Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A039408.323ON75268924840.0
Suva_2.3068.323ON5411856531e-75
Kpol_543.638.323ON5851856473e-74
KAFR0B057208.323ON4841656393e-74
TDEL0F044908.323ON5101856371e-73
Smik_4.3898.323ON5251846381e-73
YDR145W (TAF12)8.323ON5391846354e-73
ZYRO0F10384g8.323ON5581656331e-72
NCAS0B035708.323ON5191856213e-71
KLTH0G12298g8.323ON5001656081e-69
Kwal_56.239168.323ON4991656062e-69
SAKL0H15554g8.323ON5361656082e-69
NDAI0J010208.323ON6381865986e-67
KLLA0D16368g8.323ON5111655897e-67
TPHA0A015608.323ON5401855864e-66
CAGL0E01397g8.323ON5751855763e-64
Skud_4.4048.323ON5351845708e-64
AGL195C8.323ON5541655691e-63
Ecym_42548.323ON5291615602e-62
KNAG0I008908.323ON5081645362e-59
TBLA0H012808.323ON4051132967e-28
Kpol_448.141.224ON132350761.7
TBLA0B066405.161ON72984733.9
TPHA0A046705.161ON73484726.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A03940
         (752 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.3...   961   0.0  
Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa...   256   1e-75
Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON} (145534...   253   3e-74
KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON} Anc_8...   250   3e-74
TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.3...   249   1e-73
Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W ...   250   1e-73
YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subun...   249   4e-73
ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some s...   248   1e-72
NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.3...   243   3e-71
KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]...   238   1e-69
Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145...   238   2e-69
SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]...   238   2e-69
NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {...   234   6e-67
KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} simi...   231   7e-67
TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {O...   230   4e-66
CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {...   226   3e-64
Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W ...   224   8e-64
AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON} S...   223   1e-63
Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar t...   220   2e-62
KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {O...   211   2e-59
TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {O...   118   7e-28
Kpol_448.14 s448 (28880..32851) [3972 bp, 1323 aa] {ON} (28880.....    34   1.7  
TBLA0B06640 Chr2 complement(1560057..1562246) [2190 bp, 729 aa] ...    33   3.9  
TPHA0A04670 Chr1 complement(1057175..1059379) [2205 bp, 734 aa] ...    32   6.2  

>TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.323
           YDR145W
          Length = 752

 Score =  961 bits (2484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/689 (72%), Positives = 501/689 (72%)

Query: 43  IRGHQLTPNQSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNF 102
           IRGHQLTPNQSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNF
Sbjct: 43  IRGHQLTPNQSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNF 102

Query: 103 NKQRQQAIQAYKRAQNQINSPRNENSISNNSADTDSKAGTNSTAMVTAQSPGVNNNRAIP 162
           NKQRQQAIQAYKRAQNQINSPRNENSISNNSADTDSKAGTNSTAMVTAQSPGVNNNRAIP
Sbjct: 103 NKQRQQAIQAYKRAQNQINSPRNENSISNNSADTDSKAGTNSTAMVTAQSPGVNNNRAIP 162

Query: 163 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXPATNEITKSRVXXXXXXXXXXXXXXXXXXXX 222
                                        PATNEITKSRV                    
Sbjct: 163 NSMSSGSNSNSSSNTSNSNISNSSGSNNNPATNEITKSRVNSNNNNNSNTNNSNNAKNGN 222

Query: 223 XXXXXVQLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPN 282
                VQLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPN
Sbjct: 223 QNNSNVQLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPN 282

Query: 283 IPALDRVKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTS 342
           IPALDRVKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTS
Sbjct: 283 IPALDRVKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTS 342

Query: 343 HXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQKVTENKMSESVSQ 402
           H                                            DQKVTENKMSESVSQ
Sbjct: 343 HQQQQQQQQQQQLAQQQQQQQQQQQQQQQQQQQQQQLQQQHQQHQDQKVTENKMSESVSQ 402

Query: 403 RNGINQDSNLTNFSPGVSGINTTXXXXXXXXXXXXXXXXXXXXXXXXESEMSVQXXXXXX 462
           RNGINQDSNLTNFSPGVSGINTT                        ESEMSVQ      
Sbjct: 403 RNGINQDSNLTNFSPGVSGINTTGINDDKNNAINISNNINGSIDSKSESEMSVQNNTNIK 462

Query: 463 XXXXXXFSNVNNDSNISKSVKSTKSDQGQPVEPIKSQSQTGATTDEKLTXXXXXXXXXXX 522
                 FSNVNNDSNISKSVKSTKSDQGQPVEPIKSQSQTGATTDEKLT           
Sbjct: 463 ETNTTNFSNVNNDSNISKSVKSTKSDQGQPVEPIKSQSQTGATTDEKLTSQSQAASSNQS 522

Query: 523 XXXXXTLDAXXXXXXXXXXXXXAITNVNXXXXXXXXXXXXXMNIFKQTEPLLPISEHLTT 582
                TLDA             AITNVN             MNIFKQTEPLLPISEHLTT
Sbjct: 523 NNSNSTLDASSGQSNSQNRQQSAITNVNAAASTSSKSLTKTMNIFKQTEPLLPISEHLTT 582

Query: 583 KIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQRVMLKRKLKEXXXXXXXX 642
           KIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQRVMLKRKLKE        
Sbjct: 583 KIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQRVMLKRKLKEVVRSVGVD 642

Query: 643 XXXXETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRI 702
               ETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRI
Sbjct: 643 DGDGETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRI 702

Query: 703 PSYSMDVIRSSRKWNPTASYNQKLNSLNP 731
           PSYSMDVIRSSRKWNPTASYNQKLNSLNP
Sbjct: 703 PSYSMDVIRSSRKWNPTASYNQKLNSLNP 731

>Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa]
           {ON} YDR145W (REAL)
          Length = 541

 Score =  256 bits (653), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 140/185 (75%)

Query: 546 ITNVNXXXXXXXXXXXXXMNIFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNT 605
           +TNVN               IFKQTEP +PISE+++TK P  +PYR+NRPT+TGG+AMN 
Sbjct: 336 VTNVNATASMMSNASSSKSAIFKQTEPAIPISENISTKAPAPVPYRSNRPTITGGSAMNA 395

