229
                 + +++  AD  +++W +
Sbjct: 734 SYNKEGNVLISGGADHSVRVWDL 756

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/174 (20%), Positives = 67/174 (38%), Gaps = 23/174 (13%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDL------------VSKTVLLSFN--------GH 118
           +++ L+F  +  L AAG+ D  IK++ L              KT  L  N        GH
Sbjct: 498 DMTSLEFSDDCRLAAAGFQDSQIKIFSLDGSSLNSKLTESNKKTNKLLNNDESTSTLIGH 557

Query: 119 KSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLIS 177
              +    F      L+SGSED  + +W + +   L   + H   +  + +    ++  +
Sbjct: 558 SGTVYSTSFSPDNRYLVSGSEDKTVRLWSMDTHTSLVSYKGHNHPVWDVEFSPLGHYFAT 617

Query: 178 TSKDGLIKVWDLKTQQCIETHIAHTG--ECWALGIMTDFVVTSSADSQLKIWQM 229
            S D   ++W       +     H    +C +      ++ T S+D   ++W +
Sbjct: 618 ASHDHTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYLFTGSSDKTCRMWDI 671

>KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 99/237 (41%), Gaps = 20/237 (8%)

Query: 459 VLLTTIEAAHEGAIWSLDVT-NDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMN 517
           VL  T+E  H G + SL  +      L++GS DKS+  W      +        +    +
Sbjct: 8   VLRGTLEG-HNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSH 66

Query: 518 IVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDI 577
           IV D T           ++ D ++   +  D TV+++ L S K      GHK  VLS+ I
Sbjct: 67  IVQDCT-----------VTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTI 115

Query: 578 SDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPG------SHNFFSASK 631
                 I+++S DK +K+W    G+C  +L  H D +  V+  P       +    SA  
Sbjct: 116 DRRASQIVSASRDKTVKVWNT-LGECMVTLLGHNDWVSQVRVAPNETPEDETVTVISAGM 174

Query: 632 DGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEETDDQVF 688
           D  VK W+   F+       H + V  +  S +G  V S   D  I +W  T+ +  
Sbjct: 175 DKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEAL 231

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 65/141 (46%), Gaps = 10/141 (7%)

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKL 157
           D  ++LW+L S   +  F GHKS +  +  D+  +Q++S S D  + VW+ + E  +  L
Sbjct: 86  DKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWNTLGEC-MVTL 144

Query: 158 RSHKGTITGLWC-------DSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGI 210
             H   ++ +         D    +IS   D ++KVW+L + Q     I H      +  
Sbjct: 145 LGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNLHSFQIEADFIGHNNYVNTVTA 204

Query: 211 MTDFVVTSSA--DSQLKIWQM 229
             D  + +SA  D Q+ +W +
Sbjct: 205 SPDGTLVASAGKDGQIMLWNL 225

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 56/106 (52%), Gaps = 2/106 (1%)

Query: 91  LIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVS 150
           +I+AG  D V+K+W+L S  +   F GH + +  +     GT + S  +D  I++W+L  
Sbjct: 169 VISAGM-DKVVKVWNLHSFQIEADFIGHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTE 227

Query: 151 EVGLYKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIE 196
           +  LY L +        +  +  WL + +  G IK+++L+ ++ ++
Sbjct: 228 KEALYTLNAQDEVFAVAFSPNRYWLTAATSSG-IKIFNLEERKVVD 272

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 53/122 (43%), Gaps = 12/122 (9%)

Query: 385 GSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFEC-GYALTCKFLPGGLLVV 442
           G    V ++  S D  L+A+A  +G++ +WNL  K  + T           F P    + 
Sbjct: 194 GHNNYVNTVTASPDGTLVASAGKDGQIMLWNLTEKEALYTLNAQDEVFAVAFSPNRYWLT 253

Query: 443 VGTREGNLQLFDLASSVLLTTIE--------AAHEGAIWSLDVTNDGKRLVTGSADKSIK 494
             T  G +++F+L    ++  ++        AA   AI SL  + DG+ L  G  D  I+
Sbjct: 254 AATSSG-IKIFNLEERKVVDELKPEFAGYTKAAEPHAI-SLAWSADGQTLFAGYTDNVIR 311

Query: 495 FW 496
            W
Sbjct: 312 VW 313

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 33/157 (21%), Positives = 65/157 (41%), Gaps = 15/157 (9%)

Query: 87  SETGLIAAGYADGVIKLWDLVSK-----TVLLSFNGHKSRITMLKFDKTGTQLISGSEDS 141
           ++  L+ +G  D  +  W L          + SF GH   +        G   +S S D 
Sbjct: 28  AQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRGHSHIVQDCTVTPDGEYALSASWDK 87

Query: 142 NIIVWDLVSEVGLYKLRSHKGTITGLWCDSD-NWLISTSKDGLIKVWDLKTQQCIETHIA 200
            + +W+L S   + +   HK  +  +  D   + ++S S+D  +KVW+    +C+ T + 
Sbjct: 88  TVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSASRDKTVKVWN-TLGECMVTLLG 146

Query: 201 HTGECWALGIM--------TDFVVTSSADSQLKIWQM 229
           H      + +         T  V+++  D  +K+W +
Sbjct: 147 HNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNL 183

>Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 75.5 bits (184), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 113/252 (44%), Gaps = 17/252 (6%)

Query: 371 TSPTPIKAHTIELQGSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYA 429
           T+P P+ +     +G R +V S+    DN  + T+S +G +K+W++ + S  R ++    
Sbjct: 63  TNPNPVAS----FEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAP 118

Query: 430 LTCKFL-PGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGS 488
           +    + P    ++   R+GN++++DL  +     +    + ++ SL + +DG  L   +
Sbjct: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAAN 178

Query: 489 ADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLD 548
           +  +   W+     +     +    P       ST      I  I +S D K LA    D
Sbjct: 179 SKGNCYVWEMPNHTD-----ASHLKPVTKFRAHSTY-----ITRILLSSDVKHLATCSAD 228

Query: 549 NTVKVFFL-DSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSL 607
           +T +V+ + D  K   +L GH+  V     S D+  ++T+S+D  +++W L   +  +  
Sbjct: 229 HTARVWSIEDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQY 288

Query: 608 FAHQDSIMCVKF 619
             H    +CV  
Sbjct: 289 GGHHKGAVCVAL 300

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/293 (20%), Positives = 123/293 (41%), Gaps = 30/293 (10%)

Query: 383 LQGSRTDVRSIDISDDNALLATASNGELKIWNLNT--KSCIRTFEC--GYALTCKFLPGG 438
           +Q S + V  ++I++D  LLATA +  ++++++ T   + + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
             +V  + +G ++++D+ S  +    +  H   +  + +  +   L++   D +I+ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558
              Q                 H  T E    + S+ ++ D   LA +       V+ + +
Sbjct: 146 GENQ---------------CTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPN 190

Query: 559 ------MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGL--DFGDCHKSLFAH 610
                 +K       H   +  + +S D K + T SAD   ++W +  DF     +L  H
Sbjct: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIEDDF-KLETTLDGH 249

Query: 611 QDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD 663
           Q  +    F   S    +AS D +V+ WD    E +++   H      +A++D
Sbjct: 250 QRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/254 (19%), Positives = 109/254 (42%), Gaps = 24/254 (9%)

Query: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
           +++V    +  ++ ++  + V   TI+ + +  +  L++TND K+L+  +  ++++ +D 
Sbjct: 3   VILVSAGYDHTIRFWEALTGVCSRTIQHS-DSQVNRLEITND-KKLLATAGHQNVRLYDI 60

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558
           +        + + +                ++ S+    D++++  S  D T+KV+ + S
Sbjct: 61  RTTNPNPVASFEGH--------------RGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS 106

Query: 559 MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQD-SIMCV 617
                + Y H  PV  + I  +   +I+   D NI+IW L    C   L    D S+  +
Sbjct: 107 PSIPRN-YKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSL 165

Query: 618 KFLPGSHNFFSASKDGFVKYW------DGDKFECIQKLAAHQSEVWALAVSDNGERVVSV 671
                     +A+  G    W      D    + + K  AH + +  + +S + + + + 
Sbjct: 166 SMASDGSMLAAANSKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATC 225

Query: 672 SHDHSIRIWEETDD 685
           S DH+ R+W   DD
Sbjct: 226 SADHTARVWSIEDD 239

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 102/227 (44%), Gaps = 15/227 (6%)

Query: 78  AEVSYLQFHSETGLIA-AGYADGVIKLWDL--VSKTVLLSFNGHKSRITMLKFDKTGTQL 134
           ++V+ L+  ++  L+A AG+ +  ++L+D+   +   + SF GH+  +T + F +    +
Sbjct: 33  SQVNRLEITNDKKLLATAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWM 90

Query: 135 ISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNW-LISTSKDGLIKVWDLKTQQ 193
           ++ SED  I VWD+ S   + +   H   +  +    +   LIS  +DG I++WDL   Q
Sbjct: 91  VTSSEDGTIKVWDVRSP-SIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149

Query: 194 CIETHIAHTG-ECWALGIMTDFVVTSSADSQ--LKIWQMDLEGEPGSKLIEKGAFEKQSK 250
           C             +L + +D  + ++A+S+    +W+M    +  S L     F   S 
Sbjct: 150 CTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTD-ASHLKPVTKFRAHST 208

Query: 251 QRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREK 297
                I     S  V      +AD T  ++ +  D ++   +   ++
Sbjct: 209 Y----ITRILLSSDVKHLATCSADHTARVWSIEDDFKLETTLDGHQR 251

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 81/195 (41%), Gaps = 26/195 (13%)

Query: 47  ISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDL 106
           I VWD+++           P    + K + P  V+ +  H   G + +   DG I++WDL
Sbjct: 99  IKVWDVRS-----------PSIPRNYKHNAP--VNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 107 VSKTVLLSFNGHK-SRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVG------LYKLRS 159
                         + +  L     G+ L + +   N  VW++ +         + K R+
Sbjct: 146 GENQCTHQLTPEDDTSLQSLSMASDGSMLAAANSKGNCYVWEMPNHTDASHLKPVTKFRA 205

Query: 160 HKGTITGLWCDSD-NWLISTSKDGLIKVW----DLKTQQCIETHIAHTGECWALGIMTDF 214
           H   IT +   SD   L + S D   +VW    D K +  ++ H     +C A    + +
Sbjct: 206 HSTYITRILLSSDVKHLATCSADHTARVWSIEDDFKLETTLDGHQRWVWDC-AFSADSAY 264

Query: 215 VVTSSADSQLKIWQM 229
           +VT+S+D  +++W +
Sbjct: 265 LVTASSDHYVRLWDL 279

>SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 aa]
           {ON} similar to uniprot|P41811 Saccharomyces cerevisiae
           YGL137W SEC27 Involved in beta'-subunit of yeast
           coatomer
          Length = 878

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 75/318 (23%), Positives = 141/318 (44%), Gaps = 33/318 (10%)

Query: 385 GSRTD-VRSIDISDDNA-LLATASNGELKIWNLNTKSCIRTFECG--YALTCKFLPGGLL 440
           G+R+D V+ ID+      +L+T  +G ++IWN  T++ +R+ E         +F+     
Sbjct: 10  GNRSDRVKGIDLHPTEPWVLSTLYSGRVEIWNYETQTEVRSIEVTDTPVRAGRFIARKNW 69

Query: 441 VVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQV 500
           +VVG+ +  +++F+  +   +T  E  H   I S+ V      +++ S D +IK W+++ 
Sbjct: 70  IVVGSDDFKIRVFNYNTGEKVTDFEG-HPDYIRSIAVHPTRPYVLSASDDMTIKLWNWE- 127

Query: 501 KQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKIS---GDDKFLAISLLDNTVKVFFLD 557
                           N   + T E G +   + ++    D    A + LD+TVK++ L 
Sbjct: 128 ---------------KNWALEQTFE-GHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLG 171

Query: 558 SMKFFLSLYGHKLPVLSLDISD-----DTKVIITSSADKNIKIWGLDFGDCHKSLFAHQD 612
                 ++  H+     ++  D     D   +ITSS D+++KIW      C  +L  H  
Sbjct: 172 QQSPNFTMTAHE--TRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQTKSCVATLEGHMA 229

Query: 613 SIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGER-VVSV 671
           ++    F P      S S+DG VK W+ + ++  + L       W +A    G+R  V+ 
Sbjct: 230 NVSYAIFHPSLPIIISGSEDGTVKIWNANTYKLEKTLNLGLERSWCVAAHPTGKRNYVAS 289

Query: 672 SHDHSIRIWEETDDQVFL 689
             D+   +    +D+  L
Sbjct: 290 GFDNGFNVLSMGNDEPRL 307

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/163 (21%), Positives = 67/163 (41%), Gaps = 10/163 (6%)

Query: 77  PAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVL-LSFNGHKSRITMLKFD-KTGTQL 134
           P  +  +  H     + +   D  IKLW+      L  +F GH+  +  + F+ K     
Sbjct: 97  PDYIRSIAVHPTRPYVLSASDDMTIKLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTF 156

Query: 135 ISGSEDSNIIVWDLVSEVGLYKLRSHK----GTITGLWCDSDNWLISTSKDGLIKVWDLK 190
            S   D  + +W L  +   + + +H+      +         +LI++S D  +K+WD +
Sbjct: 157 ASACLDHTVKIWSLGQQSPNFTMTAHETRGVNFVDYYPLQDKPYLITSSDDRSVKIWDYQ 216

Query: 191 TQQCIETHIAHTGECWALGIM---TDFVVTSSADSQLKIWQMD 230
           T+ C+ T   H     +  I       +++ S D  +KIW  +
Sbjct: 217 TKSCVATLEGHMANV-SYAIFHPSLPIIISGSEDGTVKIWNAN 258

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/154 (21%), Positives = 67/154 (43%), Gaps = 21/154 (13%)

Query: 92  IAAGYADGVIKLWDLVSKTVLLSFNGHKSR-ITMLKF----DKTGTQLISGSEDSNIIVW 146
            A+   D  +K+W L  ++   +   H++R +  + +    DK    LI+ S+D ++ +W
Sbjct: 156 FASACLDHTVKIWSLGQQSPNFTMTAHETRGVNFVDYYPLQDKP--YLITSSDDRSVKIW 213

Query: 147 DLVSEVGLYKLRSHKGTIT-GLWCDSDNWLISTSKDGLIKVWDLKTQQ------------ 193
           D  ++  +  L  H   ++  ++  S   +IS S+DG +K+W+  T +            
Sbjct: 214 DYQTKSCVATLEGHMANVSYAIFHPSLPIIISGSEDGTVKIWNANTYKLEKTLNLGLERS 273

Query: 194 -CIETHIAHTGECWALGIMTDFVVTSSADSQLKI 226
            C+  H        A G    F V S  + + ++
Sbjct: 274 WCVAAHPTGKRNYVASGFDNGFNVLSMGNDEPRL 307

 Score = 39.3 bits (90), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 43/93 (46%), Gaps = 10/93 (10%)

Query: 80  VSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSE 139
           V Y     +  LI +   D  +K+WD  +K+ + +  GH + ++   F  +   +ISGSE
Sbjct: 190 VDYYPLQDKPYLITSS-DDRSVKIWDYQTKSCVATLEGHMANVSYAIFHPSLPIIISGSE 248

Query: 140 DSNIIVWDLVSEVGLYKLRSHKGTITGL---WC 169
           D  + +W+       YKL   K    GL   WC
Sbjct: 249 DGTVKIWN----ANTYKLE--KTLNLGLERSWC 275

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 59/154 (38%), Gaps = 12/154 (7%)

Query: 84  QFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNI 143
           +F +    I  G  D  I++++  +   +  F GH   I  +    T   ++S S+D  I
Sbjct: 62  RFIARKNWIVVGSDDFKIRVFNYNTGEKVTDFEGHPDYIRSIAVHPTRPYVLSASDDMTI 121

Query: 144 IVWDLVSEVGL---YKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIETHIA 200
            +W+      L   ++   H            N   S   D  +K+W L  Q    T  A
Sbjct: 122 KLWNWEKNWALEQTFEGHEHFVMCVAFNPKDPNTFASACLDHTVKIWSLGQQSPNFTMTA 181

Query: 201 HTGECWALGIM-------TDFVVTSSADSQLKIW 227
           H  E   +  +         +++TSS D  +KIW
Sbjct: 182 H--ETRGVNFVDYYPLQDKPYLITSSDDRSVKIW 213

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 77.0 bits (188), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 108/245 (44%), Gaps = 16/245 (6%)

Query: 436 PGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKF 495
           P G     G+  G++ +F+  +   + T    H G I  +D ++D + LV+G  D  +K 
Sbjct: 191 PEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKISGIDWSSDSRHLVSGGEDGIVKL 250

Query: 496 WDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFF 555
           ++F      +A +         I HD+       + ++K     K++  +  D T +++ 
Sbjct: 251 YNFDSNSIQVATSF--------IGHDAR------VTNVKFHPSQKYIGSASFDTTWRLWD 296

Query: 556 LDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 615
           + +    L   GH   + SL    D  +I T+ ADK   IW L  G    SL  H   I 
Sbjct: 297 IVTNSELLLQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIY 356

Query: 616 CVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVS-DNGERVVSVSHD 674
           C  +    +     S DG +K WD  K + ++ + AH++ V  L    +N + ++S S+D
Sbjct: 357 CSDWSQNGYQ-XXXSGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYD 415