Query: 606 SVLNTPVLTKLPPYEIDTQRVMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNF 665
           + LNTPV TKLPPYE+DTQRVM KRKL+E            ETVI GDVEE LLDLAD+F
Sbjct: 396 TALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDF 455

Query: 666 VTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQK 725
           VT+VT FAC++AKHRKSD+L+  DIQLHLE+NWNIRIP YS D IRS+RKWNP+ SYNQK
Sbjct: 456 VTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQK 515

Query: 726 LNSLN 730
           L ++N
Sbjct: 516 LQNIN 520

 Score =  115 bits (289), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 229 QLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDR 288
           + +N IKQ+LT E+N+QY++L  NFQ+RAT++KEK  FLKQ+I R   E+NK    A  +
Sbjct: 131 KFSNMIKQVLTSEENQQYEKLWQNFQVRATSMKEKDTFLKQNIDRLVQEVNKQTDEATKK 190

Query: 289 VKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTS 342
            +LE KK EL++N K + I+Y  L + FQN KK+FY+ CAR NP LQ+ LQ+++
Sbjct: 191 -QLEDKKNELLNNRKVLGIEYNNLLKGFQNSKKTFYVECARHNPALQKFLQEST 243

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 58/81 (71%)

Query: 50  PNQSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFNKQRQQA 109
           P Q+ MLQQKQL+E+  KFK LV+EA+ VGE T RGKEL+ QA KIK +YD FN++RQQA
Sbjct: 27  PQQNMMLQQKQLLEMTVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNRRRQQA 86

Query: 110 IQAYKRAQNQINSPRNENSIS 130
            QAYK A     +P   N +S
Sbjct: 87  AQAYKNASVGNTTPNAGNPVS 107

>Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON}
           (145534..147291) [1758 nt, 586 aa]
          Length = 585

 Score =  253 bits (647), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 139/185 (75%)

Query: 546 ITNVNXXXXXXXXXXXXXMNIFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNT 605
           +TNVN               IFKQ++P +PISE +T K PEA+ Y +NRP+LTGGTAMN 
Sbjct: 377 VTNVNATASSANKNIQSKSAIFKQSDPSVPISESITVKAPEAVSYISNRPSLTGGTAMNA 436

Query: 606 SVLNTPVLTKLPPYEIDTQRVMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNF 665
           SVLNTP +TKLPPYEIDT+RVM KRKL+E            ETVI GDVEE LLDLAD+F
Sbjct: 437 SVLNTPTITKLPPYEIDTERVMSKRKLRELIKSVGIDEGDGETVIDGDVEELLLDLADDF 496

Query: 666 VTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQK 725
           VT+VT+FAC++AKHRKSDSL+  DIQLHLE+NWNIRIP YS D IRS+RKW PT SY+QK
Sbjct: 497 VTNVTSFACRLAKHRKSDSLEARDIQLHLERNWNIRIPGYSGDEIRSTRKWIPTQSYSQK 556

Query: 726 LNSLN 730
           + S+N
Sbjct: 557 MQSIN 561

 Score =  134 bits (336), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 89/113 (78%), Gaps = 1/113 (0%)

Query: 229 QLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDR 288
           QLA+ IKQ+LTPE+N+QYD+L+ NFQ RA++IK++H FLKQHI R + E+N+    A  +
Sbjct: 130 QLADLIKQVLTPEENQQYDKLLQNFQSRASSIKDQHTFLKQHIDRLSQEINQQTDEAAKK 189

Query: 289 VKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKT 341
            +LE  + EL++NL+ ++ +Y+ LY++ +N KK+FY+ CARQNP LQRLLQK+
Sbjct: 190 -QLEVNRAELLTNLRTLNTEYSNLYEDIKNKKKAFYVECARQNPELQRLLQKS 241

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%)

Query: 67  KFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFNKQRQQAI 110
           KFK LVNEAK+VG+NT RGKELL+QA  +K +YDN+NKQRQ  I
Sbjct: 33  KFKELVNEAKRVGQNTQRGKELLIQASNLKAVYDNYNKQRQALI 76

>KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON}
           Anc_8.323 YDR145W
          Length = 484

 Score =  250 bits (639), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 110/165 (66%), Positives = 135/165 (81%)

Query: 566 IFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQR 625
           IFKQ++P +PISE +++K P  +PYR NRPT++GG+AMN + LNTP++TKLPPYE+DT+R
Sbjct: 298 IFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELDTER 357

Query: 626 VMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSL 685
           VM KRKL+E            ETVI GDVEE LLDLAD+FVT+VT+FACK+AKHRKSD+L
Sbjct: 358 VMSKRKLRELVKTIGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACKLAKHRKSDNL 417

Query: 686 DVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQKLNSLN 730
           +  DIQLHLE+NWNIRIP YS D IRS+RKWNPT SYNQKL S+N
Sbjct: 418 ETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQSIN 462

 Score =  143 bits (361), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 67/116 (57%), Positives = 90/116 (77%), Gaps = 1/116 (0%)

Query: 228 VQLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALD 287
            Q A  I+Q LTPEQN+QYD+LV NFQ RA NIK+KH FLKQ+I R   E+ K    A  
Sbjct: 113 AQFATLIRQALTPEQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIEK-QTDAAA 171

Query: 288 RVKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTSH 343
           + +L++K++ELM+NLKAIS++YT L Q++ NGKK+FYI CA++NP+LQRLLQK++ 
Sbjct: 172 KKQLDEKRIELMTNLKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLLQKSTQ 227

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 37/53 (69%), Positives = 45/53 (84%)

Query: 58  QKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFNKQRQQAI 110
           QKQLMEL A+FK LV EAKKVGE T  GKEL+MQA K+K +YDN+NKQ+Q+A+
Sbjct: 25  QKQLMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNKQKQEAM 77

>TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.323
           YDR145W
          Length = 510

 Score =  249 bits (637), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 112/185 (60%), Positives = 135/185 (72%)

Query: 546 ITNVNXXXXXXXXXXXXXMNIFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNT 605
           +TNVN               IFKQ++PL+PISE +T K P  + Y+ NRPTLTGGTAMN 
Sbjct: 306 VTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGGTAMNA 365