Query: 675 HSIRI 679
             I +
Sbjct: 416 KDINV 420

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 71/156 (45%), Gaps = 3/156 (1%)

Query: 78  AEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISG 137
           A V+ ++FH     I +   D   +LWD+V+ + LL   GH   I  L F   G+ + + 
Sbjct: 269 ARVTNVKFHPSQKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATA 328

Query: 138 SEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIET 197
             D   I+WDL S   +  L  H   I       + +    S DG IK+WDL+    +ET
Sbjct: 329 GADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNGYQXXXSGDGTIKIWDLRKVDDVET 388

Query: 198 HIAHTGECWALGIMTD---FVVTSSADSQLKIWQMD 230
            +AH      L    +   F+++SS D  + ++  D
Sbjct: 389 ILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSSD 424

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 78/163 (47%), Gaps = 5/163 (3%)

Query: 72  LKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTG 131
           L+     E+  L F ++  LIA   AD V  +WDL S   +LS  GH   I    + + G
Sbjct: 305 LQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGHAKPIYCSDWSQNG 364

Query: 132 TQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDN--WLISTSKDGLIKVWDL 189
            Q    S D  I +WDL     +  + +HK  +T L  + +N  +LIS+S D  I V+  
Sbjct: 365 YQXXX-SGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISSSYDKDINVFSS 423

Query: 190 KTQQCIETHIAHTGECWALGIMTDF--VVTSSADSQLKIWQMD 230
            +   I T   H  +  ++ I +D+  +V+   D  +K+W M+
Sbjct: 424 DSWVKIHTLQGHNDKILSIDISSDYQTIVSGGWDRSVKLWSME 466

 Score = 60.8 bits (146), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 81/161 (50%), Gaps = 4/161 (2%)

Query: 73  KSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKT--VLLSFNGHKSRITMLKFDKT 130
           + +   ++S + + S++  + +G  DG++KL++  S +  V  SF GH +R+T +KF  +
Sbjct: 220 RETHSGKISGIDWSSDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPS 279

Query: 131 GTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTS-KDGLIKVWDL 189
              + S S D+   +WD+V+   L     H   I  L   +D  LI+T+  D +  +WDL
Sbjct: 280 QKYIGSASFDTTWRLWDIVTNSELLLQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWDL 339

Query: 190 KTQQCIETHIAHTGECWALGIMTD-FVVTSSADSQLKIWQM 229
           ++ + I + + H    +      + +    S D  +KIW +
Sbjct: 340 RSGKNILSLVGHAKPIYCSDWSQNGYQXXXSGDGTIKIWDL 380

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 101/234 (43%), Gaps = 31/234 (13%)

Query: 396 SDDNALLATASNGELKIWNLNTKSC-IRTFECGY---ALTCKFLPGGLLVVVGTREGNLQ 451
           SD   L++   +G +K++N ++ S  + T   G+       KF P    +   + +   +
Sbjct: 234 SDSRHLVSGGEDGIVKLYNFDSNSIQVATSFIGHDARVTNVKFHPSQKYIGSASFDTTWR 293

Query: 452 LFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQE---LIAGT 508
           L+D+ ++  L  ++  H   I+SL    DG  + T  ADK    WD +  +    L+   
Sbjct: 294 LWDIVTNSELL-LQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWDLRSGKNILSLVGHA 352

Query: 509 SDKYVP-------QMNIVHDSTLELGD--------DILSIKISGDD--------KFLAIS 545
              Y         Q     D T+++ D         IL+ K    D        KFL  S
Sbjct: 353 KPIYCSDWSQNGYQXXXSGDGTIKIWDLRKVDDVETILAHKNVVTDLKFEKENSKFLISS 412

Query: 546 LLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLD 599
             D  + VF  DS     +L GH   +LS+DIS D + I++   D+++K+W ++
Sbjct: 413 SYDKDINVFSSDSWVKIHTLQGHNDKILSIDISSDYQTIVSGGWDRSVKLWSME 466

 Score = 38.5 bits (88), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 73/163 (44%), Gaps = 10/163 (6%)

Query: 74  SSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVS-KTVLLSFNGHKSRITMLKFDKTGT 132
           SS+P  +S +    E    AAG   G I +++  +   V+ S   H  +I+ + +     
Sbjct: 180 SSRP--ISKICISPEGTCTAAGSWAGDISIFNTKTLAPVITSRETHSGKISGIDWSSDSR 237

Query: 133 QLISGSEDSNIIVWDLVS---EVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGLIKVWD 188
            L+SG ED  + +++  S   +V       H   +T + +  S  ++ S S D   ++WD
Sbjct: 238 HLVSGGEDGIVKLYNFDSNSIQVAT-SFIGHDARVTNVKFHPSQKYIGSASFDTTWRLWD 296

Query: 189 LKTQQCIETHIAHTGECWALGIMTD--FVVTSSADSQLKIWQM 229
           + T   +     H+ E ++L   TD   + T+ AD    IW +
Sbjct: 297 IVTNSELLLQEGHSKEIYSLSFQTDGSLIATAGADKVGIIWDL 339

>ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 75.1 bits (183), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 114/252 (45%), Gaps = 17/252 (6%)

Query: 371 TSPTPIKAHTIELQGSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYA 429
           T+P P+ +     +G R +V S+    DN  +AT+S +G +K+W++   S  R ++    
Sbjct: 63  TNPNPVAS----FEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRAPSIPRNYKLNAP 118

Query: 430 LTCKFL-PGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGS 488
           +    + P    ++   R+G+++++DL  +     +    +  + SL + +DG  LV  +
Sbjct: 119 VNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAAN 178

Query: 489 ADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLD 548
              +   W+   + +     +    P       +T      I  I +S D K LA    D
Sbjct: 179 NKGNCYVWEMPNRTD-----ASNLKPVTKFRSHNTY-----ITRILLSSDVKHLATCSAD 228

Query: 549 NTVKVFFLD-SMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSL 607
           +T +V+ +D + K   +L GH+  V     S D+  ++T+S+D  +++W L   +  +  
Sbjct: 229 HTARVWSVDDNFKLETTLDGHQRWVWDCAFSADSAYLMTASSDHYVRLWDLSTREIVRQY 288

Query: 608 FAHQDSIMCVKF 619
             H    +CV  
Sbjct: 289 GGHHKGAVCVAL 300

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 59/299 (19%), Positives = 115/299 (38%), Gaps = 37/299 (12%)

Query: 401 LLATASNGELKIWNLNTKSCIRTFECGYALTCKF-LPGGLLVVVGTREGNLQLFDLASSV 459
           L++   +  ++ W   T  C RT +   +   +  +     ++      N++L+D+ ++ 
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDIRTTN 64

Query: 460 L--LTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQV----------------- 500
              + + E  H G + S+    D K + T S D +IK WD +                  
Sbjct: 65  PNPVASFEG-HRGNVTSVSFQQDNKWMATSSEDGTIKVWDVRAPSIPRNYKLNAPVNEVV 123

Query: 501 ----KQELIAGTSDKYVP-----QMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTV 551
               + ELI+   D ++      +    H  T E    + S+ ++ D   L  +      
Sbjct: 124 IHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAANNKGNC 183

Query: 552 KVFFL------DSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFG-DCH 604
            V+ +       ++K       H   +  + +S D K + T SAD   ++W +D      
Sbjct: 184 YVWEMPNRTDASNLKPVTKFRSHNTYITRILLSSDVKHLATCSADHTARVWSVDDNFKLE 243

Query: 605 KSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD 663
            +L  HQ  +    F   S    +AS D +V+ WD    E +++   H      +A++D
Sbjct: 244 TTLDGHQRWVWDCAFSADSAYLMTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/254 (18%), Positives = 109/254 (42%), Gaps = 24/254 (9%)

Query: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
           +++V    +  ++ ++  + V   TI+ + +  +  L++TND K+L+  +  ++++ +D 
Sbjct: 3   VILVSAGYDHTIRFWEALTGVCSRTIQHS-DSQVNRLEITND-KKLLAAAGHQNVRLYDI 60

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558
           +        + + +                ++ S+    D+K++A S  D T+KV+ + +
Sbjct: 61  RTTNPNPVASFEGH--------------RGNVTSVSFQQDNKWMATSSEDGTIKVWDVRA 106

Query: 559 MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDS-IMCV 617
                + Y    PV  + I  +   +I+   D +I+IW L    C   L    D+ +  +
Sbjct: 107 PSIPRN-YKLNAPVNEVVIHPNQGELISCDRDGHIRIWDLGENQCTHQLTPEDDTPLQSL 165

Query: 618 KFLPGSHNFFSASKDGFVKYW------DGDKFECIQKLAAHQSEVWALAVSDNGERVVSV 671
                     +A+  G    W      D    + + K  +H + +  + +S + + + + 
Sbjct: 166 SLASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTKFRSHNTYITRILLSSDVKHLATC 225

Query: 672 SHDHSIRIWEETDD 685
           S DH+ R+W   D+
Sbjct: 226 SADHTARVWSVDDN 239

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 56/108 (51%), Gaps = 8/108 (7%)

Query: 91  LIAAGYADGVIKLWDL--VSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDL 148
           L AAG+ +  ++L+D+   +   + SF GH+  +T + F +    + + SED  I VWD+
Sbjct: 47  LAAAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNKWMATSSEDGTIKVWDV 104

Query: 149 VSE--VGLYKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQQC 194
            +      YKL +    +  +   +   LIS  +DG I++WDL   QC
Sbjct: 105 RAPSIPRNYKLNAPVNEV--VIHPNQGELISCDRDGHIRIWDLGENQC 150

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 75.1 bits (183), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 100/230 (43%), Gaps = 22/230 (9%)

Query: 459 VLLTTIEAAHEGAIWSLDVTNDGKR--LVTGSADKSIKFWDFQVKQELIAGTSDKYVPQM 516
           VL  T+E  H G + SL  T+ G+   LV+ S DK++  W      +        +    
Sbjct: 7   VLRGTLEG-HNGWVTSL-ATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGHN 64

Query: 517 NIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLD 576
           +IV D  L           + D  +   +  D T++++ + + + +    GHK  V+S+ 
Sbjct: 65  HIVQDCAL-----------TADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVA 113

Query: 577 ISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSH------NFFSAS 630
           I     +II+ S DK IK+W +  GDC  +L  H D +  V+  P            SA 
Sbjct: 114 IDRKASMIISGSRDKTIKVWSIK-GDCLATLLGHNDWVSQVRVAPNEKQEDDNVTLISAG 172

Query: 631 KDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIW 680
            D  VK W+ ++F+       H + + ++  S +G  V S   D  I +W
Sbjct: 173 SDKMVKAWNINQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLW 222

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 61/141 (43%), Gaps = 10/141 (7%)

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKL 157
           D  ++LW++ +      F GHKS +  +  D+  + +ISGS D  I VW +  +  L  L
Sbjct: 85  DKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWSIKGDC-LATL 143

Query: 158 RSHKGTITGLWC-------DSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGI 210
             H   ++ +         D +  LIS   D ++K W++   Q     + H     ++  
Sbjct: 144 LGHNDWVSQVRVAPNEKQEDDNVTLISAGSDKMVKAWNINQFQIEADFVGHNNYINSITA 203

Query: 211 MTD--FVVTSSADSQLKIWQM 229
             D   V ++  D  + +W +
Sbjct: 204 SPDGSLVASAGKDGDIMLWNL 224

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 73/159 (45%), Gaps = 9/159 (5%)

Query: 39  VITGALE-NISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYA 97
           +I+G+ +  I VW +K   L  +L      G  D  S      +  Q      LI+AG +
Sbjct: 121 IISGSRDKTIKVWSIKGDCLATLL------GHNDWVSQVRVAPNEKQEDDNVTLISAG-S 173

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKL 157
           D ++K W++    +   F GH + I  +     G+ + S  +D +I++W+L  +  LY L
Sbjct: 174 DKMVKAWNINQFQIEADFVGHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTL 233

Query: 158 RSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIE 196
            +        +  +  WL + +  G IKV+ L+ +  I+
Sbjct: 234 SAQDEVFALAFSPNRYWLTAATATG-IKVYSLEDEVLID 271

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 52/121 (42%), Gaps = 10/121 (8%)

Query: 385 GSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFEC-GYALTCKFLPGGLLVV 442
           G    + SI  S D +L+A+A  +G++ +WNL  K+ + T           F P    + 
Sbjct: 193 GHNNYINSITASPDGSLVASAGKDGDIMLWNLKQKTPLYTLSAQDEVFALAFSPNRYWLT 252

Query: 443 VGTREGNLQLFDLASSVLL-------TTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKF 495
             T  G ++++ L   VL+       T    A E    SL  + DG+ L  G  D  I+ 
Sbjct: 253 AATATG-IKVYSLEDEVLIDELKPEFTGYNKAAEPHAVSLTWSADGQTLFAGYTDSIIRV 311

Query: 496 W 496
           W
Sbjct: 312 W 312

 Score = 38.1 bits (87), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 2/89 (2%)

Query: 114 SFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSD- 172
           SF GH   +        G   +S S D  + +W++ +     +   HK  +  +  D   
Sbjct: 59  SFKGHNHIVQDCALTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKA 118

Query: 173 NWLISTSKDGLIKVWDLKTQQCIETHIAH 201
           + +IS S+D  IKVW +K   C+ T + H
Sbjct: 119 SMIISGSRDKTIKVWSIK-GDCLATLLGH 146

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/125 (20%), Positives = 52/125 (41%), Gaps = 9/125 (7%)

Query: 114 SFNGHKSRITMLKFDKTGTQL-ISGSEDSNIIVWDLVSE-----VGLYKLRSHKGTITGL 167
           +  GH   +T L        L +S S D  +I W L  +     V +   + H   +   
Sbjct: 11  TLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKGHNHIVQDC 70

Query: 168 WCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGI--MTDFVVTSSADSQL 224
              +D  + +S S D  +++W++ T +  +    H  +  ++ I      +++ S D  +
Sbjct: 71  ALTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTI 130

Query: 225 KIWQM 229
           K+W +
Sbjct: 131 KVWSI 135

>TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score = 75.1 bits (183), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 56/252 (22%), Positives = 114/252 (45%), Gaps = 17/252 (6%)

Query: 371 TSPTPIKAHTIELQGSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYA 429
           T+P P+ +     +G R +V SI    DN  + ++S +G +K+W++   S  R ++    
Sbjct: 63  TNPNPVAS----FEGHRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVPRNYKHNAP 118

Query: 430 LTCKFL-PGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGS 488
           +    + P    ++   R+GN++++DL  +     +    +  + SL + +DG  LV  +
Sbjct: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAAN 178

Query: 489 ADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLD 548
           +  +   W+   + +     +    P       +T      I  I +S D K LA    D
Sbjct: 179 SKGNCYVWEMPNRTD-----ASNLKPVTKFRSHATY-----ITRILLSSDVKHLATCSAD 228

Query: 549 NTVKVFFLDS-MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSL 607
           +T +V+ +D+  +   +L GH+  V     S D+  ++T+S+D  +++W L   +  +  
Sbjct: 229 HTARVWSIDNNFELETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTKEIVRQY 288

Query: 608 FAHQDSIMCVKF 619
             H    +CV  
Sbjct: 289 GGHHKGAVCVAL 300

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 57/292 (19%), Positives = 120/292 (41%), Gaps = 28/292 (9%)

Query: 383 LQGSRTDVRSIDISDDNALLATASNGELKIWNLNT--KSCIRTFEC--GYALTCKFLPGG 438
           +Q S + V  ++I+ D  LLA A +  ++++++ T   + + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITSDKKLLAAAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSISFQQDN 87

Query: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
             +V  + +G ++++D+ +  +    +  H   +  + +  +   L++   D +I+ WD 
Sbjct: 88  KWMVSSSEDGTIKVWDVRAPSVPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFL-- 556
              Q                 H  T E    + S+ ++ D   L  +       V+ +  
Sbjct: 146 GENQ---------------CTHQLTPEDDTPLQSLSLASDGSMLVAANSKGNCYVWEMPN 190

Query: 557 ----DSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFG-DCHKSLFAHQ 611
                ++K       H   +  + +S D K + T SAD   ++W +D   +   +L  HQ
Sbjct: 191 RTDASNLKPVTKFRSHATYITRILLSSDVKHLATCSADHTARVWSIDNNFELETTLDGHQ 250

Query: 612 DSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD 663
             +    F   S    +AS D +V+ WD    E +++   H      +A++D
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTKEIVRQYGGHHKGAVCVALND 302

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 61/120 (50%), Gaps = 5/120 (4%)

Query: 78  AEVSYLQFHSETGLIAAGYADGVIKLWDL--VSKTVLLSFNGHKSRITMLKFDKTGTQLI 135
           ++V+ L+  S+  L+AA     V +L+D+   +   + SF GH+  +T + F +    ++
Sbjct: 33  SQVNRLEITSDKKLLAAAGHQNV-RLYDIRTTNPNPVASFEGHRGNVTSISFQQDNKWMV 91

Query: 136 SGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNW-LISTSKDGLIKVWDLKTQQC 194
           S SED  I VWD V    + +   H   +  +    +   LIS  +DG I++WDL   QC
Sbjct: 92  SSSEDGTIKVWD-VRAPSVPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/292 (20%), Positives = 118/292 (40%), Gaps = 29/292 (9%)

Query: 401 LLATASNGELKIWNLNTKSCIRTFECGYALTCKF-LPGGLLVVVGTREGNLQLFDLASSV 459
           L++   +  ++ W   T  C RT +   +   +  +     ++      N++L+D+ ++ 
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITSDKKLLAAAGHQNVRLYDIRTTN 64

Query: 460 L--LTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMN 517
              + + E  H G + S+    D K +V+ S D +IK WD +             VP+ N
Sbjct: 65  PNPVASFEG-HRGNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPS----------VPR-N 112

Query: 518 IVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHK-LPVLSLD 576
             H++ +        + I  +   L     D  ++++ L   +    L      P+ SL 
Sbjct: 113 YKHNAPVN------EVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTPLQSLS 166

Query: 577 ISDDTKVIITSSADKNIKIWGLDFGDCHKSL------FAHQDSIMCVKFLPGSHNFFSAS 630
           ++ D  +++ +++  N  +W +       +L       +H   I  +       +  + S
Sbjct: 167 LASDGSMLVAANSKGNCYVWEMPNRTDASNLKPVTKFRSHATYITRILLSSDVKHLATCS 226

Query: 631 KDGFVKYWDGDK-FECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
            D   + W  D  FE    L  HQ  VW  A S +   +V+ S DH +R+W+
Sbjct: 227 ADHTARVWSIDNNFELETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWD 278

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 84/204 (41%), Gaps = 11/204 (5%)

Query: 37  GKVITGALENISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGY 96
           G V + + +  + W + +SE   +    +   SV       A V+ +  H   G + +  
Sbjct: 76  GNVTSISFQQDNKWMVSSSEDGTIKVWDVRAPSVPRNYKHNAPVNEVVIHPNQGELISCD 135

Query: 97  ADGVIKLWDLVSKTVLLSFNGHK-SRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVG-- 153
            DG I++WDL              + +  L     G+ L++ +   N  VW++ +     
Sbjct: 136 RDGNIRIWDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAANSKGNCYVWEMPNRTDAS 195

Query: 154 ----LYKLRSHKGTITGLWCDSD-NWLISTSKDGLIKVWDLKTQQCIETHI-AHTGECWA 207
               + K RSH   IT +   SD   L + S D   +VW +     +ET +  H    W 
Sbjct: 196 NLKPVTKFRSHATYITRILLSSDVKHLATCSADHTARVWSIDNNFELETTLDGHQRWVWD 255

Query: 208 LGIMTD--FVVTSSADSQLKIWQM 229
                D  ++VT+S+D  +++W +
Sbjct: 256 CAFSADSAYLVTASSDHYVRLWDL 279

>Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 112/252 (44%), Gaps = 17/252 (6%)

Query: 371 TSPTPIKAHTIELQGSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYA 429
           T+P P+ +     +G R +V S+    DN  + T+S +G +K+W++ + S  R ++    
Sbjct: 63  TNPNPVAS----FEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAP 118

Query: 430 LTCKFL-PGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGS 488
           +    + P    ++   R+GN++++DL  +     +    + ++ SL + +DG  L   +
Sbjct: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAAN 178

Query: 489 ADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLD 548
              +   W+     +     +    P       ST      I  I +S D K LA    D
Sbjct: 179 TKGNCYVWEMPNHTD-----ASHLKPVTKFRAHSTY-----ITRILLSSDVKHLATCSAD 228

Query: 549 NTVKVFFLDS-MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSL 607
           +T +V+ +D   K   +L GH+  V     S D+  ++T+S+D  +++W L   +  +  
Sbjct: 229 HTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQY 288

Query: 608 FAHQDSIMCVKF 619
             H    +CV  
Sbjct: 289 GGHHKGAVCVAL 300

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/292 (20%), Positives = 122/292 (41%), Gaps = 28/292 (9%)

Query: 383 LQGSRTDVRSIDISDDNALLATASNGELKIWNLNT--KSCIRTFEC--GYALTCKFLPGG 438
           +Q S + V  ++I++D  LLATA +  ++++++ T   + + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
             +V  + +G ++++D+ S  +    +  H   +  + +  +   L++   D +I+ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558
              Q                 H  T E    + S+ ++ D   LA +       V+ + +
Sbjct: 146 GENQ---------------CTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPN 190

Query: 559 ------MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFG-DCHKSLFAHQ 611
                 +K       H   +  + +S D K + T SAD   ++W +D       +L  HQ
Sbjct: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQ 250

Query: 612 DSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD 663
             +    F   S    +AS D +V+ WD    E +++   H      +A++D
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/254 (19%), Positives = 109/254 (42%), Gaps = 24/254 (9%)

Query: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
           +++V    +  ++ ++  + V   TI+ + +  +  L++TND K+L+  +  ++++ +D 
Sbjct: 3   VILVSAGYDHTIRFWEALTGVCSRTIQHS-DSQVNRLEITND-KKLLATAGHQNVRLYDI 60

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558
           +        + + +                ++ S+    D++++  S  D T+KV+ + S
Sbjct: 61  RTTNPNPVASFEGH--------------RGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS 106

Query: 559 MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQD-SIMCV 617
                + Y H  PV  + I  +   +I+   D NI+IW L    C   L    D S+  +
Sbjct: 107 PSIPRN-YKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSL 165

Query: 618 KFLPGSHNFFSASKDGFVKYW------DGDKFECIQKLAAHQSEVWALAVSDNGERVVSV 671
                     +A+  G    W      D    + + K  AH + +  + +S + + + + 
Sbjct: 166 SMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATC 225

Query: 672 SHDHSIRIWEETDD 685
           S DH+ R+W   DD
Sbjct: 226 SADHTARVWSIDDD 239

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 65/123 (52%), Gaps = 7/123 (5%)

Query: 78  AEVSYLQFHSETGLIA-AGYADGVIKLWDL--VSKTVLLSFNGHKSRITMLKFDKTGTQL 134
           ++V+ L+  ++  L+A AG+ +  ++L+D+   +   + SF GH+  +T + F +    +
Sbjct: 33  SQVNRLEITNDKKLLATAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWM 90

Query: 135 ISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNW-LISTSKDGLIKVWDLKTQQ 193
           ++ SED  I VWD+ S   + +   H   +  +    +   LIS  +DG I++WDL   Q
Sbjct: 91  VTSSEDGTIKVWDVRSP-SIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149

Query: 194 CIE 196
           C  
Sbjct: 150 CTH 152

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 81/195 (41%), Gaps = 26/195 (13%)

Query: 47  ISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDL 106
           I VWD+++           P    + K + P  V+ +  H   G + +   DG I++WDL
Sbjct: 99  IKVWDVRS-----------PSIPRNYKHNAP--VNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 107 VSKTVLLSFNGHK-SRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVG------LYKLRS 159
                         + +  L     G+ L + +   N  VW++ +         + K R+
Sbjct: 146 GENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRA 205

Query: 160 HKGTITGLWCDSD-NWLISTSKDGLIKVW----DLKTQQCIETHIAHTGECWALGIMTDF 214
           H   IT +   SD   L + S D   +VW    D K +  ++ H     +C A    + +
Sbjct: 206 HSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC-AFSADSAY 264

Query: 215 VVTSSADSQLKIWQM 229
           +VT+S+D  +++W +
Sbjct: 265 LVTASSDHYVRLWDL 279

>YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protein
           required for the transport of amino acid permease Gap1p
           from the Golgi to the cell surface; component of the TOR
           signaling pathway; associates with both Tor1p and Tor2p;
           contains a WD-repeat
          Length = 303

 Score = 74.7 bits (182), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 112/252 (44%), Gaps = 17/252 (6%)

Query: 371 TSPTPIKAHTIELQGSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYA 429
           T+P P+ +     +G R +V S+    DN  + T+S +G +K+W++ + S  R ++    
Sbjct: 63  TNPNPVAS----FEGHRGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRSPSIPRNYKHNAP 118

Query: 430 LTCKFL-PGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGS 488
           +    + P    ++   R+GN++++DL  +     +    + ++ SL + +DG  L   +
Sbjct: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSLSMASDGSMLAAAN 178

Query: 489 ADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLD 548
              +   W+     +     +    P       ST      I  I +S D K LA    D
Sbjct: 179 TKGNCYVWEMPNHTD-----ASHLKPVTKFRAHSTY-----ITRILLSSDVKHLATCSAD 228

Query: 549 NTVKVFFLDS-MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSL 607
           +T +V+ +D   K   +L GH+  V     S D+  ++T+S+D  +++W L   +  +  
Sbjct: 229 HTARVWSIDDDFKLETTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQY 288

Query: 608 FAHQDSIMCVKF 619
             H    +CV  
Sbjct: 289 GGHHKGAVCVAL 300

 Score = 66.6 bits (161), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/292 (20%), Positives = 122/292 (41%), Gaps = 28/292 (9%)

Query: 383 LQGSRTDVRSIDISDDNALLATASNGELKIWNLNT--KSCIRTFEC--GYALTCKFLPGG 438
           +Q S + V  ++I++D  LLATA +  ++++++ T   + + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLATAGHQNVRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDN 87

Query: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
             +V  + +G ++++D+ S  +    +  H   +  + +  +   L++   D +I+ WD 
Sbjct: 88  RWMVTSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558
              Q                 H  T E    + S+ ++ D   LA +       V+ + +
Sbjct: 146 GENQ---------------CTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPN 190

Query: 559 ------MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFG-DCHKSLFAHQ 611
                 +K       H   +  + +S D K + T SAD   ++W +D       +L  HQ
Sbjct: 191 HTDASHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQ 250

Query: 612 DSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD 663
             +    F   S    +AS D +V+ WD    E +++   H      +A++D
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREIVRQYGGHHKGAVCVALND 302

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/254 (19%), Positives = 109/254 (42%), Gaps = 24/254 (9%)

Query: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
           +++V    +  ++ ++  + V   TI+ + +  +  L++TND K+L+  +  ++++ +D 
Sbjct: 3   VILVSAGYDHTIRFWEALTGVCSRTIQHS-DSQVNRLEITND-KKLLATAGHQNVRLYDI 60

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558
           +        + + +                ++ S+    D++++  S  D T+KV+ + S
Sbjct: 61  RTTNPNPVASFEGH--------------RGNVTSVSFQQDNRWMVTSSEDGTIKVWDVRS 106

Query: 559 MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQD-SIMCV 617
                + Y H  PV  + I  +   +I+   D NI+IW L    C   L    D S+  +
Sbjct: 107 PSIPRN-YKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDTSLQSL 165

Query: 618 KFLPGSHNFFSASKDGFVKYW------DGDKFECIQKLAAHQSEVWALAVSDNGERVVSV 671
                     +A+  G    W      D    + + K  AH + +  + +S + + + + 
Sbjct: 166 SMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRAHSTYITRILLSSDVKHLATC 225

Query: 672 SHDHSIRIWEETDD 685
           S DH+ R+W   DD
Sbjct: 226 SADHTARVWSIDDD 239

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 65/123 (52%), Gaps = 7/123 (5%)

Query: 78  AEVSYLQFHSETGLIA-AGYADGVIKLWDL--VSKTVLLSFNGHKSRITMLKFDKTGTQL 134
           ++V+ L+  ++  L+A AG+ +  ++L+D+   +   + SF GH+  +T + F +    +
Sbjct: 33  SQVNRLEITNDKKLLATAGHQN--VRLYDIRTTNPNPVASFEGHRGNVTSVSFQQDNRWM 90

Query: 135 ISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNW-LISTSKDGLIKVWDLKTQQ 193
           ++ SED  I VWD+ S   + +   H   +  +    +   LIS  +DG I++WDL   Q
Sbjct: 91  VTSSEDGTIKVWDVRSP-SIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQ 149

Query: 194 CIE 196
           C  
Sbjct: 150 CTH 152

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 81/195 (41%), Gaps = 26/195 (13%)

Query: 47  ISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDL 106
           I VWD+++           P    + K + P  V+ +  H   G + +   DG I++WDL
Sbjct: 99  IKVWDVRS-----------PSIPRNYKHNAP--VNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 107 VSKTVLLSFNGHK-SRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVG------LYKLRS 159
                         + +  L     G+ L + +   N  VW++ +         + K R+
Sbjct: 146 GENQCTHQLTPEDDTSLQSLSMASDGSMLAAANTKGNCYVWEMPNHTDASHLKPVTKFRA 205

Query: 160 HKGTITGLWCDSD-NWLISTSKDGLIKVW----DLKTQQCIETHIAHTGECWALGIMTDF 214
           H   IT +   SD   L + S D   +VW    D K +  ++ H     +C A    + +
Sbjct: 206 HSTYITRILLSSDVKHLATCSADHTARVWSIDDDFKLETTLDGHQRWVWDC-AFSADSAY 264

Query: 215 VVTSSADSQLKIWQM 229
           +VT+S+D  +++W +
Sbjct: 265 LVTASSDHYVRLWDL 279

>KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}
           Anc_7.534 YPR178W
          Length = 461

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 102/248 (41%), Gaps = 19/248 (7%)

Query: 436 PGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKF 495
           P   +   G   G+L+LF+  +      I+  H G I  LD    G  LVTG+ D  +K 
Sbjct: 186 PNDEVFATGDWNGDLKLFNSKTLEPTVKIDNVHSGKIGGLDWNKTGGMLVTGAEDGMVKL 245

Query: 496 WDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDD--ILSIKISGDDKFLAISLLDNTVKV 553
           + +                  N + ++T+  G +  +++ K     +FL  +  D T ++
Sbjct: 246 YSYT----------------SNEIKETTVLKGHEKRVVATKFHPSTRFLGSTSFDTTWRL 289

Query: 554 FFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDS 613
           + + + +  L   GH   V SL    D  ++ T   D    +W +  G    +L  H   
Sbjct: 290 WDIATSQELLLQEGHSKEVYSLSFQGDGSLVCTGGLDNTALLWDIRCGKSIMTLNGHSKP 349

Query: 614 IMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGER-VVSVS 672
           + CV +    +N  +   DG +  WD  K   +  + AH + +  L  +    + +VS S
Sbjct: 350 VYCVDWSCNGYNVATGGGDGLINIWDIRKTNLVNTILAHNNIISDLRFAKQDSKCLVSCS 409

Query: 673 HDHSIRIW 680
           +D  I I+
Sbjct: 410 YDKKINIY 417

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/158 (24%), Positives = 71/158 (44%), Gaps = 18/158 (11%)

Query: 84  QFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNI 143
           +FH  T  + +   D   +LWD+ +   LL   GH   +  L F   G+ + +G  D+  
Sbjct: 270 KFHPSTRFLGSTSFDTTWRLWDIATSQELLLQEGHSKEVYSLSFQGDGSLVCTGGLDNTA 329

Query: 144 IVWDLVSEVGLYKLRSHKGTITGL-W-CDSDNWLISTSKDGLIKVWDLKTQQCIETHIAH 201
           ++WD+     +  L  H   +  + W C+  N + +   DGLI +WD++    + T +AH
Sbjct: 330 LLWDIRCGKSIMTLNGHSKPVYCVDWSCNGYN-VATGGGDGLINIWDIRKTNLVNTILAH 388

Query: 202 TGECWALGIMTDF---------VVTSSADSQLKIWQMD 230
                   I++D          +V+ S D ++ I+  D
Sbjct: 389 N------NIISDLRFAKQDSKCLVSCSYDKKINIYSSD 420

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 75/169 (44%), Gaps = 18/169 (10%)

Query: 428 YALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTG 487
           Y+L+  F   G LV  G  +    L+D+     + T+   H   ++ +D + +G  + TG
Sbjct: 309 YSLS--FQGDGSLVCTGGLDNTALLWDIRCGKSIMTLNG-HSKPVYCVDWSCNGYNVATG 365

Query: 488 SADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLL 547
             D  I  WD + K  L+    +  +   NI+ D                D K L     
Sbjct: 366 GGDGLINIWDIR-KTNLV----NTILAHNNIISDLRF----------AKQDSKCLVSCSY 410

Query: 548 DNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIW 596
           D  + ++  D+     +L GH   +LS+D++++ K +I+   D+++K+W
Sbjct: 411 DKKINIYSSDNWLKVKTLEGHSHNILSVDMTNNAKALISGGWDRSVKLW 459

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 76/179 (42%), Gaps = 6/179 (3%)

Query: 56  ELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLS- 114
           +L+   S  L P +V + +    ++  L ++   G++  G  DG++KL+   S  +  + 
Sbjct: 199 DLKLFNSKTLEP-TVKIDNVHSGKIGGLDWNKTGGMLVTGAEDGMVKLYSYTSNEIKETT 257

Query: 115 -FNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDN 173
              GH+ R+   KF  +   L S S D+   +WD+ +   L     H   +  L    D 
Sbjct: 258 VLKGHEKRVVATKFHPSTRFLGSTSFDTTWRLWDIATSQELLLQEGHSKEVYSLSFQGDG 317

Query: 174 WLISTSK-DGLIKVWDLKTQQCIETHIAHTGECWALGIMTDF--VVTSSADSQLKIWQM 229
            L+ T   D    +WD++  + I T   H+   + +    +   V T   D  + IW +
Sbjct: 318 SLVCTGGLDNTALLWDIRCGKSIMTLNGHSKPVYCVDWSCNGYNVATGGGDGLINIWDI 376