Query: 606 SVLNTPVLTKLPPYEIDTQRVMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNF 665
           + LNTP +TKLPPYE+DT+RVM KRKL+E            ETVI GDVE  LLDLAD+F
Sbjct: 366 AALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLDLADDF 425

Query: 666 VTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQK 725
           V++VT FAC++AKHRKSD+LD  DIQLHLE+NWNIRIP YS D IRS+RKWNP  SYNQK
Sbjct: 426 VSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKPSYNQK 485

Query: 726 LNSLN 730
           + ++N
Sbjct: 486 MQAIN 490

 Score =  135 bits (339), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 64/113 (56%), Positives = 85/113 (75%), Gaps = 1/113 (0%)

Query: 230 LANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDRV 289
           LAN IKQ+LTPEQN+Q++ L  NFQ RA +I++KH FLKQHI R   E++K    A  + 
Sbjct: 125 LANIIKQVLTPEQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSK-QTDASAKK 183

Query: 290 KLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTS 342
           +LE+KK EL +NLK ++++Y  L QEFQNGKK FY+ CAR NP LQRLLQ+++
Sbjct: 184 QLEEKKTELANNLKMLNMEYGALQQEFQNGKKKFYVECARHNPALQRLLQRST 236

 Score = 92.0 bits (227), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 42/62 (67%), Positives = 52/62 (83%)

Query: 57  QQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFNKQRQQAIQAYKRA 116
           QQ+QL+EL  KF+ LVNEAK VGENT RGKELL++A KIK IYDN+N+QRQQA QA+ + 
Sbjct: 23  QQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYNRQRQQAAQAFVQG 82

Query: 117 QN 118
           +N
Sbjct: 83  RN 84

>Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W
           (REAL)
          Length = 525

 Score =  250 bits (638), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 136/184 (73%)

Query: 546 ITNVNXXXXXXXXXXXXXMNIFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNT 605
           +TNVN               IFKQTEP +PISE+++ K P  + YR+NRPT+TGG+AMN 
Sbjct: 320 VTNVNATASMMNNVSSSKSAIFKQTEPAIPISENISAKAPAPVAYRSNRPTITGGSAMNA 379

Query: 606 SVLNTPVLTKLPPYEIDTQRVMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNF 665
           S LNTP  TKLPPYE+DTQRVM KRKL+E            ETVI GDVEE LLDLAD+F
Sbjct: 380 SALNTPAATKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDF 439

Query: 666 VTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQK 725
           VT+VT F+C++AKHR+SD+L+  DIQLHLE+NWNIRIP YS D IRS+RKWNP+ SYNQK
Sbjct: 440 VTNVTAFSCRLAKHRRSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQK 499

Query: 726 LNSL 729
           L S+
Sbjct: 500 LQSI 503

 Score =  112 bits (279), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 81/114 (71%), Gaps = 1/114 (0%)

Query: 229 QLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDR 288
           + ++ IKQ+LTPE+N++Y++L  NFQ R T+IKEK  FLKQ+I R   E+NK       +
Sbjct: 137 KFSSMIKQVLTPEENQEYEKLWQNFQARHTSIKEKETFLKQNIDRLEQEINKQTEEGA-K 195

Query: 289 VKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTS 342
            +L++KK EL+++ K + I+YT L+  +QN KK+FY+ CAR NP L + LQ+++
Sbjct: 196 QQLQEKKNELLNDWKVLKIEYTKLFNSYQNSKKTFYVECARHNPALHKFLQEST 249

 Score = 82.8 bits (203), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 62/96 (64%), Gaps = 7/96 (7%)

Query: 52  QSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYD--NFNKQRQQA 109
           Q+ +LQ +QL E+ AKF  L+ EA+ VGE T RGKEL+ QA KIKQ+YD    NK+RQQA
Sbjct: 29  QNMVLQPRQLQEMTAKFTALLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNKRRQQA 88

Query: 110 IQAYKRAQNQINSPRNENSISNNSADTDSKAGTNST 145
            QAY+ A     S  N NS SNN     ++  +NS+
Sbjct: 89  AQAYRNA-----SMGNTNSNSNNPVTMSTEKTSNSS 119

>YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subunit
           (61/68 kDa) of TFIID and SAGA complexes, involved in RNA
           polymerase II transcription initiation and in chromatin
           modification, similar to histone H2A
          Length = 539

 Score =  249 bits (635), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 114/184 (61%), Positives = 137/184 (74%)

Query: 546 ITNVNXXXXXXXXXXXXXMNIFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNT 605
           +TNVN               IFKQTEP +PISE+++TK P  + YR+NRPT+TGG+AMN 
Sbjct: 334 VTNVNATASMLNNISSSKSAIFKQTEPAIPISENISTKTPAPVAYRSNRPTITGGSAMNA 393

Query: 606 SVLNTPVLTKLPPYEIDTQRVMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNF 665
           S LNTP  TKLPPYE+DTQRVM KRKL+E            ETVI GDVEE LLDLAD+F
Sbjct: 394 SALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDF 453

Query: 666 VTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQK 725
           VT+VT F+C++AKHRKSD+L+  DIQLHLE+NWNIRIP YS D IRS+RKWNP+ +YNQK
Sbjct: 454 VTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNYNQK 513

Query: 726 LNSL 729
           L S+
Sbjct: 514 LQSI 517

 Score =  114 bits (286), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 83/114 (72%), Gaps = 1/114 (0%)

Query: 229 QLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDR 288
           + +N IKQ+LTPE+N++Y++L  NFQ+R T+IKEK  +LKQ+I R   E+NK       +
Sbjct: 131 KFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEINKQTDEG-PK 189

Query: 289 VKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTS 342
            +L++KK+EL+++ K + I+YT L+  +QN KK+FY+ CAR NP L + LQ+++
Sbjct: 190 QQLQEKKIELLNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPALHKFLQEST 243

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/64 (57%), Positives = 48/64 (75%), Gaps = 2/64 (3%)

Query: 52  QSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYD--NFNKQRQQA 109
           Q+ +LQ +QL E+ AKF+ L+ EA+ VGE T RGKEL+ QA KIKQ+YD    N++RQQA
Sbjct: 29  QNMVLQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRQQA 88