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/184 (21%), Positives = 79/184 (42%), Gaps = 16/184 (8%)

Query: 49  VWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVS 108
           +WD+ TS+ E +L +G              EV  L F  +  L+  G  D    LWD+  
Sbjct: 289 LWDIATSQ-ELLLQEG-----------HSKEVYSLSFQGDGSLVCTGGLDNTALLWDIRC 336

Query: 109 KTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL- 167
              +++ NGH   +  + +   G  + +G  D  I +WD+     +  + +H   I+ L 
Sbjct: 337 GKSIMTLNGHSKPVYCVDWSCNGYNVATGGGDGLINIWDIRKTNLVNTILAHNNIISDLR 396

Query: 168 WCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTD--FVVTSSADSQL 224
           +   D+  L+S S D  I ++       ++T   H+    ++ +  +   +++   D  +
Sbjct: 397 FAKQDSKCLVSCSYDKKINIYSSDNWLKVKTLEGHSHNILSVDMTNNAKALISGGWDRSV 456

Query: 225 KIWQ 228
           K+W 
Sbjct: 457 KLWH 460

 Score = 38.5 bits (88), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 31/155 (20%), Positives = 70/155 (45%), Gaps = 3/155 (1%)

Query: 530 ILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYG-HKLPVLSLDISDDTKVIITSS 588
           I  I I+ +D+  A    +  +K+F   +++  + +   H   +  LD +    +++T +
Sbjct: 179 ISKIAIAPNDEVFATGDWNGDLKLFNSKTLEPTVKIDNVHSGKIGGLDWNKTGGMLVTGA 238

Query: 589 ADKNIKIWGLDFGDCHKS--LFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECI 646
            D  +K++     +  ++  L  H+  ++  KF P +    S S D   + WD    + +
Sbjct: 239 EDGMVKLYSYTSNEIKETTVLKGHEKRVVATKFHPSTRFLGSTSFDTTWRLWDIATSQEL 298

Query: 647 QKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
                H  EV++L+   +G  V +   D++  +W+
Sbjct: 299 LLQEGHSKEVYSLSFQGDGSLVCTGGLDNTALLWD 333

>TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.399
           YNL006W
          Length = 304

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/283 (22%), Positives = 129/283 (45%), Gaps = 23/283 (8%)

Query: 341 LSLSTKLEVVVTTNSNTIEYYSVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNA 400
           L ++   +++    SN I+ Y V     +P +            G + +V SI+   +N 
Sbjct: 38  LEITNDKKLLAAAGSNNIKLYDVNTSNSNPIA---------SFDGHKNNVTSINFQVENK 88

Query: 401 LLATAS-NGELKIWNLNTKSCIRTFECGYALTCKFL-PGGLLVVVGTREGNLQLFDLASS 458
            + T+S +  +K+W++ + S  RT++    +    + P    ++   ++GN++++DL  +
Sbjct: 89  WMVTSSEDNTIKLWDIRSPSSPRTYKHNCPVNEVIIHPNQGELISCDKDGNIRIWDLGEN 148

Query: 459 VLLTTIEAA-HEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMN 517
                +    ++ +I S+ + NDG  LV  +   +   WD   K   I  ++ K + +  
Sbjct: 149 QCTHQLTPEDNDISIQSISLANDGSMLVAANNKGNCYVWDMPNK---IDASNLKPITKFK 205

Query: 518 IVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFL-DSMKFFLSLYGHKLPVLSLD 576
             HDS       I  I +S D K++A    D+T +++ + D+     +L GH+  V    
Sbjct: 206 -AHDSY------ITKILLSSDVKYMATCSADHTARIWSVEDNFTLDKTLTGHQRWVWDCA 258

Query: 577 ISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKF 619
            S D+  ++T+S+D  +++W L   +  +    HQ    CV  
Sbjct: 259 FSADSAYLVTASSDHYVRLWDLSTNEIVRQYSGHQKGATCVAL 301

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/287 (21%), Positives = 127/287 (44%), Gaps = 17/287 (5%)

Query: 383 LQGSRTDVRSIDISDDNALLATASNGELKIWNLNTKSC--IRTFECGY---ALTCKFLPG 437
           +Q   + V  ++I++D  LLA A +  +K++++NT +   I +F+ G+     +  F   
Sbjct: 28  IQHPDSQVNKLEITNDKKLLAAAGSNNIKLYDVNTSNSNPIASFD-GHKNNVTSINFQVE 86

Query: 438 GLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWD 497
              +V  + +  ++L+D+ S     T +  H   +  + +  +   L++   D +I+ WD
Sbjct: 87  NKWMVTSSEDNTIKLWDIRSPSSPRTYK--HNCPVNEVIIHPNQGELISCDKDGNIRIWD 144

Query: 498 FQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLD 557
               Q      + +  P+ N +   ++ L +D   +  + +     +  + N +      
Sbjct: 145 LGENQ-----CTHQLTPEDNDISIQSISLANDGSMLVAANNKGNCYVWDMPNKIDA---S 196

Query: 558 SMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGL-DFGDCHKSLFAHQDSIMC 616
           ++K       H   +  + +S D K + T SAD   +IW + D     K+L  HQ  +  
Sbjct: 197 NLKPITKFKAHDSYITKILLSSDVKYMATCSADHTARIWSVEDNFTLDKTLTGHQRWVWD 256

Query: 617 VKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD 663
             F   S    +AS D +V+ WD    E +++ + HQ     +A++D
Sbjct: 257 CAFSADSAYLVTASSDHYVRLWDLSTNEIVRQYSGHQKGATCVALND 303

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 64/119 (53%), Gaps = 3/119 (2%)

Query: 78  AEVSYLQFHSETGLIAAGYADGVIKLWDL--VSKTVLLSFNGHKSRITMLKFDKTGTQLI 135
           ++V+ L+  ++  L+AA  ++  IKL+D+   +   + SF+GHK+ +T + F      ++
Sbjct: 33  SQVNKLEITNDKKLLAAAGSNN-IKLYDVNTSNSNPIASFDGHKNNVTSINFQVENKWMV 91

Query: 136 SGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQQC 194
           + SED+ I +WD+ S       + +      +   +   LIS  KDG I++WDL   QC
Sbjct: 92  TSSEDNTIKLWDIRSPSSPRTYKHNCPVNEVIIHPNQGELISCDKDGNIRIWDLGENQC 150

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/204 (20%), Positives = 90/204 (44%), Gaps = 26/204 (12%)

Query: 39  VITGALEN-ISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYA 97
           ++T + +N I +WD+++           P      K + P  V+ +  H   G + +   
Sbjct: 90  MVTSSEDNTIKLWDIRS-----------PSSPRTYKHNCP--VNEVIIHPNQGELISCDK 136

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITM--LKFDKTGTQLISGSEDSNIIVWDLVSEVG-- 153
           DG I++WDL             + I++  +     G+ L++ +   N  VWD+ +++   
Sbjct: 137 DGNIRIWDLGENQCTHQLTPEDNDISIQSISLANDGSMLVAANNKGNCYVWDMPNKIDAS 196

Query: 154 ----LYKLRSHKGTITGLWCDSD-NWLISTSKDGLIKVWDLKTQQCIE-THIAHTGECWA 207
               + K ++H   IT +   SD  ++ + S D   ++W ++    ++ T   H    W 
Sbjct: 197 NLKPITKFKAHDSYITKILLSSDVKYMATCSADHTARIWSVEDNFTLDKTLTGHQRWVWD 256

Query: 208 LGIMTD--FVVTSSADSQLKIWQM 229
                D  ++VT+S+D  +++W +
Sbjct: 257 CAFSADSAYLVTASSDHYVRLWDL 280

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 58/111 (52%), Gaps = 5/111 (4%)

Query: 91  LIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVS 150
           L++AGY D  I+ W+ ++     +     S++  L+      +L++ +  +NI ++D+ +
Sbjct: 5   LVSAGY-DHTIRFWEALTGVCSRTIQHPDSQVNKLEI-TNDKKLLAAAGSNNIKLYDVNT 62

Query: 151 EVG--LYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETH 198
                +     HK  +T +    +N W++++S+D  IK+WD+++     T+
Sbjct: 63  SNSNPIASFDGHKNNVTSINFQVENKWMVTSSEDNTIKLWDIRSPSSPRTY 113

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/302 (21%), Positives = 124/302 (41%), Gaps = 48/302 (15%)

Query: 383 LQGSRTDVRSIDISDDNALLATA-SNGELKIWNLNTKSCIRTFECGYALTCKFLPGGLLV 441
              + +++ S++ SDD  L A    +  +KIW+L+          G  L  K LP     
Sbjct: 423 FHNTNSEMTSLEFSDDVRLAAAGFQDSIIKIWSLD----------GEPLKNK-LPSKQ-- 469

Query: 442 VVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVK 501
             G R  N  L               H G ++S   + D + L++ S DK+++ W     
Sbjct: 470 --GERTNNETL-------------VGHSGTVYSTSFSPDNRYLLSASEDKTVRLW----- 509

Query: 502 QELIAGTSDKYVPQMNIV-HDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMK 560
                 ++D Y   +N   H+        I  +  S    + A +  D T +++  D + 
Sbjct: 510 ------STDTYTSLVNYKGHNHP------IWDVAFSPLGHYFATASHDQTARLWSCDHIY 557

Query: 561 FFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFL 620
                 GH   V ++    +   + T S+DK  ++W +  GD  +    H   +      
Sbjct: 558 PLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVS 617

Query: 621 PGSHNFFSASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHDHSIRI 679
           P      + S+DG +  WD    + ++++  H ++ V++L+ S  G  ++S   DHS+R+
Sbjct: 618 PDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRV 677

Query: 680 WE 681
           W+
Sbjct: 678 WD 679

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 81/181 (44%), Gaps = 17/181 (9%)

Query: 516 MNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS--MKFFL---------- 563
           M   H++  E+     S++ S D +  A    D+ +K++ LD   +K  L          
Sbjct: 420 MYTFHNTNSEM----TSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNN 475

Query: 564 -SLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPG 622
            +L GH   V S   S D + ++++S DK +++W  D      +   H   I  V F P 
Sbjct: 476 ETLVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPL 535

Query: 623 SHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEE 682
            H F +AS D   + W  D    ++  A H ++V  ++   NG  V + S D + R+W+ 
Sbjct: 536 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDI 595

Query: 683 T 683
           T
Sbjct: 596 T 596

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 67/152 (44%), Gaps = 5/152 (3%)

Query: 92  IAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSE 151
            A    D   +LW       L  F GH + +  + F   GT + +GS D    +WD+ S 
Sbjct: 539 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDITSG 598

Query: 152 VGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAH-TGECWALG 209
             +     H   +T      D  WL + S+DG+I VWD+ T + ++    H     ++L 
Sbjct: 599 DSVRLFLGHTAPVTSTAVSPDGRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLS 658

Query: 210 IMTD--FVVTSSADSQLKIWQMDLE-GEPGSK 238
              +   +++  AD  +++W +     EPGS+
Sbjct: 659 YSKEGHVLISGGADHSVRVWDVKKSTAEPGSE 690

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           +V  + FH     +  G +D   ++WD+ S   +  F GH + +T       G  L +GS
Sbjct: 568 DVDTVSFHPNGTYVFTGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWLSTGS 627

Query: 139 EDSNIIVWDLVSEVGLYKLRSH-KGTITGL-WCDSDNWLISTSKDGLIKVWDLK 190
           ED  I VWD+ +   L ++R H K  +  L +    + LIS   D  ++VWD+K
Sbjct: 628 EDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVWDVK 681

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 34/156 (21%), Positives = 66/156 (42%), Gaps = 32/156 (20%)

Query: 78  AEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISG 137
           +E++ L+F  +  L AAG+ D +IK+W L  + +       K+++   + ++T  + + G
Sbjct: 428 SEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPL-------KNKLPSKQGERTNNETLVG 480

Query: 138 SEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIE 196
                                 H GT+       DN +L+S S+D  +++W   T   + 
Sbjct: 481 ----------------------HSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLV 518

Query: 197 THIAHTGECW--ALGIMTDFVVTSSADSQLKIWQMD 230
            +  H    W  A   +  +  T+S D   ++W  D
Sbjct: 519 NYKGHNHPIWDVAFSPLGHYFATASHDQTARLWSCD 554

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 103/239 (43%), Gaps = 37/239 (15%)

Query: 375 PIKAHTIELQGSRTD----------VRSIDISDDNALLATASNGE-LKIWNLNTKSCIRT 423
           P+K      QG RT+          V S   S DN  L +AS  + +++W+ +T + +  
Sbjct: 460 PLKNKLPSKQGERTNNETLVGHSGTVYSTSFSPDNRYLLSASEDKTVRLWSTDTYTSLVN 519

Query: 424 FECGYALT---CKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTND 480
           ++ G+        F P G      + +   +L+     +    I A H   + ++    +
Sbjct: 520 YK-GHNHPIWDVAFSPLGHYFATASHDQTARLWS-CDHIYPLRIFAGHLNDVDTVSFHPN 577

Query: 481 GKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGD--DILSIKISGD 538
           G  + TGS+DK+ + WD      + +G S +            L LG    + S  +S D
Sbjct: 578 GTYVFTGSSDKTCRMWD------ITSGDSVR------------LFLGHTAPVTSTAVSPD 619

Query: 539 DKFLAISLLDNTVKVFFLDSMKFFLSLYGH-KLPVLSLDISDDTKVIITSSADKNIKIW 596
            ++L+    D  + V+ + + K    + GH K  V SL  S +  V+I+  AD ++++W
Sbjct: 620 GRWLSTGSEDGVINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLISGGADHSVRVW 678

>AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL137W
           (SEC27); 1-intron
          Length = 832

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 127/291 (43%), Gaps = 26/291 (8%)

Query: 386 SRTD-VRSIDISDDNA-LLATASNGELKIWNLNTKSCIRTFECGYA--LTCKFLPGGLLV 441
           SRTD V+ ID       +L T  +G  +IWN  T++ +R+     A     KF+P    +
Sbjct: 11  SRTDRVKGIDFHPSEPWVLITLYSGRAEIWNYETQTEVRSISVCEAPVRAGKFIPRKSWI 70

Query: 442 VVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVK 501
           +VG+ +  +++F+  +   +   EA H   I +L V      +++ S D ++K W+++  
Sbjct: 71  IVGSDDFKIRVFNYNTGEKVVDFEA-HPDYIRALAVHPTRSYVLSASDDLTVKLWNWE-- 127

Query: 502 QELIAGTSDKYVPQMNIVHDSTLELGDD-ILSIKISG-DDKFLAISLLDNTVKVFFLDSM 559
                          N   + T E  +  ++S+  +  D    A + LD+TVK++ L   
Sbjct: 128 --------------KNWALEQTFEGHEHFVMSVTFNPKDPNTFATACLDHTVKIWSLGQE 173

Query: 560 KFFLSLYGH---KLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMC 616
               +L  H    +  +      D   +ITSS D+ +K+W      C  +L  H  ++  
Sbjct: 174 TSNFTLRAHLEKGVNFVDYYPFQDKPYLITSSDDRTVKVWDYQTKSCVATLEGHLSNVSY 233

Query: 617 VKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGER 667
             + P      S S+DG VK W+ + ++  + L       W +A    G+R
Sbjct: 234 AVYHPMLPIIISGSEDGTVKIWNSNTYKLERTLNLGLERSWCVAAHPTGKR 284

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 73/162 (45%), Gaps = 8/162 (4%)

Query: 75  SKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVL-LSFNGHKSRITMLKFD-KTGT 132
           + P  +  L  H     + +   D  +KLW+      L  +F GH+  +  + F+ K   
Sbjct: 95  AHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNWALEQTFEGHEHFVMSVTFNPKDPN 154

Query: 133 QLISGSEDSNIIVWDLVSEVGLYKLRSH--KG-TITGLWCDSDN-WLISTSKDGLIKVWD 188
              +   D  + +W L  E   + LR+H  KG      +   D  +LI++S D  +KVWD
Sbjct: 155 TFATACLDHTVKIWSLGQETSNFTLRAHLEKGVNFVDYYPFQDKPYLITSSDDRTVKVWD 214

Query: 189 LKTQQCIETHIAH-TGECWAL-GIMTDFVVTSSADSQLKIWQ 228
            +T+ C+ T   H +   +A+   M   +++ S D  +KIW 
Sbjct: 215 YQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIWN 256

 Score = 35.8 bits (81), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 36/171 (21%), Positives = 66/171 (38%), Gaps = 24/171 (14%)

Query: 92  IAAGYADGVIKLWDLVSKTVLLSFNGHKSR----ITMLKFDKTGTQLISGSEDSNIIVWD 147
            A    D  +K+W L  +T   +   H  +    +    F +    LI+ S+D  + VWD
Sbjct: 156 FATACLDHTVKIWSLGQETSNFTLRAHLEKGVNFVDYYPF-QDKPYLITSSDDRTVKVWD 214

Query: 148 LVSEVGLYKLRSHKGTIT-GLWCDSDNWLISTSKDGLIKVWDLKTQQ------------- 193
             ++  +  L  H   ++  ++      +IS S+DG +K+W+  T +             
Sbjct: 215 YQTKSCVATLEGHLSNVSYAVYHPMLPIIISGSEDGTVKIWNSNTYKLERTLNLGLERSW 274