Query: 110 IQAY 113
            QAY
Sbjct: 89  AQAY 92

>ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some
           similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 558

 Score =  248 bits (633), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 133/165 (80%)

Query: 566 IFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQR 625
           IFKQ++PL+PISE++T K P  + Y++NRPTLTGG AMN S LNTP +TKLPPYE+DT+R
Sbjct: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428

Query: 626 VMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSL 685
           VM KRKL+E            ETVI GDVEE LLDLAD+FVT+VT FAC++AKHRKSD+L
Sbjct: 429 VMSKRKLRELVKTVGIDDGDGETVIDGDVEELLLDLADDFVTNVTGFACRLAKHRKSDNL 488

Query: 686 DVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQKLNSLN 730
           D  DIQLHLE+NWNIRIP YS D IRS+RKWNP+ SYNQK+ S+N
Sbjct: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSIN 533

 Score =  138 bits (348), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 64/113 (56%), Positives = 87/113 (76%), Gaps = 1/113 (0%)

Query: 230 LANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDRV 289
           LAN IKQ+LTPEQN+QYD L+  FQ R  NI++KH+FL+QH+     E+NK   PA  + 
Sbjct: 139 LANIIKQVLTPEQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKK- 197

Query: 290 KLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTS 342
           +LE KK+EL++NLK+++++Y+ L QEF NGKK FY+ CAR NP LQRLLQK++
Sbjct: 198 QLEDKKMELLTNLKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 32/51 (62%), Positives = 40/51 (78%)

Query: 52  QSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNF 102
           Q A+LQ +QL+EL  KF+ LV E+K VGENT RGKELL+QA KIK +Y N+
Sbjct: 30  QGALLQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNY 80

>NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.323
           YDR145W
          Length = 519

 Score =  243 bits (621), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 109/185 (58%), Positives = 140/185 (75%)

Query: 546 ITNVNXXXXXXXXXXXXXMNIFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNT 605
           +TNVN               IFKQ++P++P+S+ ++TK P A+PYR+NRPT+TGG+AM+ 
Sbjct: 315 VTNVNAAASMSDSSNSSKQTIFKQSDPMVPVSDTISTKQPIAVPYRSNRPTMTGGSAMSA 374

Query: 606 SVLNTPVLTKLPPYEIDTQRVMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNF 665
           S LNTPV+TKLPPYE+DT+RVM KRKL+E            ETVI GDVEE LLD+AD+F
Sbjct: 375 SALNTPVMTKLPPYELDTERVMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDMADDF 434

Query: 666 VTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQK 725
           +T+VT+FAC++AKHRKSD+L+  DIQLHLE+NW+IRIP YS D IRS RKWNP  +YNQK
Sbjct: 435 ITNVTSFACRLAKHRKSDNLEARDIQLHLERNWDIRIPGYSADEIRSIRKWNPAQTYNQK 494

Query: 726 LNSLN 730
           L  +N
Sbjct: 495 LQQIN 499

 Score =  129 bits (323), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 88/114 (77%)

Query: 229 QLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDR 288
           QLAN ++Q+LT EQN  +D+L   F+ RA+ +K+KH FLKQ+I R T E+NK       R
Sbjct: 120 QLANIMRQVLTDEQNANFDKLDQTFRSRASALKDKHTFLKQNIERLTQEINKQADNVNAR 179

Query: 289 VKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTS 342
            +LE+K+ EL+ NLKAI++++ TLYQ++QNGKK+FYI CA+ NP+LQ+LLQK++
Sbjct: 180 KQLEEKRGELLRNLKAITMEHNTLYQKYQNGKKAFYIECAKTNPDLQKLLQKST 233

 Score = 79.7 bits (195), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 68/96 (70%), Gaps = 6/96 (6%)

Query: 45  GHQLTPNQS------AMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQI 98
           G+Q TP  S       +LQ  Q+ EL AKFK LVNEAK+VGENT RGKELL+QA K+K +
Sbjct: 4   GNQNTPAPSNGQPRNIILQPNQIRELTAKFKALVNEAKEVGENTQRGKELLIQASKLKAM 63

Query: 99  YDNFNKQRQQAIQAYKRAQNQINSPRNENSISNNSA 134
           YDN+N+QRQQ +Q  +   N++ +P N ++++ N++
Sbjct: 64  YDNYNRQRQQQLQQQQAVNNKVQNPSNNDNVTTNNS 99

>KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]
           {ON} similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145W
          Length = 500

 Score =  238 bits (608), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 130/165 (78%)

Query: 566 IFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQR 625
           IFKQ  P +P+SE +T ++P  + +R+NRPT+TGG+AMN + L TPV+TKLPPYE+D +R
Sbjct: 305 IFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNER 364

Query: 626 VMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSL 685
           VM KRKL+E            ET I GDVEE LLDLAD+F+T+VT+FAC++AKHRKSD+L
Sbjct: 365 VMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 424

Query: 686 DVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQKLNSLN 730
           DV DIQLHLE+NWNIRIP Y+ D +RS+RKWNPT SYNQKL  +N
Sbjct: 425 DVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGIN 469

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 62/114 (54%)

Query: 230 LANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDRV 289
           +++ I+ LLTP+QN+ Y +L+         IK ++ +LK+ I     E+ K         
Sbjct: 112 MSSNIQNLLTPQQNEAYGRLIQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVK 171

Query: 290 KLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTSH 343
           +LE  K E+++ L+  S  Y  L Q+ +  KK FYI CA  NPNL+R LQ ++ 
Sbjct: 172 QLETNKTEILNKLRGFSASYLALNQKLREDKKKFYIECAATNPNLKRFLQASTQ 225

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 46  HQLTPNQSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFNKQ 105
            Q TP Q   L  + L ++  KF    NEAK+VG  T +G+ELL QA +IK +YD + +Q
Sbjct: 17  QQGTPAQ--RLTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAY-RQ 73

Query: 106 RQQAIQAYKRA 116
           RQQ+ Q +++ 
Sbjct: 74  RQQSAQGFEQG 84

>Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145W
           (TAF12) - TFIID subunit [contig 171] FULL
          Length = 499

 Score =  238 bits (606), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 105/165 (63%), Positives = 130/165 (78%)