Query: 194 CIETHIAHTGECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLIEKGA 244
           C+  H        A G    F V +  + + +     L  +P  KL+  G 
Sbjct: 275 CVAAHPTGKRNFIAAGFDNGFTVLAIGNDEPR-----LSLDPVGKLVWCGG 320

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/180 (20%), Positives = 77/180 (42%), Gaps = 12/180 (6%)

Query: 75  SKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQL 134
           S+   V  + FH     +      G  ++W+  ++T + S +  ++ +   KF    + +
Sbjct: 11  SRTDRVKGIDFHPSEPWVLITLYSGRAEIWNYETQTEVRSISVCEAPVRAGKFIPRKSWI 70

Query: 135 ISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCD-SDNWLISTSKDGLIKVWDLKTQQ 193
           I GS+D  I V++  +   +    +H   I  L    + ++++S S D  +K+W+ +   
Sbjct: 71  IVGSDDFKIRVFNYNTGEKVVDFEAHPDYIRALAVHPTRSYVLSASDDLTVKLWNWEKNW 130

Query: 194 CIE-THIAHTGECWALGIM-----TDFVVTSSADSQLKIWQMDLEGEPGSKLIEKGAFEK 247
            +E T   H  E + + +       +   T+  D  +KIW +   G+  S    +   EK
Sbjct: 131 ALEQTFEGH--EHFVMSVTFNPKDPNTFATACLDHTVKIWSL---GQETSNFTLRAHLEK 185

>KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 755

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/216 (20%), Positives = 91/216 (42%), Gaps = 17/216 (7%)

Query: 467 AHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLEL 526
            H G ++S   + D + L++ S DK+++ W       L++     +              
Sbjct: 480 GHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNH-------------- 525

Query: 527 GDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIIT 586
              I  +  S    + A +  D T +++  D +       GH   V ++    +   + T
Sbjct: 526 --PIWDVAFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFT 583

Query: 587 SSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECI 646
            S+DK  ++W +  GD  +    H   +      P      + S+DG +  WD    + +
Sbjct: 584 GSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRL 643

Query: 647 QKLAAH-QSEVWALAVSDNGERVVSVSHDHSIRIWE 681
           +++  H ++ V++L+ S  G  +VS   DHS+R+W+
Sbjct: 644 KQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWD 679

 Score = 68.2 bits (165), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 81/188 (43%), Gaps = 18/188 (9%)

Query: 516 MNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFF------------- 562
           M   H++  E+     S++ S D +  +    D+ VK++ LD                  
Sbjct: 420 MYTFHNTNSEM----TSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNN 475

Query: 563 LSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPG 622
            +L GH   V S   S D + ++++S DK +++W  D      S   H   I  V F P 
Sbjct: 476 ATLVGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPL 535

Query: 623 SHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE- 681
            H F +AS D   + W  D    ++  A H ++V  ++   NG  V + S D + R+W+ 
Sbjct: 536 GHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDM 595

Query: 682 ETDDQVFL 689
            T D V L
Sbjct: 596 STGDSVRL 603

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 85/206 (41%), Gaps = 18/206 (8%)

Query: 92  IAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSE 151
            A    D   +LW       L  F GH + +  + F   GT + +GS D    +WD+ + 
Sbjct: 539 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTG 598

Query: 152 VGLYKLRSHKGTITGLWCDSD-NWLISTSKDGLIKVWDLKTQQCIETHIAH-TGECWALG 209
             +     H   +T      D  WL + S+DG+I VWD+ T + ++    H     ++L 
Sbjct: 599 DSVRLFLGHTAPVTATAVSPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLS 658

Query: 210 IMTD--FVVTSSADSQLKIWQMDLE-GEPGSKLIEK---------GAFEKQSKQRGLSIE 257
              +   +V+  AD  L++W +     EPGS+  +           +  +  K+ G    
Sbjct: 659 YSKEGHVLVSGGADHSLRVWDVKKSTAEPGSEPEQPFTSFSGDVTTSVNQDIKEYGRRRT 718

Query: 258 FTTTSDGVHFFYVQNADKTVEIFRLR 283
              TSD V  FY     K   +F+++
Sbjct: 719 IVPTSDLVASFYT----KKTPVFKVK 740

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           +V  + FH     +  G +D   ++WD+ +   +  F GH + +T       G  L +GS
Sbjct: 568 DVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWLSTGS 627

Query: 139 EDSNIIVWDLVSEVGLYKLRSH-KGTITGL-WCDSDNWLISTSKDGLIKVWDLK 190
           ED  I VWD+ +   L ++R H K  +  L +    + L+S   D  ++VWD+K
Sbjct: 628 EDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWDVK 681

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/149 (23%), Positives = 68/149 (45%), Gaps = 5/149 (3%)

Query: 385 GSRTDVRSIDISDDNALLATASNGE-LKIWNLNTKSCIRTF--ECGYALTCKFLPGGLLV 441
           G   DV ++    +   + T S+ +  ++W+++T   +R F             P G  +
Sbjct: 564 GHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDMSTGDSVRLFLGHTAPVTATAVSPDGRWL 623

Query: 442 VVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVK 501
             G+ +G + ++D+ +   L  +    + A++SL  + +G  LV+G AD S++ WD  VK
Sbjct: 624 STGSEDGIINVWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVWD--VK 681

Query: 502 QELIAGTSDKYVPQMNIVHDSTLELGDDI 530
           +      S+   P  +   D T  +  DI
Sbjct: 682 KSTAEPGSEPEQPFTSFSGDVTTSVNQDI 710

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 46/225 (20%), Positives = 99/225 (44%), Gaps = 23/225 (10%)

Query: 377 KAHTIELQGSRTDVRSIDISDDNALLATASNGE-LKIWNLNTKSCIRTFECGYALT---C 432
           +++   L G    V S   S DN  L +AS  + +++W+ +T + + +++ G+       
Sbjct: 472 RSNNATLVGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYK-GHNHPIWDV 530

Query: 433 KFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKS 492
            F P G      + +   +L+     +    I A H   + ++    +G  + TGS+DK+
Sbjct: 531 AFSPLGHYFATASHDQTARLWS-CDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKT 589

Query: 493 IKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVK 552
            + WD      +          ++ + H +       + +  +S D ++L+    D  + 
Sbjct: 590 CRMWDMSTGDSV----------RLFLGHTAP------VTATAVSPDGRWLSTGSEDGIIN 633

Query: 553 VFFLDSMKFFLSLYGH-KLPVLSLDISDDTKVIITSSADKNIKIW 596
           V+ + + K    + GH K  V SL  S +  V+++  AD ++++W
Sbjct: 634 VWDIGTGKRLKQMRGHGKNAVYSLSYSKEGHVLVSGGADHSLRVW 678

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 67/168 (39%), Gaps = 16/168 (9%)

Query: 78  AEVSYLQFHSETGLIAAGYADGVIKLWD---------LVSKTVLLSFN----GHKSRITM 124
           +E++ L+F  +  L +AG+ D ++K+W          L SK    S N    GH   +  
Sbjct: 428 SEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSKLPSKQDERSNNATLVGHSGTVYS 487

Query: 125 LKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGL 183
             F      L+S SED  + +W   +   L   + H   I  + +    ++  + S D  
Sbjct: 488 TAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHNHPIWDVAFSPLGHYFATASHDQT 547

Query: 184 IKVWDLKTQQCIETHIAHTGECWALGIMTD--FVVTSSADSQLKIWQM 229
            ++W       +     H  +   +    +  +V T S+D   ++W M
Sbjct: 548 ARLWSCDHIYPLRIFAGHLNDVDTVSFHPNGTYVFTGSSDKTCRMWDM 595

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 63/150 (42%), Gaps = 19/150 (12%)

Query: 100 VIKLWDLVSKT---VLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYK 156
            I+L +L S      + +F+   S +T L+F        +G +DS + +W L  E    K
Sbjct: 405 AIRLDNLQSSAPSVCMYTFHNTNSEMTSLEFSDDVRLASAGFQDSIVKIWSLDGEPLSSK 464

Query: 157 LRS-------------HKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHT 202
           L S             H GT+       DN +L+S S+D  +++W   T   + ++  H 
Sbjct: 465 LPSKQDERSNNATLVGHSGTVYSTAFSPDNRYLLSASEDKTVRLWSTDTYTSLVSYKGHN 524

Query: 203 GECW--ALGIMTDFVVTSSADSQLKIWQMD 230
              W  A   +  +  T+S D   ++W  D
Sbjct: 525 HPIWDVAFSPLGHYFATASHDQTARLWSCD 554

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 73.2 bits (178), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 95/228 (41%), Gaps = 19/228 (8%)

Query: 459 VLLTTIEAAHEGAIWSLDVT-NDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMN 517
           VL  T+E  H G + SL  +      L++GS DK++  W    + +        +    +
Sbjct: 24  VLRGTLEG-HNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSH 82

Query: 518 IVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDI 577
           IV D T           ++ D K+   +  D T++++ L S K      GHK  V+S+ I
Sbjct: 83  IVQDCT-----------VTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSI 131

Query: 578 SDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHN-----FFSASKD 632
                 I+++S DK +K+W    GDC  +L  H D +  V+  P   +       SA  D
Sbjct: 132 DPRATQIVSASRDKTVKVWNT-VGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMD 190

Query: 633 GFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIW 680
             VK WD   F        H + V  +  S +G    S   D  I +W
Sbjct: 191 KVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILW 238

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 59/125 (47%), Gaps = 10/125 (8%)

Query: 564 SLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGS 623
           S  GH   V    ++ D K  +++S DK +++W L  G C K    H+  +M V   P +
Sbjct: 76  SFKGHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRA 135

Query: 624 HNFFSASKDGFVKYWD--GDKFECIQKLAAHQSEVWALAV-----SDNGERVVSVSHDHS 676
               SAS+D  VK W+  GD   C+  L  H   V  + +     SD+   V+S   D  
Sbjct: 136 TQIVSASRDKTVKVWNTVGD---CVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKV 192

Query: 677 IRIWE 681
           +++W+
Sbjct: 193 VKVWD 197

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 91/203 (44%), Gaps = 23/203 (11%)

Query: 467 AHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLEL 526
            H   +    VT+DGK  ++ S DK+++ WD Q         S K + +  + H S    
Sbjct: 79  GHSHIVQDCTVTHDGKYALSASWDKTLRLWDLQ---------SGKCIKRF-VGHKS---- 124

Query: 527 GDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDI-----SDDT 581
             D++S+ I      +  +  D TVKV+        ++L GH   V ++ I     SDD 
Sbjct: 125 --DVMSVSIDPRATQIVSASRDKTVKVWNTVG-DCVVTLLGHNDWVSNVRIAPSEKSDDA 181

Query: 582 KVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGD 641
             +I++  DK +K+W L           H + +  V   P    F SA KDG +  W+ +
Sbjct: 182 VTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLN 241

Query: 642 KFECIQKLAAHQSEVWALAVSDN 664
           +   +  L A + EV+A+A S N
Sbjct: 242 EKTALYTLDA-KDEVFAVAFSPN 263

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 65/141 (46%), Gaps = 9/141 (6%)

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKL 157
           D  ++LWDL S   +  F GHKS +  +  D   TQ++S S D  + VW+ V +  +  L
Sbjct: 102 DKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGDC-VVTL 160

Query: 158 RSHKGTITGLW------CDSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGIM 211
             H   ++ +        D    +IS   D ++KVWDL++       I H      +   
Sbjct: 161 LGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQSFTIEADFIGHNNYVTTVTPS 220

Query: 212 TDFVVTSSA--DSQLKIWQMD 230
            D  + +SA  D Q+ +W ++
Sbjct: 221 PDGSIFASAGKDGQIILWNLN 241

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 56/106 (52%), Gaps = 2/106 (1%)

Query: 91  LIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVS 150
           +I+AG  D V+K+WDL S T+   F GH + +T +     G+   S  +D  II+W+L  
Sbjct: 184 VISAGM-DKVVKVWDLQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNE 242

Query: 151 EVGLYKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIE 196
           +  LY L +        +  +  WL + +  G IK++DL+ +  ++
Sbjct: 243 KTALYTLDAKDEVFAVAFSPNRYWLTAATASG-IKIFDLEERTIVD 287

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 59/130 (45%), Gaps = 6/130 (4%)

Query: 564 SLYGHKLPVLSLDISD-DTKVIITSSADKNIKIWGL-----DFGDCHKSLFAHQDSIMCV 617
           +L GH   V SL  S     ++++ S DK +  W L      +G   +S   H   +   
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDC 87

Query: 618 KFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSI 677
                     SAS D  ++ WD    +CI++   H+S+V ++++     ++VS S D ++
Sbjct: 88  TVTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASRDKTV 147

Query: 678 RIWEETDDQV 687
           ++W    D V
Sbjct: 148 KVWNTVGDCV 157

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 17/128 (13%)

Query: 114 SFNGHKSRITMLKFDKT-GTQLISGSEDSNIIVWDLVSEVGLY--KLRSHKG-------- 162
           +  GH   +T L         L+SGS D  +I W L  E   Y   +RS KG        
Sbjct: 28  TLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKGHSHIVQDC 87

Query: 163 TITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGI--MTDFVVTSSA 220
           T+T        + +S S D  +++WDL++ +CI+  + H  +  ++ I      +V++S 
Sbjct: 88  TVT----HDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSASR 143

Query: 221 DSQLKIWQ 228
           D  +K+W 
Sbjct: 144 DKTVKVWN 151

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 57/293 (19%), Positives = 112/293 (38%), Gaps = 63/293 (21%)

Query: 397 DDNALLATASNGELKIWNLNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLA 456
           D    L+ + +  L++W+L +  CI+ F                                
Sbjct: 92  DGKYALSASWDKTLRLWDLQSGKCIKRF-------------------------------- 119

Query: 457 SSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQM 516
                      H+  + S+ +     ++V+ S DK++K W+      +     + +V  +
Sbjct: 120 ---------VGHKSDVMSVSIDPRATQIVSASRDKTVKVWNTVGDCVVTLLGHNDWVSNV 170

Query: 517 NIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLD 576
            I   +  E  DD +++  +G         +D  VKV+ L S        GH   V ++ 
Sbjct: 171 RI---APSEKSDDAVTVISAG---------MDKVVKVWDLQSFTIEADFIGHNNYVTTVT 218

Query: 577 ISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVK 636
            S D  +  ++  D  I +W L+      +L A +D +  V F P  +   +A+  G +K
Sbjct: 219 PSPDGSIFASAGKDGQIILWNLNEKTALYTLDA-KDEVFAVAFSPNRYWLTAATASG-IK 276

Query: 637 YWDGDKFECIQKL--------AAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
            +D ++   +  L         A      +LA S +G+ + +   D+ IR+W+
Sbjct: 277 IFDLEERTIVDDLKPEFAGYNKAQDPHAVSLAWSADGQTLFAGYTDNIIRVWQ 329

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 61/133 (45%), Gaps = 14/133 (10%)

Query: 376 IKAHTIELQ--GSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFEC-GYALT 431
           +++ TIE    G    V ++  S D ++ A+A  +G++ +WNLN K+ + T +       
Sbjct: 198 LQSFTIEADFIGHNNYVTTVTPSPDGSIFASAGKDGQIILWNLNEKTALYTLDAKDEVFA 257

Query: 432 CKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEG--------AIWSLDVTNDGKR 483
             F P    +   T  G +++FDL    ++  ++    G        A+ SL  + DG+ 
Sbjct: 258 VAFSPNRYWLTAATASG-IKIFDLEERTIVDDLKPEFAGYNKAQDPHAV-SLAWSADGQT 315

Query: 484 LVTGSADKSIKFW 496
           L  G  D  I+ W
Sbjct: 316 LFAGYTDNIIRVW 328

>KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score = 72.8 bits (177), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 118/252 (46%), Gaps = 17/252 (6%)

Query: 371 TSPTPIKAHTIELQGSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFECGYA 429
           T+P P+ +     +G + +V S+    DN  + ++S +G +K+W++ + S  R ++    
Sbjct: 63  TNPNPVAS----FEGHKGNVTSLSFQQDNKWMVSSSEDGTIKVWDVRSPSIPRNYKHNAP 118

Query: 430 LTCKFL-PGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGS 488
           +    + P    ++   R+GN++++DL  +     +    +  + S+ V +DG  LV  +
Sbjct: 119 VNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDIPLQSISVASDGSMLVAAN 178

Query: 489 ADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLD 548
              +   W+     +    ++ K V +    H+      D I  I +S D K LA    D
Sbjct: 179 TKGNCFVWEMPNHTD---ASNLKPVTKFK-AHN------DYITRILLSSDVKHLATCSAD 228

Query: 549 NTVKVFFLDS-MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSL 607
           +T +V+ +D+  K   +L GH+  V     S D+  ++T+S+D  +++W L   +  +  
Sbjct: 229 HTTRVWSIDNNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREVVRQY 288

Query: 608 FAHQDSIMCVKF 619
             H   ++CV  
Sbjct: 289 GGHHKGVVCVAL 300

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 60/292 (20%), Positives = 121/292 (41%), Gaps = 28/292 (9%)

Query: 383 LQGSRTDVRSIDISDDNALLATASNGELKIWNLNT--KSCIRTFEC--GYALTCKFLPGG 438
           +Q S + V  ++I++D  LLA A +  ++++++ T   + + +FE   G   +  F    
Sbjct: 28  IQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDIRTTNPNPVASFEGHKGNVTSLSFQQDN 87

Query: 439 LLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDF 498
             +V  + +G ++++D+ S  +    +  H   +  + +  +   L++   D +I+ WD 
Sbjct: 88  KWMVSSSEDGTIKVWDVRSPSIPRNYK--HNAPVNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFL-- 556
              Q                 H  T E    + SI ++ D   L  +       V+ +  
Sbjct: 146 GENQ---------------CTHQLTPEDDIPLQSISVASDGSMLVAANTKGNCFVWEMPN 190

Query: 557 ----DSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFG-DCHKSLFAHQ 611
                ++K       H   +  + +S D K + T SAD   ++W +D       +L  HQ
Sbjct: 191 HTDASNLKPVTKFKAHNDYITRILLSSDVKHLATCSADHTTRVWSIDNNFKLESTLDGHQ 250

Query: 612 DSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSD 663
             +    F   S    +AS D +V+ WD    E +++   H   V  +A++D
Sbjct: 251 RWVWDCAFSADSAYLVTASSDHYVRLWDLSTREVVRQYGGHHKGVVCVALND 302

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 62/120 (51%), Gaps = 5/120 (4%)

Query: 78  AEVSYLQFHSETGLIAAGYADGVIKLWDL--VSKTVLLSFNGHKSRITMLKFDKTGTQLI 135
           ++V+ L+  ++  L+AA     V +L+D+   +   + SF GHK  +T L F +    ++
Sbjct: 33  SQVNRLEITNDKKLLAAAGHQNV-RLYDIRTTNPNPVASFEGHKGNVTSLSFQQDNKWMV 91

Query: 136 SGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDNW-LISTSKDGLIKVWDLKTQQC 194
           S SED  I VWD+ S   + +   H   +  +    +   LIS  +DG I++WDL   QC
Sbjct: 92  SSSEDGTIKVWDVRSP-SIPRNYKHNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQC 150

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/299 (21%), Positives = 123/299 (41%), Gaps = 31/299 (10%)

Query: 401 LLATASNGELKIWNLNTKSCIRTFECGYALTCKF-LPGGLLVVVGTREGNLQLFDLASSV 459
           L++   +  ++ W   T  C RT +   +   +  +     ++      N++L+D+ ++ 
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDIRTTN 64

Query: 460 L--LTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMN 517
              + + E  H+G + SL    D K +V+ S D +IK WD  V+   I        P   
Sbjct: 65  PNPVASFEG-HKGNVTSLSFQQDNKWMVSSSEDGTIKVWD--VRSPSIPRNYKHNAPVNE 121

Query: 518 IV-HDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHK-LPVLSL 575
           +V H +  EL        IS D         D  ++++ L   +    L     +P+ S+
Sbjct: 122 VVIHPNQGEL--------ISCD--------RDGNIRIWDLGENQCTHQLTPEDDIPLQSI 165

Query: 576 DISDDTKVIITSSADKNIKIWGL-DFGDCHK-----SLFAHQDSIMCVKFLPGSHNFFSA 629
            ++ D  +++ ++   N  +W + +  D           AH D I  +       +  + 
Sbjct: 166 SVASDGSMLVAANTKGNCFVWEMPNHTDASNLKPVTKFKAHNDYITRILLSSDVKHLATC 225

Query: 630 SKDGFVKYWDGDK-FECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEETDDQV 687
           S D   + W  D  F+    L  HQ  VW  A S +   +V+ S DH +R+W+ +  +V
Sbjct: 226 SADHTTRVWSIDNNFKLESTLDGHQRWVWDCAFSADSAYLVTASSDHYVRLWDLSTREV 284

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 82/196 (41%), Gaps = 21/196 (10%)

Query: 45  ENISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLW 104
           +N+ ++D++T+           P  V         V+ L F  +   + +   DG IK+W
Sbjct: 53  QNVRLYDIRTTN----------PNPVASFEGHKGNVTSLSFQQDNKWMVSSSEDGTIKVW 102

Query: 105 DLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKG-T 163
           D+ S ++  ++  H + +  +       +LIS   D NI +WDL      ++L       
Sbjct: 103 DVRSPSIPRNYK-HNAPVNEVVIHPNQGELISCDRDGNIRIWDLGENQCTHQLTPEDDIP 161

Query: 164 ITGLWCDSD-NWLISTSKDGLIKVWDLKTQ------QCIETHIAHTGECWALGIMTD--F 214
           +  +   SD + L++ +  G   VW++         + +    AH      + + +D   
Sbjct: 162 LQSISVASDGSMLVAANTKGNCFVWEMPNHTDASNLKPVTKFKAHNDYITRILLSSDVKH 221

Query: 215 VVTSSADSQLKIWQMD 230
           + T SAD   ++W +D
Sbjct: 222 LATCSADHTTRVWSID 237

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/194 (21%), Positives = 79/194 (40%), Gaps = 24/194 (12%)

Query: 47  ISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDL 106
           I VWD+++           P    + K + P  V+ +  H   G + +   DG I++WDL
Sbjct: 99  IKVWDVRS-----------PSIPRNYKHNAP--VNEVVIHPNQGELISCDRDGNIRIWDL 145

Query: 107 VSKTVLLSFNGHKS-RITMLKFDKTGTQLISGSEDSNIIVWDLVSEVG------LYKLRS 159
                           +  +     G+ L++ +   N  VW++ +         + K ++
Sbjct: 146 GENQCTHQLTPEDDIPLQSISVASDGSMLVAANTKGNCFVWEMPNHTDASNLKPVTKFKA 205

Query: 160 HKGTITGLWCDSD-NWLISTSKDGLIKVWDLKTQQCIETHI-AHTGECWALGIMTD--FV 215
           H   IT +   SD   L + S D   +VW +     +E+ +  H    W      D  ++
Sbjct: 206 HNDYITRILLSSDVKHLATCSADHTTRVWSIDNNFKLESTLDGHQRWVWDCAFSADSAYL 265

Query: 216 VTSSADSQLKIWQM 229
           VT+S+D  +++W +
Sbjct: 266 VTASSDHYVRLWDL 279

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/142 (22%), Positives = 55/142 (38%), Gaps = 47/142 (33%)

Query: 134 LISGSEDSNIIVWDLVS--------------------------------EVGLYKLRS-- 159
           L+S   D  I  W+ ++                                 V LY +R+  
Sbjct: 5   LVSAGYDHTIRFWEALTGVCSRTIQHSDSQVNRLEITNDKKLLAAAGHQNVRLYDIRTTN 64

Query: 160 ---------HKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALG 209
                    HKG +T L    DN W++S+S+DG IKVWD+++   I  +  H      + 
Sbjct: 65  PNPVASFEGHKGNVTSLSFQQDNKWMVSSSEDGTIKVWDVRSPS-IPRNYKHNAPVNEVV 123

Query: 210 IMTDF--VVTSSADSQLKIWQM 229
           I  +   +++   D  ++IW +
Sbjct: 124 IHPNQGELISCDRDGNIRIWDL 145

>Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON}
           (10035..10568,10902..11324) [957 nt, 319 aa]
          Length = 318

 Score = 72.8 bits (177), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 57/230 (24%), Positives = 100/230 (43%), Gaps = 22/230 (9%)

Query: 459 VLLTTIEAAHEGAIWSLDVTNDGKR--LVTGSADKSIKFWDFQVKQELIAGTSDKYVPQM 516
           VL  T+E  H G + SL  T+ G+   L++ S DK++  W      +        +    
Sbjct: 7   VLRGTLEG-HNGWVTSL-ATSAGQPNLLLSASRDKTLISWKLTGNDQQYGVPVRSFKGHS 64

Query: 517 NIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLD 576
           +IV D  L           + D  +   +  D T++++ + + + +    GHK  V+S+ 
Sbjct: 65  HIVQDCAL-----------TADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVA 113

Query: 577 ISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSH------NFFSAS 630
           I     +II+ S DK IK+W +  GDC  ++  H D +  V+  P  +         SA 
Sbjct: 114 IDRKASMIISGSRDKTIKVWTIK-GDCLATMLGHNDWVSQVRVAPNENEDDETVRLISAG 172

Query: 631 KDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIW 680
            D  VK W+ ++F+       H + +  +  S +G  + S   D  I +W
Sbjct: 173 MDKMVKAWNVNQFQIEADFVGHNNYINTITASPDGTLIASAGKDGDIMLW 222

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 55/106 (51%), Gaps = 2/106 (1%)

Query: 91  LIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVS 150
           LI+AG  D ++K W++    +   F GH + I  +     GT + S  +D +I++W+L  
Sbjct: 168 LISAGM-DKMVKAWNVNQFQIEADFVGHNNYINTITASPDGTLIASAGKDGDIMLWNLKE 226

Query: 151 EVGLYKLRSHKGTITGLWCDSDNWLISTSKDGLIKVWDLKTQQCIE 196
           +  LY L +        +  +  WL + +  G IKV+DL+ ++ I+
Sbjct: 227 KSPLYTLNAQDEVFALAFSPNRYWLTAATSSG-IKVFDLEEKKLID 271

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 60/141 (42%), Gaps = 10/141 (7%)

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKL 157
           D  ++LW++ +      F GHKS +  +  D+  + +ISGS D  I VW +  +  L  +
Sbjct: 85  DKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKASMIISGSRDKTIKVWTIKGDC-LATM 143

Query: 158 RSHKGTITGLWC-------DSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGI 210
             H   ++ +         D    LIS   D ++K W++   Q     + H      +  
Sbjct: 144 LGHNDWVSQVRVAPNENEDDETVRLISAGMDKMVKAWNVNQFQIEADFVGHNNYINTITA 203

Query: 211 MTDFVVTSSA--DSQLKIWQM 229
             D  + +SA  D  + +W +
Sbjct: 204 SPDGTLIASAGKDGDIMLWNL 224

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 56/130 (43%), Gaps = 7/130 (5%)

Query: 564 SLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGS 623
           S  GH   V    ++ D    +++S DK +++W +  G+ ++    H+  +M V     +
Sbjct: 59  SFKGHSHIVQDCALTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKA 118

Query: 624 HNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGE------RVVSVSHDHSI 677
               S S+D  +K W   K +C+  +  H   V  + V+ N        R++S   D  +
Sbjct: 119 SMIISGSRDKTIKVWT-IKGDCLATMLGHNDWVSQVRVAPNENEDDETVRLISAGMDKMV 177

Query: 678 RIWEETDDQV 687
           + W     Q+
Sbjct: 178 KAWNVNQFQI 187

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 54/122 (44%), Gaps = 12/122 (9%)

Query: 385 GSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSCIRTFEC-GYALTCKFLPGGLLVV 442
           G    + +I  S D  L+A+A  +G++ +WNL  KS + T           F P    + 
Sbjct: 193 GHNNYINTITASPDGTLIASAGKDGDIMLWNLKEKSPLYTLNAQDEVFALAFSPNRYWLT 252

Query: 443 VGTREGNLQLFDLASSVLLTTIE--------AAHEGAIWSLDVTNDGKRLVTGSADKSIK 494
             T  G +++FDL    L+  ++        AA   A+ SL  + DG+ L  G  D  I+
Sbjct: 253 AATSSG-IKVFDLEEKKLIDELKPEFTGFNKAADPHAV-SLAWSADGQTLFAGYTDNVIR 310

Query: 495 FW 496
            W
Sbjct: 311 VW 312

 Score = 38.5 bits (88), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%), Gaps = 2/89 (2%)

Query: 114 SFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSD- 172
           SF GH   +        G   +S S D  + +W++ +     +   HK  +  +  D   
Sbjct: 59  SFKGHSHIVQDCALTADGAYALSASWDKTLRLWNVATGETYQRFTGHKSDVMSVAIDRKA 118

Query: 173 NWLISTSKDGLIKVWDLKTQQCIETHIAH 201
           + +IS S+D  IKVW +K   C+ T + H
Sbjct: 119 SMIISGSRDKTIKVWTIK-GDCLATMLGH 146

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 94/227 (41%), Gaps = 17/227 (7%)

Query: 472 IWSLDVTNDGKRLVTGSADKSIKFWDFQVKQ-ELIAGTSDKYVPQMNI------------ 518
           + SLD ++D +    G  D  IK W       + +  T++ +  + N             
Sbjct: 491 MLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTSTNNTHFTKKNTADNNLHSKKKHQ 550

Query: 519 --VHDSTLELGDD--ILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLS 574
             V+ +T  +G    + S   S D+K L     D TV+++ +D+    +S  GH  PV  
Sbjct: 551 EHVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWD 610

Query: 575 LDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGF 634
           +  S       T+S D+  ++W  D     +    H   + CV F P     F+ S D  
Sbjct: 611 VAFSPMGHYFATASHDQTARLWSCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKT 670

Query: 635 VKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
            + WD    E ++    H + V +L VS +G  + S S D  I +W+
Sbjct: 671 CRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASGSEDGLINVWD 717

 Score = 74.7 bits (182), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 66/303 (21%), Positives = 125/303 (41%), Gaps = 30/303 (9%)

Query: 383 LQGSRTDVRSIDISDDNALLATA-SNGELKIWNLNTKSC-IRTFECGYALTCKFLPGGLL 440
              +  ++ S+D SDD  L A    +  +KIW+L+  S    T       T K       
Sbjct: 484 FHNTNREMLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTSTNNTHFTKK------- 536

Query: 441 VVVGTREGNLQLFDLASSVLLTTIE-AAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQ 499
               T + NL         + T  +   H GA++S   + D K L++GS DK+++ W   
Sbjct: 537 ---NTADNNLHSKKKHQEHVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMD 593

Query: 500 VKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSM 559
            +  L++     Y    + V D           +  S    + A +  D T +++  D +
Sbjct: 594 TQSTLVS-----YKGHNHPVWD-----------VAFSPMGHYFATASHDQTARLWSCDHI 637

Query: 560 KFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKF 619
                  GH   V  +    +   + T S+DK  ++W +  G+  +    H   ++ +  
Sbjct: 638 YSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGV 697

Query: 620 LPGSHNFFSASKDGFVKYWDGDKFECIQKLAAH-QSEVWALAVSDNGERVVSVSHDHSIR 678
            P      S S+DG +  WD    + ++++  H ++ V ++  S  G  ++S   D+S+R
Sbjct: 698 SPDGRWLASGSEDGLINVWDIGSGKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVR 757

Query: 679 IWE 681
           +W+
Sbjct: 758 VWD 760

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/151 (22%), Positives = 71/151 (47%), Gaps = 9/151 (5%)

Query: 85  FHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNII 144
           F  +  L+ +G  D  ++LW + +++ L+S+ GH   +  + F   G    + S D    
Sbjct: 571 FSPDNKLLISGSEDKTVRLWAMDTQSTLVSYKGHNHPVWDVAFSPMGHYFATASHDQTAR 630

Query: 145 VWDLVSEVGLYKLRSHKGTITGLWC----DSDNWLISTSKDGLIKVWDLKTQQCIETHIA 200
           +W   S   +Y LR   G ++ + C     +  ++ + S D   ++WD+ T + +   + 
Sbjct: 631 LW---SCDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLG 687

Query: 201 HTGECWALGIMTD--FVVTSSADSQLKIWQM 229
           HT    +LG+  D  ++ + S D  + +W +
Sbjct: 688 HTAPVVSLGVSPDGRWLASGSEDGLINVWDI 718

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 53/114 (46%), Gaps = 2/114 (1%)

Query: 78  AEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISG 137
           ++V  + FH     +  G +D   ++WD+ +   +  F GH + +  L     G  L SG
Sbjct: 648 SDVDCVTFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWLASG 707

Query: 138 SEDSNIIVWDLVSEVGLYKLRSHKGTITG--LWCDSDNWLISTSKDGLIKVWDL 189
           SED  I VWD+ S   L ++R H        ++      +IS   D  ++VWD+
Sbjct: 708 SEDGLINVWDIGSGKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/222 (22%), Positives = 100/222 (45%), Gaps = 23/222 (10%)

Query: 382 ELQGSRTDVRSIDISDDNALLATASNGE-LKIWNLNTKSCIRTFECGYALTC---KFLPG 437
           +L G    V S   S DN LL + S  + +++W ++T+S + +++ G+        F P 
Sbjct: 558 KLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVSYK-GHNHPVWDVAFSPM 616

Query: 438 GLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWD 497
           G      + +   +L+     +    I A H   +  +    +G  + TGS+DK+ + WD
Sbjct: 617 GHYFATASHDQTARLWS-CDHIYSLRIFAGHLSDVDCVTFHPNGCYVFTGSSDKTCRMWD 675

Query: 498 FQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLD 557
               + +          ++ + H +       ++S+ +S D ++LA    D  + V+ + 
Sbjct: 676 VSTGETV----------RLFLGHTAP------VVSLGVSPDGRWLASGSEDGLINVWDIG 719

Query: 558 SMKFFLSLYGH-KLPVLSLDISDDTKVIITSSADKNIKIWGL 598
           S K    + GH +  V S+  S +  VII+   D ++++W +
Sbjct: 720 SGKRLKQMRGHGRNAVNSIVFSQEGTVIISGGTDNSVRVWDM 761

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 65/155 (41%), Gaps = 12/155 (7%)

Query: 79  EVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGS 138
           E+  L F  +  L AAG+ D  IK+W L   ++    + + +  T  K +     L S  
Sbjct: 490 EMLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTSTNNTHFT--KKNTADNNLHSKK 547