Query: 566 IFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQR 625
           IFKQ  P +P+SE +T K+P  +  R+NRPT+TGG+AMN + L TPV+TKLPPYE+D +R
Sbjct: 305 IFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNER 364

Query: 626 VMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSL 685
           VM KRKL+E            ET I GDVEE LLDLAD+F+T+VT+FAC++AKHRKSD+L
Sbjct: 365 VMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 424

Query: 686 DVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQKLNSLN 730
           DV DIQLHLE+NWNIRIP Y+ D +RS+RKWNPTASYNQKL  +N
Sbjct: 425 DVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGIN 469

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 63/114 (55%)

Query: 230 LANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDRV 289
           +++ I+ LLTP+QN+ Y +L+ +       IK ++ +LK+ I     E+ K         
Sbjct: 112 ISSNIQNLLTPQQNEAYGRLIQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVK 171

Query: 290 KLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTSH 343
           +LE  K E+++ LK  S  Y  L Q+ +  KK FYI CA  NPNL+R LQ ++ 
Sbjct: 172 QLEANKAEILNKLKGFSASYVALNQKLREDKKKFYIECAATNPNLKRFLQASTQ 225

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 61  LMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFNKQRQQAIQAY 113
           + ++  KF    NEAK++G  T +G+ELL QA  IK +YD + +QRQQA Q +
Sbjct: 30  MQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAY-RQRQQAAQGF 81

>SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]
           {ON} some similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 536

 Score =  238 bits (608), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 130/165 (78%)

Query: 566 IFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQR 625
           IFKQ  P LP+SE++T K P A+ YR+NRPT+TGG+AMN + LNTPV+TKLPPYE+D++R
Sbjct: 328 IFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAALNTPVMTKLPPYEVDSER 387

Query: 626 VMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSL 685
           VM KRKL+E            ET I GDVEE LLDLAD+F+++VT FAC++AKHRKSD+L
Sbjct: 388 VMSKRKLRELVKSVGVDEGDGETTIDGDVEELLLDLADDFISNVTGFACRLAKHRKSDNL 447

Query: 686 DVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQKLNSLN 730
           DV DIQLHLE+NWNIRIP YS D IRS+RKWN T +Y QKL  +N
Sbjct: 448 DVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGIN 492

 Score = 81.3 bits (199), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 63/109 (57%)

Query: 234 IKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDRVKLEK 293
           I+ LLTPEQ++ Y++L   F   A NI+ + ++L+++I     E+       L   +LE 
Sbjct: 120 IRTLLTPEQSEAYNKLTKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLES 179

Query: 294 KKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTS 342
            K EL++ L+ +   +  L Q+F   KK FYI CA  NPNL+R LQ ++
Sbjct: 180 TKAELVTKLRGLDASFQALPQKFHEAKKKFYIECAASNPNLKRFLQAST 228

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%)

Query: 61  LMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFNKQRQQAIQAYKRAQNQ 119
           + +L  +F  L  EA ++G NT+ G+ELL QA KIK IYD +NKQ+QQA QA+ +  N+
Sbjct: 30  IQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNKQKQQAAQAFGQTNNR 88

>NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {ON}
           Anc_8.323 YDR145W
          Length = 638

 Score =  234 bits (598), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 111/186 (59%), Positives = 135/186 (72%)

Query: 545 AITNVNXXXXXXXXXXXXXMNIFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMN 604
           ++TNVN               +FK  EP++ IS+ ++TK P ++PYR+NRP+LTGG+AMN
Sbjct: 418 SVTNVNAAASASSVHPSNKSIMFKPAEPIVNISDTISTKQPISVPYRSNRPSLTGGSAMN 477

Query: 605 TSVLNTPVLTKLPPYEIDTQRVMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADN 664
            S L TPV TKLPPYEIDT+RVM KRKL+E            ETVI GDVEE LLDLAD+
Sbjct: 478 ASALTTPVATKLPPYEIDTERVMSKRKLRELVKSIGVDEGDGETVIDGDVEELLLDLADD 537

Query: 665 FVTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQ 724
           FVT+VT+FAC++AKHR SDSL+  DIQLHLEKNWNIRIP YS D IRS RKW+P  +YNQ
Sbjct: 538 FVTNVTSFACRLAKHRNSDSLEPRDIQLHLEKNWNIRIPGYSADEIRSIRKWHPIQNYNQ 597

Query: 725 KLNSLN 730
           KL  +N
Sbjct: 598 KLQHIN 603

 Score =  132 bits (332), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 59/112 (52%), Positives = 86/112 (76%)

Query: 229 QLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDR 288
           QLA+ +KQ+LTPEQN++YD+LV+ FQ RA  IKEKH F+KQ+I R + ELNKPN+    +
Sbjct: 162 QLASIMKQVLTPEQNQEYDKLVSTFQTRAAAIKEKHSFVKQNIERLSQELNKPNLDPNLK 221

Query: 289 VKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQK 340
            +LE KK EL + ++AI++++ TL+Q+FQ G+K+FY+ CA+ NP LQ   +K
Sbjct: 222 TQLENKKTELFNTIRAITVEHNTLHQQFQTGQKTFYVECAKNNPALQNCYKK 273

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (71%), Gaps = 3/60 (5%)

Query: 45  GHQLTPNQSAMLQQKQLMELVAKFKLLVNEAKKVG-ENTARGKELLMQAGKIKQIYDNFN 103
           GHQ  P     LQ  Q++EL  KFK LVNEAK++G +N+ RGKELL+QA KIK IYD +N
Sbjct: 27  GHQGGP--PITLQPNQVIELSNKFKALVNEAKQLGGDNSQRGKELLIQASKIKAIYDTYN 84

>KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} similar
           to uniprot|Q03761 Saccharomyces cerevisiae YDR145W,
          Length = 511

 Score =  231 bits (589), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 103/165 (62%), Positives = 128/165 (77%)

Query: 566 IFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQR 625
           IFKQ  P +PISE++T     ++ YR+NRPT+TGG+ MN   L TPV+TKLPPYE+DT+R
Sbjct: 335 IFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTER 394

Query: 626 VMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSL 685
           VM KRKL+E            ET I GDVEE LLDLAD+F+T+VT FACK+AKHRKSDSL
Sbjct: 395 VMSKRKLRELVKTVGIDEGDGETTIDGDVEELLLDLADDFITNVTNFACKLAKHRKSDSL 454

Query: 686 DVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQKLNSLN 730
           DV DIQ+HLE+NWNIRIP ++ D IRS++KWNPT SYNQ +N++N
Sbjct: 455 DVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAIN 499

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 69/109 (63%)

Query: 230 LANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDRV 289
           + N IK LLTP+Q + Y++LV  ++    NIK + +FLK++IS    E+      +L   
Sbjct: 109 VTNNIKVLLTPQQREAYNRLVQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQ 168

Query: 290 KLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLL 338
           +LE  + EL+  ++A+S QY+TL Q++Q  ++ FYI C++ N +L+R L
Sbjct: 169 QLEVNRNELLMKIRALSAQYSTLQQKYQEDRRKFYIECSQTNADLRRYL 217

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 34/46 (73%)

Query: 61  LMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFNKQR 106
           + +L  + K LVNEAK++G +T  GKELL QA +IK +Y+ ++KQR
Sbjct: 18  MQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQR 63

>TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {ON}
           Anc_8.323 YDR145W
          Length = 540

 Score =  230 bits (586), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 136/185 (73%)

Query: 546 ITNVNXXXXXXXXXXXXXMNIFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNT 605
           ITNVN               IFKQ++P +PIS+++T +  E IPY++NRP+LTGG AM+ 
Sbjct: 334 ITNVNAAASANVKNNQAKSVIFKQSDPTVPISDNVTLEPTELIPYKSNRPSLTGGAAMSA 393

Query: 606 SVLNTPVLTKLPPYEIDTQRVMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNF 665
           + LN P LT LPPYEIDT+RVM KRKL+E            ETVI GDVEE LLDLAD+F
Sbjct: 394 AALNVPPLTTLPPYEIDTERVMAKRKLRELIKNVGIDEGDGETVIDGDVEELLLDLADDF 453

Query: 666 VTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQK 725
           VT+VT+FAC++AKHRKS++L+  DIQLHLE+NWNIRIP YS D IRS+RKW PT +++QK
Sbjct: 454 VTNVTSFACRLAKHRKSENLESRDIQLHLERNWNIRIPGYSGDEIRSTRKWLPTQAFSQK 513

Query: 726 LNSLN 730
           L S+N
Sbjct: 514 LQSIN 518

 Score =  113 bits (282), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/112 (50%), Positives = 83/112 (74%), Gaps = 2/112 (1%)

Query: 229 QLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAEL--NKPNIPAL 286
           Q+AN IKQ+LT EQN+QYD LV NF  + T+IK+KH FLKQ+I + T E+  N  N    
Sbjct: 147 QIANIIKQILTAEQNQQYDNLVKNFLAKRTSIKDKHAFLKQNIDKLTQEINNNSNNNDVN 206

Query: 287 DRVKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLL 338
            +  LE K+ EL++NLK +S++++ +++EF+N KK+FY+ CA+QNP LQ+LL
Sbjct: 207 VKKNLEIKRNELITNLKQLSLEFSKIHEEFKNDKKTFYVECAKQNPALQKLL 258

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 45/60 (75%), Gaps = 4/60 (6%)

Query: 49  TPNQSA----MLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFNK 104
           TP  SA     LQQKQL+EL  KFK LVNEAK VGENT RGKELL+QA K+K IY+NF K
Sbjct: 14  TPASSAQAKLALQQKQLIELTNKFKQLVNEAKAVGENTPRGKELLIQASKLKAIYENFTK 73

>CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {ON}
           similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145w TAF61
          Length = 575

 Score =  226 bits (576), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 131/185 (70%)

Query: 546 ITNVNXXXXXXXXXXXXXMNIFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNT 605
           +T VN              +IFK ++P +PI++ ++ K PE I +R+NRPT++ G+AMN 
Sbjct: 366 VTGVNAAASSAGSSTVTKSSIFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNA 425

Query: 606 SVLNTPVLTKLPPYEIDTQRVMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNF 665
           + LNTPV+T LPPYEIDT RVM KRKL+E            ETVI GDVEE LLDLAD+F
Sbjct: 426 AALNTPVMTTLPPYEIDTDRVMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDLADDF 485

Query: 666 VTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQK 725
           VT+VT FAC++AKHRKSD+L+  DIQLHLE+NWNIRIP YS D IRS  KWN + +Y QK
Sbjct: 486 VTNVTGFACRLAKHRKSDNLEPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQK 545

Query: 726 LNSLN 730
           L S+N
Sbjct: 546 LTSIN 550

 Score =  137 bits (345), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 65/115 (56%), Positives = 88/115 (76%), Gaps = 1/115 (0%)

Query: 228 VQLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALD 287
            QLAN IKQ+LTPEQN+QY+QL+ NFQ+RA+ IK+KH F+KQ+I R   E+NK       
Sbjct: 131 AQLANIIKQVLTPEQNQQYEQLLQNFQVRASAIKDKHTFIKQNIDRLVVEINK-QTDEEA 189

Query: 288 RVKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTS 342
           + +L +KK EL+ N+KAI +++  L QE QNGKK+FY+ CARQNP LQRLLQ+++
Sbjct: 190 KKQLNEKKTELLRNIKAIRLEHQALQQELQNGKKNFYLECARQNPALQRLLQRST 244

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 45/58 (77%), Gaps = 1/58 (1%)

Query: 45  GHQLTPNQSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNF 102
           G    P++SA +QQKQ+ EL A+FK LV EAKKVGE T RGKELL+QA K+K +Y+N+
Sbjct: 20  GSGGPPSKSA-IQQKQIQELTARFKQLVTEAKKVGETTPRGKELLLQAAKLKAVYENY 76

>Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W
           (REAL)
          Length = 535

 Score =  224 bits (570), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 115/184 (62%), Positives = 138/184 (75%)

Query: 546 ITNVNXXXXXXXXXXXXXMNIFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNT 605
           +TNVN               IFKQTEP +PISE+++TK P  + YR+NRPT+TGG+AMN 
Sbjct: 330 VTNVNATASMMSNVSANKSAIFKQTEPAIPISENISTKAPAPVAYRSNRPTVTGGSAMNA 389