Query: 139 EDSNIIVWDLVSEVGLYKLRSHKGTITGLWCDSDN-WLISTSKDGLIKVWDLKTQQCIET 197
           +    +  +        KL  H G +       DN  LIS S+D  +++W + TQ  + +
Sbjct: 548 KHQEHVNTNT-------KLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTLVS 600

Query: 198 HIAHTGECW--ALGIMTDFVVTSSADSQLKIWQMD 230
           +  H    W  A   M  +  T+S D   ++W  D
Sbjct: 601 YKGHNHPVWDVAFSPMGHYFATASHDQTARLWSCD 635

>NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25
          Length = 510

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 105/211 (49%), Gaps = 24/211 (11%)

Query: 433 KFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKS 492
           K+ P G  +VV T  G   L++  +S    ++  AH+ ++ +++ ++DG  +++G +D  
Sbjct: 86  KWTPEGRRLVVATYNGEFSLWN-GTSFNFESLMQAHDSSVTTMEYSHDGDWMISGDSDGI 144

Query: 493 IKFW--DFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDD-KFLAISLLDN 549
           IK W  +F + +EL                D+  E    I  +  SG+D KF++ S  DN
Sbjct: 145 IKIWQANFNMVKEL---------------DDAHTEC---IRDVAFSGNDSKFVSCSD-DN 185

Query: 550 TVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGLDFGDCHKSLFA 609
            +K++   + K    L GH   V S D   +  +II++S D  IK+W    G+C  ++  
Sbjct: 186 ILKIWNFSNGKLERVLSGHHWDVKSCDWHPEMGLIISASKDNLIKLWDPRSGNCVSTILK 245

Query: 610 HQDSIMCVKFLPGSHNFFSA-SKDGFVKYWD 639
            + +++ VKF P   N  +A SKD   + +D
Sbjct: 246 FKHTVLKVKFQPTGGNMIAAISKDKSCRVFD 276

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 90/199 (45%), Gaps = 21/199 (10%)

Query: 38  KVITGALENI-SVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGY 96
           K ++ + +NI  +W+    +LE VLS        D+KS          +H E GLI +  
Sbjct: 177 KFVSCSDDNILKIWNFSNGKLERVLSGH----HWDVKS--------CDWHPEMGLIISAS 224

Query: 97  ADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISG-SEDSNIIVWDLVSEVG-L 154
            D +IKLWD  S   + +    K  +  +KF  TG  +I+  S+D +  V+D+   +  L
Sbjct: 225 KDNLIKLWDPRSGNCVSTILKFKHTVLKVKFQPTGGNMIAAISKDKSCRVFDIRHSMKEL 284

Query: 155 YKLRSHKGTITGLWCDSDNWLISTSK-DGLIKVWDLKTQQCIETHI---AHTGECWALGI 210
             +R     +T LW   +  + +    DG IK +DL       TH+   AH     +L  
Sbjct: 285 LCVRDEVDYMTLLWNPINESMFTVGNYDGSIKHFDLLQDLTKPTHVIPYAHDKCVTSLSY 344

Query: 211 --MTDFVVTSSADSQLKIW 227
             M + + ++S D  ++ W
Sbjct: 345 NPMGNILASASKDRTVRFW 363

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 67/147 (45%), Gaps = 1/147 (0%)

Query: 52  LKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTV 111
           + T   E+ L +G       L  +  + V+ +++  +   + +G +DG+IK+W      V
Sbjct: 96  VATYNGEFSLWNGTSFNFESLMQAHDSSVTTMEYSHDGDWMISGDSDGIIKIWQANFNMV 155

Query: 112 LLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WCD 170
               + H   I  + F    ++ +S S+D+ + +W+  +      L  H   +    W  
Sbjct: 156 KELDDAHTECIRDVAFSGNDSKFVSCSDDNILKIWNFSNGKLERVLSGHHWDVKSCDWHP 215

Query: 171 SDNWLISTSKDGLIKVWDLKTQQCIET 197
               +IS SKD LIK+WD ++  C+ T
Sbjct: 216 EMGLIISASKDNLIKLWDPRSGNCVST 242

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 73/165 (44%)

Query: 518 IVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDI 577
             H S+ ++   I +IK + + + L ++  +    ++   S  F   +  H   V +++ 
Sbjct: 70  FTHLSSNKVKHVIPAIKWTPEGRRLVVATYNGEFSLWNGTSFNFESLMQAHDSSVTTMEY 129

Query: 578 SDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKY 637
           S D   +I+  +D  IKIW  +F    +   AH + I  V F      F S S D  +K 
Sbjct: 130 SHDGDWMISGDSDGIIKIWQANFNMVKELDDAHTECIRDVAFSGNDSKFVSCSDDNILKI 189

Query: 638 WDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEE 682
           W+    +  + L+ H  +V +         ++S S D+ I++W+ 
Sbjct: 190 WNFSNGKLERVLSGHHWDVKSCDWHPEMGLIISASKDNLIKLWDP 234

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 46/206 (22%), Positives = 91/206 (44%), Gaps = 26/206 (12%)

Query: 91  LIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVW---- 146
           L+ A Y +G   LW+  S         H S +T +++   G  +ISG  D  I +W    
Sbjct: 94  LVVATY-NGEFSLWNGTSFNFESLMQAHDSSVTTMEYSHDGDWMISGDSDGIIKIWQANF 152

Query: 147 DLVSEVGLYKLRSHKGTITGL-WCDSDNWLISTSKDGLIKVWDL---KTQQCIETHIAHT 202
           ++V E+      +H   I  + +  +D+  +S S D ++K+W+    K ++ +  H    
Sbjct: 153 NMVKELD----DAHTECIRDVAFSGNDSKFVSCSDDNILKIWNFSNGKLERVLSGHHWDV 208

Query: 203 GEC-WALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLIEKGAFEKQSKQRGLSIEFTTT 261
             C W   +    ++++S D+ +K+W     G   S ++       + K   L ++F  T
Sbjct: 209 KSCDWHPEM--GLIISASKDNLIKLWD-PRSGNCVSTIL-------KFKHTVLKVKFQPT 258

Query: 262 SDGVHFFYVQNADKTVEIFRLRKDIE 287
             G +     + DK+  +F +R  ++
Sbjct: 259 --GGNMIAAISKDKSCRVFDIRHSMK 282

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 63/164 (38%), Gaps = 51/164 (31%)

Query: 383 LQGSRTDVRSIDISDDNALLATASNGEL-KIWNLNTKSCIRT---FECGYALTCKFLPGG 438
           L G   DV+S D   +  L+ +AS   L K+W+  + +C+ T   F+    L  KF P G
Sbjct: 201 LSGHHWDVKSCDWHPEMGLIISASKDNLIKLWDPRSGNCVSTILKFK-HTVLKVKFQPTG 259

Query: 439 ------------------------LLVV--------------------VGTREGNLQLFD 454
                                   LL V                    VG  +G+++ FD
Sbjct: 260 GNMIAAISKDKSCRVFDIRHSMKELLCVRDEVDYMTLLWNPINESMFTVGNYDGSIKHFD 319

Query: 455 LASSVLLTT--IEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFW 496
           L   +   T  I  AH+  + SL     G  L + S D++++FW
Sbjct: 320 LLQDLTKPTHVIPYAHDKCVTSLSYNPMGNILASASKDRTVRFW 363

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%)

Query: 614 IMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSH 673
           I  +K+ P       A+ +G    W+G  F     + AH S V  +  S +G+ ++S   
Sbjct: 82  IPAIKWTPEGRRLVVATYNGEFSLWNGTSFNFESLMQAHDSSVTTMEYSHDGDWMISGDS 141

Query: 674 DHSIRIWEETDDQV 687
           D  I+IW+   + V
Sbjct: 142 DGIIKIWQANFNMV 155

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 59/273 (21%), Positives = 117/273 (42%), Gaps = 38/273 (13%)

Query: 401 LLATASNGELKIWN---LNTKSCIRTFECGYALTCKFLPGGLLVVVGTREGNLQLFDLAS 457
           L+    NGE  +WN    N +S ++  +     T ++   G  ++ G  +G ++++  A+
Sbjct: 94  LVVATYNGEFSLWNGTSFNFESLMQAHDSS-VTTMEYSHDGDWMISGDSDGIIKIWQ-AN 151

Query: 458 SVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVK--QELIAG-----TSD 510
             ++  ++ AH   I  +  + +  + V+ S D  +K W+F     + +++G      S 
Sbjct: 152 FNMVKELDDAHTECIRDVAFSGNDSKFVSCSDDNILKIWNFSNGKLERVLSGHHWDVKSC 211

Query: 511 KYVPQMNIV----HDSTLELGDD---------------ILSIKI--SGDDKFLAISLLDN 549
            + P+M ++     D+ ++L D                +L +K   +G +   AIS  D 
Sbjct: 212 DWHPEMGLIISASKDNLIKLWDPRSGNCVSTILKFKHTVLKVKFQPTGGNMIAAISK-DK 270

Query: 550 TVKVF-FLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGL--DFG-DCHK 605
           + +VF    SMK  L +      +  L    +  +    + D +IK + L  D     H 
Sbjct: 271 SCRVFDIRHSMKELLCVRDEVDYMTLLWNPINESMFTVGNYDGSIKHFDLLQDLTKPTHV 330

Query: 606 SLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYW 638
             +AH   +  + + P  +   SASKD  V++W
Sbjct: 331 IPYAHDKCVTSLSYNPMGNILASASKDRTVRFW 363

>KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.239
           YGL137W
          Length = 911

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 127/291 (43%), Gaps = 26/291 (8%)

Query: 386 SRTD-VRSIDISDDNA-LLATASNGELKIWNLNTKSCIRTFECGYA--LTCKFLPGGLLV 441
           +R+D V+ ID       +L T  +G+++IWN  T+  +R+           +F+     +
Sbjct: 11  NRSDRVKGIDFHPSEPWVLTTLYSGKIEIWNYETQQEVRSIHVTETPVRAGRFIARKNWI 70

Query: 442 VVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVK 501
           VVG+ +  L++F+  +   ++  EA H   I S+ V      ++TGS D ++K W+++  
Sbjct: 71  VVGSDDFRLRIFNYNTGEKISDFEA-HPDYIRSIAVHPTKPYVITGSDDLTVKLWNWE-- 127

Query: 502 QELIAGTSDKYVPQMNIVHDSTLELGDD-ILSIKISG-DDKFLAISLLDNTVKVFFL-DS 558
                          N   + T E  D  ++S+  +  D    A   LD TVKV+ L  S
Sbjct: 128 --------------KNWALEQTFEGHDHFVMSVAFNPKDPNTFASGCLDRTVKVWSLGQS 173

Query: 559 MKFFLSLYGHKLPVLSLDISD--DTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMC 616
              F  + G +  V  +D     D   ++T+S D  +KIW      C  +L  H  ++  
Sbjct: 174 QPNFTLVTGQEKGVNYVDYYPLPDKPYLLTASDDMTVKIWDYQTKSCVATLEGHMANVSF 233

Query: 617 VKFLPGSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDNGER 667
             F P      S S+DG VK W+   ++  + L       W +A    G++
Sbjct: 234 AIFHPTLPIIISGSEDGTVKIWNSSTYKIEKTLNLGLERSWCIASHPTGKK 284

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 65/163 (39%), Gaps = 10/163 (6%)

Query: 75  SKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTVL-LSFNGHKSRITMLKFD-KTGT 132
           + P  +  +  H     +  G  D  +KLW+      L  +F GH   +  + F+ K   
Sbjct: 95  AHPDYIRSIAVHPTKPYVITGSDDLTVKLWNWEKNWALEQTFEGHDHFVMSVAFNPKDPN 154

Query: 133 QLISGSEDSNIIVWDLVSEVGLYKLRS--HKGT--ITGLWCDSDNWLISTSKDGLIKVWD 188
              SG  D  + VW L      + L +   KG   +         +L++ S D  +K+WD
Sbjct: 155 TFASGCLDRTVKVWSLGQSQPNFTLVTGQEKGVNYVDYYPLPDKPYLLTASDDMTVKIWD 214

Query: 189 LKTQQCIETHIAHTGECWALGIM---TDFVVTSSADSQLKIWQ 228
            +T+ C+ T   H     +  I       +++ S D  +KIW 
Sbjct: 215 YQTKSCVATLEGHMANV-SFAIFHPTLPIIISGSEDGTVKIWN 256

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 51/110 (46%), Gaps = 14/110 (12%)

Query: 41  TGALEN-ISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHS--ETGLIAAGYA 97
           +G L+  + VW L  S+  + L  G   G           V+Y+ ++   +   +     
Sbjct: 158 SGCLDRTVKVWSLGQSQPNFTLVTGQEKG-----------VNYVDYYPLPDKPYLLTASD 206

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWD 147
           D  +K+WD  +K+ + +  GH + ++   F  T   +ISGSED  + +W+
Sbjct: 207 DMTVKIWDYQTKSCVATLEGHMANVSFAIFHPTLPIIISGSEDGTVKIWN 256

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 61/146 (41%), Gaps = 21/146 (14%)

Query: 92  IAAGYADGVIKLWDL-VSKTVLLSFNGHKSRITMLKF----DKTGTQLISGSEDSNIIVW 146
            A+G  D  +K+W L  S+       G +  +  + +    DK    L++ S+D  + +W
Sbjct: 156 FASGCLDRTVKVWSLGQSQPNFTLVTGQEKGVNYVDYYPLPDKP--YLLTASDDMTVKIW 213

Query: 147 DLVSEVGLYKLRSHKGTIT-GLWCDSDNWLISTSKDGLIKVWDLKTQQ------------ 193
           D  ++  +  L  H   ++  ++  +   +IS S+DG +K+W+  T +            
Sbjct: 214 DYQTKSCVATLEGHMANVSFAIFHPTLPIIISGSEDGTVKIWNSSTYKIEKTLNLGLERS 273

Query: 194 -CIETHIAHTGECWALGIMTDFVVTS 218
            CI +H        A G    F V S
Sbjct: 274 WCIASHPTGKKNYIAAGFDNGFTVLS 299

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 89/444 (20%), Positives = 170/444 (38%), Gaps = 105/444 (23%)

Query: 80  VSYLQFHSETGLIAAGYADGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQLISGSE 139
            S    H+ + ++  G  D   ++WD  ++T + +  GH + +  + +   G  + +GS 
Sbjct: 145 CSAFAPHTSSRMVT-GAGDNTARIWDCDTQTPMATLTGHHNWVLCVSWSPDGELIATGSM 203

Query: 140 DSNIIVWDLVSEVGLY---KLRSHKGTITGLWCDSDNW-------------LISTSKDGL 183
           D+ + +W+  S+ G      LR H     G W  S +W             L ++SKDG 
Sbjct: 204 DNTVRLWE--SKTGKPFGDALRGH-----GKWITSLSWEPIHLVTPGERPRLATSSKDGT 256

Query: 184 IKVWDLKTQQCIETHIAHTG--ECWALGIMTDFVVTSSADSQLKIWQMDLEGEPGSKLIE 241
           IK+WD   + C  T   HT    C   G   +F+ + S D  +++W M   G   + L  
Sbjct: 257 IKIWDTTRRVCTMTLSGHTSSVSCVKWGGQ-NFLYSGSHDKTVRVWDMKNSGRCINILKN 315

Query: 242 KGAFEKQSKQRGLSIEFTTTSDGVHFFYVQNADKTVEIFRLRKDIEIAKAIKRREKRLTE 301
              +        LS+          F Y      T EI +       AKA+K  EK + +
Sbjct: 316 HAHWVNH-----LSLSTDYALRVGPFDYTGEQPATPEIAK-------AKALKNYEK-VAK 362

Query: 302 KGMTEEDIKTNISESYVSFVMHPFQVVRSMYKIKSVAWTLSLSTKLEVVVTTNSNTIEYY 361
           +   E ++    S+ +  F+  P +  + + +                            
Sbjct: 363 RNGKETELMVTASDDFTMFLWDPLRTTKPIAR---------------------------- 394

Query: 362 SVPYEKRDPTSPTPIKAHTIELQGSRTDVRSIDISDDNALLATAS-NGELKIWNLNTKSC 420
                                + G +  V  +  S D   + +AS +  +K+W+      
Sbjct: 395 ---------------------MTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWDSRDGKF 433

Query: 421 IRTF--------ECGYALTCKFLPGGLLVVVGTREGNLQLFDLASSVLLTTIEAAHEGAI 472
           I TF        +  ++  C+ L      V  +++  L+++D+ +  L   +   H+  +
Sbjct: 434 ITTFRGHVASVYQVAWSSDCRLL------VSCSKDTTLKVWDIRTRKLSVDL-PGHKDEV 486

Query: 473 WSLDVTNDGKRLVTGSADKSIKFW 496
           +++D + DGKR+ +G  DK ++ W
Sbjct: 487 YTVDWSVDGKRVCSGGKDKMVRIW 510

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 82/190 (43%), Gaps = 28/190 (14%)

Query: 483 RLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFL 542
           R+VTG+ D + + WD   +  +   T                   + +L +  S D + +
Sbjct: 155 RMVTGAGDNTARIWDCDTQTPMATLTGHH----------------NWVLCVSWSPDGELI 198