Query: 606 SVLNTPVLTKLPPYEIDTQRVMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNF 665
           S LNTPV TKLPPYE+DTQRVM KRKL+E            ETVI GDVE+ LLDLAD+F
Sbjct: 390 SALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIDGDVEDLLLDLADDF 449

Query: 666 VTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQK 725
           VT+VT FAC++AKHRKSD+L+  DIQLHLE+NWNIRIP YS D IRS+RKWNP+ SYNQK
Sbjct: 450 VTNVTAFACRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQK 509

Query: 726 LNSL 729
           L ++
Sbjct: 510 LQNI 513

 Score =  114 bits (284), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 82/114 (71%), Gaps = 1/114 (0%)

Query: 229 QLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDR 288
           + +N IKQ+LTPE+N++Y++L  NFQ+R T+IKE+  FLKQ++ R   E+NK       +
Sbjct: 136 KFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKEREAFLKQNVDRLEQEINKQTDEGTKQ 195

Query: 289 VKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTS 342
            +LE+KK EL+++ K + I+YT L+  +QN KK+FY+ CAR NP L + LQ+++
Sbjct: 196 -QLEEKKNELLNDWKVLKIEYTKLFNSYQNSKKTFYVECARHNPALHKFLQEST 248

 Score = 80.1 bits (196), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/67 (59%), Positives = 49/67 (73%), Gaps = 2/67 (2%)

Query: 52  QSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYD--NFNKQRQQA 109
           Q+  LQ +QL E+ AKF+ L+ EA+ VGE T RGKEL+ QA KIKQ+YD    NK+RQQA
Sbjct: 29  QNLTLQPRQLQEMTAKFRALLIEARNVGETTPRGKELMFQAAKIKQVYDALTLNKRRQQA 88

Query: 110 IQAYKRA 116
            QAYK A
Sbjct: 89  AQAYKNA 95

>AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR145W
           (TAF12)
          Length = 554

 Score =  223 bits (569), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 127/165 (76%)

Query: 566 IFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQR 625
           IFKQ  P +PI E++T     ++ YR+NRPT+T G+AMN S L  PV+TKLPPYE+D++R
Sbjct: 358 IFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDSER 417

Query: 626 VMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSL 685
           VM KRKL+E            ET + GDVEE LLDLAD+F+T+VT+FAC++AKHRKSD+L
Sbjct: 418 VMSKRKLRELVKTVGIDDGDGETTVDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 477

Query: 686 DVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQKLNSLN 730
           DV DIQLHLE+NWNIRIP Y+ D IRS++KWNPT +Y+QKL  ++
Sbjct: 478 DVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGIS 522

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 66/114 (57%)

Query: 230 LANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDRV 289
           +A+ IK LLTP+Q + Y++L   F     NI  +++FLK++I     E+       +   
Sbjct: 158 VASNIKMLLTPQQREAYEKLTQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVK 217

Query: 290 KLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTSH 343
           +LE KK EL++ L  ++ Q+  L ++FQ  KK FYI CA  N NL++ LQ TS 
Sbjct: 218 QLETKKNELLTKLTGLNTQFQALPKKFQEDKKKFYIECAATNVNLKKFLQATSQ 271

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 10/68 (14%)

Query: 47  QLTPNQSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFNKQR 106
           QLTP  S+M Q      L  KF+ LV+EA++VG  T  G ELL +A  IK IY+ ++  R
Sbjct: 74  QLTP--SSMRQ------LAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETYH--R 123

Query: 107 QQAIQAYK 114
           QQA QA++
Sbjct: 124 QQAQQAFQ 131

>Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar to
           Ashbya gossypii AGL195C
          Length = 529

 Score =  220 bits (560), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 123/161 (76%)

Query: 566 IFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQR 625
           IFKQ  P +PI E ++     ++ YR+NRPT+TGG+AMN + L TPV+TKLPPYE+D++R
Sbjct: 329 IFKQPNPSIPIPESVSPISTTSVSYRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDSER 388

Query: 626 VMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSL 685
           VM KRKL+E            ET I GDVEE LLDLAD+F+T+VT+FAC++AKHRKSD+L
Sbjct: 389 VMSKRKLRELVKSVGIDDGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 448

Query: 686 DVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQKL 726
           DV DIQLHLE+NWNIR P YS D IRS++KWN T +Y QK+
Sbjct: 449 DVRDIQLHLERNWNIRTPGYSADEIRSTKKWNSTPAYGQKM 489

 Score = 84.0 bits (206), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 72/115 (62%), Gaps = 2/115 (1%)

Query: 230 LANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAEL-NKPNIPALDR 288
           +A+ IK LL P+Q + Y++L   F   A NIK +++FLK++I     E+ N+ + P   R
Sbjct: 129 VASNIKMLLNPQQREAYERLTQTFNESAKNIKGEYEFLKKNIEVLDTEIKNRQSEPITVR 188

Query: 289 VKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTSH 343
            +LE KK EL+  L +++ Q+ TL ++FQ  KK FYI CA  N NL++ LQ TS 
Sbjct: 189 -QLESKKNELLMKLTSLNTQFQTLPKKFQEDKKKFYIECAATNMNLKKFLQATSQ 242

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 31/52 (59%)

Query: 52  QSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFN 103
           Q   L    L +L  KF  LV+EA++VG  T  G ELL +A K+K IY+ +N
Sbjct: 11  QVPQLTPPSLQQLAYKFTTLVDEAQRVGVQTPEGLELLKKASKVKAIYETYN 62

>KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {ON}
           Anc_8.323 YDR145W
          Length = 508

 Score =  211 bits (536), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 93/164 (56%), Positives = 121/164 (73%)

Query: 566 IFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQR 625
           IFK++EP +PI E + T  P  + Y+ NRPT+TGG+ MN   LNTPV  K+P YE DT R
Sbjct: 323 IFKESEPSVPIPESIDTVQPAQVAYKVNRPTITGGSGMNAPALNTPVNVKIPVYEADTDR 382

Query: 626 VMLKRKLKEXXXXXXXXXXXXETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSL 685
           V+ KRKL+E            ETV+ GDVE+ LLDLAD+FV+ VT FAC++AKHR SDSL
Sbjct: 383 VLSKRKLRELVRTVGVDEGDGETVMDGDVEQLLLDLADDFVSDVTAFACRLAKHRGSDSL 442

Query: 686 DVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQKLNSL 729
           +  D+QLHLE+NWNIR+P Y+ D IRS+RKWN T++Y+QKLN++
Sbjct: 443 EARDVQLHLERNWNIRLPGYATDEIRSTRKWNGTSAYHQKLNAI 486

 Score =  102 bits (254), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 84/116 (72%), Gaps = 7/116 (6%)

Query: 229 QLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDR 288
           QLA  ++Q LTPEQ +QYD++ TNFQ +A +I++KH++LKQ+I + TAE+NK      DR
Sbjct: 114 QLAMAMRQALTPEQVQQYDKIATNFQNKAKSIRDKHNYLKQNIDKLTAEINKQQ----DR 169

Query: 289 V---KLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKT 341
               +L +K+ EL+ +++ +++++ +L   FQ  +K+FY+ CA+ NP LQ++LQ+T
Sbjct: 170 SAKQQLAEKRNELLRSVRQLTVEHNSLKVNFQLSRKNFYVECAKLNPKLQQILQRT 225

 Score = 61.2 bits (147), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%)

Query: 53  SAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNF 102
           SA   Q+QL+EL  +FKL V EAK+VGE T  GK+LL++A KIK +YD+ 
Sbjct: 22  SASTPQQQLVELAQRFKLFVGEAKRVGETTEAGKQLLVRAAKIKAVYDSV 71

>TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {ON}
           Anc_8.323 YDR145W
          Length = 405

 Score =  118 bits (296), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 81/113 (71%), Gaps = 1/113 (0%)

Query: 619 YEIDTQRVMLKRKLKEXXXXXXXXXXXXETV-IGGDVEEALLDLADNFVTSVTTFACKIA 677
           YE++++RV+ KRKL+E            + + I GDVEE LLD+AD FV+++T+F+C+++
Sbjct: 274 YELNSERVLSKRKLRELVRSVSIDEHDEKDLSIDGDVEELLLDMADEFVSNITSFSCRLS 333

Query: 678 KHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQKLNSLN 730
           +HR S+ ++  DIQLH+E+NWNIR+P ++ D I+S++KW  +  Y   LNS+N
Sbjct: 334 RHRNSNMVNKRDIQLHVERNWNIRVPGFNADEIKSAKKWQSSNVYMHYLNSVN 386

 Score = 82.8 bits (203), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 72/113 (63%), Gaps = 5/113 (4%)

Query: 230 LANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELN-KPNIPALDR 288
           L+  IK  LTPEQN+ Y+ L+ +FQ+RA  IK +H  +K+ I   +  LN K N    ++
Sbjct: 107 LSMMIKNALTPEQNESYETLLKDFQIRAAKIKREHSDVKEKIDNISKLLNSKTN----NQ 162

Query: 289 VKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKT 341
             L  K+ E +  LK +S  YT L+Q+FQN KK+FY+  A+QN  LQ++LQ++
Sbjct: 163 EALTAKRNEYLFQLKKLSKDYTELHQQFQNEKKNFYLKSAKQNSELQKVLQES 215

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%), Gaps = 1/51 (1%)

Query: 50 PNQSAMLQQKQLMELVAKFKLLVNEAK-KVGENTARGKELLMQAGKIKQIY 99
           N S   QQKQL EL   FK L+ +AK   G+ T +GKELL++A K+K+++
Sbjct: 4  SNPSLAQQQKQLNELAENFKNLIKDAKLNGGDTTEKGKELLIKATKVKKLF 54

>Kpol_448.14 s448 (28880..32851) [3972 bp, 1323 aa] {ON}
           (28880..32851) [3972 nt, 1324 aa]
          Length = 1323

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 683 DSLDVGDIQLHLEKNWNIRIPSYSMDVIRSSR--KWNPTASYNQKLNSLN 730
           D  D+G+  LH + ++N+  PS+S+    S+    W PT   N     LN
Sbjct: 709 DEEDIGNYHLHFDHDFNLAYPSHSLSRTMSTNYLSWQPTIGRNSTFVGLN 758

>TBLA0B06640 Chr2 complement(1560057..1562246) [2190 bp, 729 aa]
           {ON} Anc_5.161 YJL012C
          Length = 729

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 44/84 (52%), Gaps = 16/84 (19%)

Query: 260 IKEKH--DFLKQHISRYTAELNKPNIPALDRVKLEKKK----VELMSNLKAISIQYTTLY 313
           +KEK+  DF+K    +YTA+         D+++ EKKK    +E + +L AI IQY  L 
Sbjct: 299 LKEKYINDFVK---GKYTAQ------KVFDKIRREKKKSPKEIESLESL-AIEIQYAMLK 348

Query: 314 QEFQNGKKSFYIACARQNPNLQRL 337
           +  +   +SFY   A Q P   R+
Sbjct: 349 KRLRPVVRSFYNRTAFQLPGDARV 372

>TPHA0A04670 Chr1 complement(1057175..1059379) [2205 bp, 734 aa]
           {ON} Anc_5.161 YJL012C
          Length = 734

 Score = 32.3 bits (72), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 42/84 (50%), Gaps = 16/84 (19%)

Query: 260 IKEKH--DFLKQHISRYTAELNKPNIPALDRVKLEKKK----VELMSNLKAISIQYTTLY 313
           +KE H  DFLK    RYTAE       A  ++  E KK    +E +  L AI IQYT L 
Sbjct: 296 LKEPHVNDFLK---GRYTAE------QAFAKMYREGKKSIKEIESLEAL-AIEIQYTMLK 345

Query: 314 QEFQNGKKSFYIACARQNPNLQRL 337
           ++ +   +SFY   A Q P   R+
Sbjct: 346 KKLRPVVRSFYNRTAFQLPGDARV 369

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.125    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,819,393
Number of extensions: 1887338
Number of successful extensions: 10695
Number of sequences better than 10.0: 59
Number of HSP's gapped: 11004
Number of HSP's successfully gapped: 100
Length of query: 752
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 635
Effective length of database: 40,065,477
Effective search space: 25441577895
Effective search space used: 25441577895
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)