Query: 543 AISLLDNTVKVFFLDSMKFFL-SLYGHKLPVLSLD-------ISDDTKVIITSSADKNIK 594
           A   +DNTV+++   + K F  +L GH   + SL           +   + TSS D  IK
Sbjct: 199 ATGSMDNTVRLWESKTGKPFGDALRGHGKWITSLSWEPIHLVTPGERPRLATSSKDGTIK 258

Query: 595 IWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNF-FSASKDGFVKYWD-GDKFECIQKLAAH 652
           IW      C  +L  H  S+ CVK+  G  NF +S S D  V+ WD  +   CI  L  H
Sbjct: 259 IWDTTRRVCTMTLSGHTSSVSCVKW--GGQNFLYSGSHDKTVRVWDMKNSGRCINILKNH 316

Query: 653 QSEVWALAVS 662
              V  L++S
Sbjct: 317 AHWVNHLSLS 326

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 70/146 (47%), Gaps = 17/146 (11%)

Query: 548 DNTVKVFFLDSMKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIW----GLDFGDC 603
           DNT +++  D+     +L GH   VL +  S D ++I T S D  +++W    G  FGD 
Sbjct: 162 DNTARIWDCDTQTPMATLTGHHNWVLCVSWSPDGELIATGSMDNTVRLWESKTGKPFGD- 220

Query: 604 HKSLFAHQDSIMCVKF------LPGSH-NFFSASKDGFVKYWDGDKFECIQKLAAHQSEV 656
             +L  H   I  + +       PG      ++SKDG +K WD  +  C   L+ H S V
Sbjct: 221 --ALRGHGKWITSLSWEPIHLVTPGERPRLATSSKDGTIKIWDTTRRVCTMTLSGHTSSV 278

Query: 657 WALAVSDNGERVV-SVSHDHSIRIWE 681
               V   G+  + S SHD ++R+W+
Sbjct: 279 --SCVKWGGQNFLYSGSHDKTVRVWD 302

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 122/284 (42%), Gaps = 26/284 (9%)

Query: 402 LATAS-NGELKIWNLNTKSCIRTFECGY--ALTCKFLPGGLLVVVGTREGNLQLFDLASS 458
           LAT+S +G +KIW+   + C  T   G+  +++C    G   +  G+ +  ++++D+ +S
Sbjct: 248 LATSSKDGTIKIWDTTRRVCTMTLS-GHTSSVSCVKWGGQNFLYSGSHDKTVRVWDMKNS 306

Query: 459 VLLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNI 518
                I   H   +  L +          S D +++   F    E  A       P+  I
Sbjct: 307 GRCINILKNHAHWVNHLSL----------STDYALRVGPFDYTGEQPA------TPE--I 348

Query: 519 VHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFF--LDSMKFFLSLYGHKLPVLSLD 576
                L+  + +   K +G +  L ++  D+     +  L + K    + GH+  V  + 
Sbjct: 349 AKAKALKNYEKV--AKRNGKETELMVTASDDFTMFLWDPLRTTKPIARMTGHQKLVNHVA 406

Query: 577 ISDDTKVIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVK 636
            S D + I+++S D +IK+W    G    +   H  S+  V +        S SKD  +K
Sbjct: 407 FSPDGRHIVSASFDNSIKLWDSRDGKFITTFRGHVASVYQVAWSSDCRLLVSCSKDTTLK 466

Query: 637 YWDGDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIW 680
            WD    +    L  H+ EV+ +  S +G+RV S   D  +RIW
Sbjct: 467 VWDIRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRIW 510

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/180 (24%), Positives = 76/180 (42%), Gaps = 4/180 (2%)

Query: 52  LKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYADGVIKLWDLVSKTV 111
           L+    +Y       P     K+ K  E    +   ET L+     D  + LWD +  T 
Sbjct: 331 LRVGPFDYTGEQPATPEIAKAKALKNYEKVAKRNGKETELMVTASDDFTMFLWDPLRTTK 390

Query: 112 LLS-FNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDLVSEVGLYKLRSHKGTITGL-WC 169
            ++   GH+  +  + F   G  ++S S D++I +WD      +   R H  ++  + W 
Sbjct: 391 PIARMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWDSRDGKFITTFRGHVASVYQVAWS 450

Query: 170 DSDNWLISTSKDGLIKVWDLKTQQCIETHIAHTGECWALGIMTD--FVVTSSADSQLKIW 227
                L+S SKD  +KVWD++T++       H  E + +    D   V +   D  ++IW
Sbjct: 451 SDCRLLVSCSKDTTLKVWDIRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRIW 510

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 71/332 (21%), Positives = 127/332 (38%), Gaps = 69/332 (20%)

Query: 401 LLATASNGELKIWNLNTKSCIRTF--ECGYALTCKFLPGGLLVVVGTREGNLQLFDLASS 458
           ++  A +   +IW+ +T++ + T      + L   + P G L+  G+ +  ++L++  + 
Sbjct: 156 MVTGAGDNTARIWDCDTQTPMATLTGHHNWVLCVSWSPDGELIATGSMDNTVRLWESKTG 215

Query: 459 VLLTTIEAAHEGAIWSLD-------VTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDK 511
                    H   I SL           +  RL T S D +IK WD           + +
Sbjct: 216 KPFGDALRGHGKWITSLSWEPIHLVTPGERPRLATSSKDGTIKIWD-----------TTR 264

Query: 512 YVPQMNIV-HDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFL-DSMKFFLSLYGHK 569
            V  M +  H S++        +K  G + FL     D TV+V+ + +S +    L  H 
Sbjct: 265 RVCTMTLSGHTSSVSC------VKWGGQN-FLYSGSHDKTVRVWDMKNSGRCINILKNHA 317

Query: 570 LPVLSLDISDD---------------------------------------TKVIITSSAD 590
             V  L +S D                                       T++++T+S D
Sbjct: 318 HWVNHLSLSTDYALRVGPFDYTGEQPATPEIAKAKALKNYEKVAKRNGKETELMVTASDD 377

Query: 591 KNIKIW-GLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKDGFVKYWDGDKFECIQKL 649
             + +W  L        +  HQ  +  V F P   +  SAS D  +K WD    + I   
Sbjct: 378 FTMFLWDPLRTTKPIARMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWDSRDGKFITTF 437

Query: 650 AAHQSEVWALAVSDNGERVVSVSHDHSIRIWE 681
             H + V+ +A S +   +VS S D ++++W+
Sbjct: 438 RGHVASVYQVAWSSDCRLLVSCSKDTTLKVWD 469

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 10/113 (8%)

Query: 39  VITGALEN-ISVWDLKTSELEYVLSDGLPPGSVDLKSSKPAEVSYLQFHSETGLIAAGYA 97
           + TG+++N + +W+ KT +      D L  G     +S   E  +L    E   +A    
Sbjct: 198 IATGSMDNTVRLWESKTGK---PFGDALR-GHGKWITSLSWEPIHLVTPGERPRLATSSK 253

Query: 98  DGVIKLWDLVSKTVLLSFNGHKSRITMLKFDKTGTQ--LISGSEDSNIIVWDL 148
           DG IK+WD   +   ++ +GH S ++ +K+   G Q  L SGS D  + VWD+
Sbjct: 254 DGTIKIWDTTRRVCTMTLSGHTSSVSCVKW---GGQNFLYSGSHDKTVRVWDM 303

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 1/84 (1%)

Query: 606 SLFAHQDSIMCVKFLP-GSHNFFSASKDGFVKYWDGDKFECIQKLAAHQSEVWALAVSDN 664
           ++  H  +I+C  F P  S    + + D   + WD D    +  L  H + V  ++ S +
Sbjct: 135 AIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMATLTGHHNWVLCVSWSPD 194

Query: 665 GERVVSVSHDHSIRIWEETDDQVF 688
           GE + + S D+++R+WE    + F
Sbjct: 195 GELIATGSMDNTVRLWESKTGKPF 218

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 57/289 (19%), Positives = 110/289 (38%), Gaps = 55/289 (19%)

Query: 441 VVVGTREGNLQLFDLASSVLLTTIEAAHEGAIWSLDVT--NDGKRLVTGSADKSIKFWDF 498
           +V G  +   +++D  +   + T+   H    W L V+   DG+ + TGS D +++ W+ 
Sbjct: 156 MVTGAGDNTARIWDCDTQTPMATLTGHHN---WVLCVSWSPDGELIATGSMDNTVRLWES 212

Query: 499 QVKQELIAGTSDKYVPQMNIVHDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDS 558
           +        T   +   +         L  + + +   G+   LA S  D T+K++    
Sbjct: 213 K--------TGKPFGDALRGHGKWITSLSWEPIHLVTPGERPRLATSSKDGTIKIWDTTR 264

Query: 559 MKFFLSLYGHKLPVLSLDISDDTKVIITSSADKNIKIWGL-DFGDCHKSLFAHQDSI--- 614
               ++L GH   V  +        + + S DK +++W + + G C   L  H   +   
Sbjct: 265 RVCTMTLSGHTSSVSCVKWGGQ-NFLYSGSHDKTVRVWDMKNSGRCINILKNHAHWVNHL 323

Query: 615 -----MCVKFLPGSHN-------------------------------FFSASKDGFVKYW 638
                  ++  P  +                                  +AS D  +  W
Sbjct: 324 SLSTDYALRVGPFDYTGEQPATPEIAKAKALKNYEKVAKRNGKETELMVTASDDFTMFLW 383

Query: 639 DGDKF-ECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEETDDQ 686
           D  +  + I ++  HQ  V  +A S +G  +VS S D+SI++W+  D +
Sbjct: 384 DPLRTTKPIARMTGHQKLVNHVAFSPDGRHIVSASFDNSIKLWDSRDGK 432

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 52/129 (40%), Gaps = 9/129 (6%)

Query: 564 SLYGHKLPVLSLDISDDTKV-IITSSADKNIKIWGLDFGDCHKSLFAHQDSIMCVKFLPG 622
           ++ GH   +L    +  T   ++T + D   +IW  D      +L  H + ++CV + P 
Sbjct: 135 AIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMATLTGHHNWVLCVSWSPD 194

Query: 623 SHNFFSASKDGFVKYWD-------GDKFECIQKLAAHQS-EVWALAVSDNGERVVSVSHD 674
                + S D  V+ W+       GD      K     S E   L       R+ + S D
Sbjct: 195 GELIATGSMDNTVRLWESKTGKPFGDALRGHGKWITSLSWEPIHLVTPGERPRLATSSKD 254

Query: 675 HSIRIWEET 683
            +I+IW+ T
Sbjct: 255 GTIKIWDTT 263

>Ecym_5501 Chr5 (1021675..1022658) [984 bp, 327 aa] {ON} similar to
           Ashbya gossypii ACR091W
          Length = 327

 Score = 72.4 bits (176), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 71/238 (29%), Positives = 101/238 (42%), Gaps = 39/238 (16%)

Query: 468 HEGAIWSLDVTNDGKRLVTGSADKSIKFW---DFQVKQELIAGTSDKYVPQMNIVHDSTL 524
           H+   WSLDV+ D   L TGSAD+ IK     DFQ+  EL      K V           
Sbjct: 13  HKDKCWSLDVSKD--VLATGSADRKIKLVDLNDFQLIDELDDTAHKKAVR---------- 60

Query: 525 ELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLS-------LYGHKLPVLSLDI 577
                  S+    +   LA    D+T+ ++  D   +  S       + GH+  V S+  
Sbjct: 61  -------SVAWRPNSNILAAGSFDSTISIWGRDDNGYSSSETDLLAIIEGHENEVKSVSW 113

Query: 578 SDDTKVIITSSADKNIKIW-----GLDFGDCHKSLFAHQDSIMCVKFLPGSHNFFSASKD 632
           S     + T S DK+I IW     G DF +C   L  H   I  V + P ++   S+S D
Sbjct: 114 SHSGYYLATCSRDKSIWIWETDEMGEDF-ECISVLQEHSQDIKHVIWHPSTNILASSSYD 172

Query: 633 GFVKYWD--GDKFECIQKLAAHQSEVWA--LAVSDNGERVVSVSHDHSIRIWEETDDQ 686
             ++ W    D  EC   L  HQ  VW      S++  R+ S S D ++RIW+  D+ 
Sbjct: 173 DTIRVWKEYDDDLECCAVLTGHQGTVWCSGFEASESVIRLCSCSDDATVRIWKCVDEN 230

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 76/173 (43%), Gaps = 15/173 (8%)

Query: 528 DDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSL--YGHKLPVLSLDISDDTKVII 585
           D   S+ +S D   LA    D  +K+  L+  +    L    HK  V S+    ++ ++ 
Sbjct: 15  DKCWSLDVSKD--VLATGSADRKIKLVDLNDFQLIDELDDTAHKKAVRSVAWRPNSNILA 72

Query: 586 TSSADKNIKIWGLD---FGDCHKSLFA----HQDSIMCVKFLPGSHNFFSASKDGFVKYW 638
             S D  I IWG D   +      L A    H++ +  V +    +   + S+D  +  W
Sbjct: 73  AGSFDSTISIWGRDDNGYSSSETDLLAIIEGHENEVKSVSWSHSGYYLATCSRDKSIWIW 132

Query: 639 D----GDKFECIQKLAAHQSEVWALAVSDNGERVVSVSHDHSIRIWEETDDQV 687
           +    G+ FECI  L  H  ++  +    +   + S S+D +IR+W+E DD +
Sbjct: 133 ETDEMGEDFECISVLQEHSQDIKHVIWHPSTNILASSSYDDTIRVWKEYDDDL 185

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 76/172 (44%), Gaps = 26/172 (15%)

Query: 80  VSYLQFHSETGLIAAGYADGVIKLWDL------VSKTVLLSF-NGHKSRITMLKFDKTGT 132
           V  + +   + ++AAG  D  I +W         S+T LL+   GH++ +  + +  +G 
Sbjct: 59  VRSVAWRPNSNILAAGSFDSTISIWGRDDNGYSSSETDLLAIIEGHENEVKSVSWSHSGY 118

Query: 133 QLISGSEDSNIIVWDLVSEVG-----LYKLRSHKGTITG-LWCDSDNWLISTSKDGLIKV 186
            L + S D +I +W+   E+G     +  L+ H   I   +W  S N L S+S D  I+V
Sbjct: 119 YLATCSRDKSIWIWE-TDEMGEDFECISVLQEHSQDIKHVIWHPSTNILASSSYDDTIRV 177

Query: 187 W-----DLKTQQCIETHIAHTGECWALGIMTDFVV----TSSADSQLKIWQM 229
           W     DL   +C      H G  W  G      V    + S D+ ++IW+ 
Sbjct: 178 WKEYDDDL---ECCAVLTGHQGTVWCSGFEASESVIRLCSCSDDATVRIWKC 226

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 89/239 (37%), Gaps = 70/239 (29%)

Query: 460 LLTTIEAAHEGAIWSLDVTNDGKRLVTGSADKSIKFWDFQVKQELIAGTSDKYVPQMNIV 519
           LL  IE  HE  + S+  ++ G  L T S DKSI  W+                      
Sbjct: 97  LLAIIEG-HENEVKSVSWSHSGYYLATCSRDKSIWIWE---------------------- 133

Query: 520 HDSTLELGDDILSIKISGDDKFLAISLLDNTVKVFFLDSMKFFLSLYGHKLPVLSLDISD 579
              T E+G+D           F  IS+L                    H   +  +    
Sbjct: 134 ---TDEMGED-----------FECISVLQE------------------HSQDIKHVIWHP 161

Query: 580 DTKVIITSSADKNIKIWGL--DFGDCHKSLFAHQDSIMCVKFLPGSH--NFFSASKDGFV 635
            T ++ +SS D  I++W    D  +C   L  HQ ++ C  F          S S D  V
Sbjct: 162 STNILASSSYDDTIRVWKEYDDDLECCAVLTGHQGTVWCSGFEASESVIRLCSCSDDATV 221

Query: 636 KYW-------DGDKFECIQKL---AAHQSEVWALAVSDNGERVVSVSHDHSIRIWEETD 684
           + W       D ++ E IQ+    A H   +++++ S +G  + S   D  + +++ETD
Sbjct: 222 RIWKCVDENPDTNEQEWIQEATLPAVHTRAIYSVSWSKDG-IIASAGSDGILAVYKETD 279

 Score = 32.0 bits (71), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 67/156 (42%), Gaps = 20/156 (12%)

Query: 91  LIAAGYADGVIKLWDLVSKTVL--LSFNGHKSRITMLKFDKTGTQLISGSEDSNIIVWDL 148
           ++A G AD  IKL DL    ++  L    HK  +  + +      L +GS DS I +W  
Sbjct: 26  VLATGSADRKIKLVDLNDFQLIDELDDTAHKKAVRSVAWRPNSNILAAGSFDSTISIWGR 85

Query: 149 ------VSEVGLYK-LRSHKGTITGL-WCDSDNWLISTSKDGLIKVWDLKTQ----QCIE 196
                  SE  L   +  H+  +  + W  S  +L + S+D  I +W+        +CI 
Sbjct: 86  DDNGYSSSETDLLAIIEGHENEVKSVSWSHSGYYLATCSRDKSIWIWETDEMGEDFECIS 145

Query: 197 THIAHTGE----CWALGIMTDFVVTSSADSQLKIWQ 228
               H+ +     W     T+ + +SS D  +++W+
Sbjct: 146 VLQEHSQDIKHVIWHPS--TNILASSSYDDTIRVWK 179

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 46