Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A039308.322ON26626614050.0
TPHA0C008208.322ON2662735252e-65
TDEL0F044808.322ON2602675137e-64
Kpol_1036.688.322ON2562595015e-62
YLR128W (DCN1)8.322ON2692574894e-60
SAKL0H15576g8.322ON2822634696e-57
ZYRO0F10362g8.322ON2512624536e-55
KAFR0H022708.322ON2682654461e-53
NDAI0G025908.322ON2862894471e-53
Kwal_56.239148.322ON2652614312e-51
KNAG0G024408.322ON2652644155e-49
CAGL0M04257g8.322ON2732694112e-48
AGL194C8.322ON2562614042e-47
KLLA0D16346g8.322ON3012684011e-46
Ecym_42538.322ON2582583814e-44
KLTH0G12320g8.322ON2542523806e-44
Suva_10.2218.322ON1781783641e-42
Skud_12.1978.322ON1791793562e-41
NCAS0C032708.322ON1841843311e-37
Smik_12.1918.322ON1251262643e-28
ABR211C7.377ON38941880.013
Smik_15.4568.725ON42873850.030
KNAG0H019902.288ON97377770.35
TDEL0C017007.377ON39041750.51
KLTH0C07040g7.377ON38586740.74
SAKL0G01320g5.648ON70296730.90
Kwal_YGOB_Anc_7.3777.377ON38444721.1
TBLA0C051507.377ON42845721.3
Skud_8.2604.359ON58078711.5
Ecym_46987.377ON39438711.5
SAKL0F12078g7.377ON38542692.7
YBR199W (KTR4)8.541ON46499684.2
ZYRO0B03014g7.377ON40143674.2
NCAS0F022105.41ON745110684.6
ZYRO0A06116g8.735ON109173676.0
Ecym_64252.71ON75364667.1
NCAS0H026405.543ON64841667.9
CAGL0A04345g7.377ON39247659.4
TDEL0B025205.671ON811115659.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A03930
         (266 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.32...   545   0.0  
TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 ...   206   2e-65
TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa...   202   7e-64
Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 ...   197   5e-62
YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {...   192   4e-60
SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa] ...   185   6e-57
ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 a...   179   6e-55
KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON...   176   1e-53
NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON...   176   1e-53
Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W...   170   2e-51
KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.32...   164   5e-49
CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} simila...   162   2e-48
AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, ...   160   2e-47
KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 3...   159   1e-46
Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa] ...   151   4e-44
KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315) ...   150   6e-44
Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W...   144   1e-42
Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W...   141   2e-41
NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON...   132   1e-37
Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W...   106   3e-28
ABR211C Chr2 complement(800856..802025) [1170 bp, 389 aa] {ON} S...    39   0.013
Smik_15.456 Chr15 (787294..788580) [1287 bp, 428 aa] {ON} YOR274...    37   0.030
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...    34   0.35 
TDEL0C01700 Chr3 (297260..298432) [1173 bp, 390 aa] {ON} Anc_7.3...    33   0.51 
KLTH0C07040g Chr3 (611631..611723,611832..612896) [1158 bp, 385 ...    33   0.74 
SAKL0G01320g Chr7 complement(110958..113066) [2109 bp, 702 aa] {...    33   0.90 
Kwal_YGOB_Anc_7.377 s27 (549860..549952,550053..551114) [1155 bp...    32   1.1  
TBLA0C05150 Chr3 complement(1247347..1248633) [1287 bp, 428 aa] ...    32   1.3  
Skud_8.260 Chr8 (457563..459305) [1743 bp, 580 aa] {ON} YHR194W ...    32   1.5  
Ecym_4698 Chr4 (1366090..1367274) [1185 bp, 394 aa] {ON} similar...    32   1.5  
SAKL0F12078g Chr6 complement(940018..941082,941150..941242) [115...    31   2.7  
YBR199W Chr2 (618909..620303) [1395 bp, 464 aa] {ON}  KTR4Putati...    31   4.2  
ZYRO0B03014g Chr2 complement(244268..245473) [1206 bp, 401 aa] {...    30   4.2  
NCAS0F02210 Chr6 (440848..443085) [2238 bp, 745 aa] {ON} Anc_5.4...    31   4.6  
ZYRO0A06116g Chr1 (487142..490417) [3276 bp, 1091 aa] {ON} simil...    30   6.0  
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    30   7.1  
NCAS0H02640 Chr8 complement(521008..522954) [1947 bp, 648 aa] {O...    30   7.9  
CAGL0A04345g Chr1 complement(429936..431114) [1179 bp, 392 aa] {...    30   9.4  
TDEL0B02520 Chr2 (455189..457624) [2436 bp, 811 aa] {ON} Anc_5.6...    30   9.5  

>TBLA0A03930 Chr1 (982960..983760) [801 bp, 266 aa] {ON} Anc_8.322
           YLR128W
          Length = 266

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/266 (100%), Positives = 266/266 (100%)

Query: 1   MMASDQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKIL 60
           MMASDQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKIL
Sbjct: 1   MMASDQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKIL 60

Query: 61  GIEYVRPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPIL 120
           GIEYVRPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPIL
Sbjct: 61  GIEYVRPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPIL 120

Query: 121 LSNFIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSET 180
           LSNFIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSET
Sbjct: 121 LSNFIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSET 180

Query: 181 AQEYWDLFFACQNYPIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQ 240
           AQEYWDLFFACQNYPIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQ
Sbjct: 181 AQEYWDLFFACQNYPIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQ 240

Query: 241 RKYSEDSAWPYIFDEYYEYLEDNNKI 266
           RKYSEDSAWPYIFDEYYEYLEDNNKI
Sbjct: 241 RKYSEDSAWPYIFDEYYEYLEDNNKI 266

>TPHA0C00820 Chr3 complement(162176..162973,163105..163107) [801 bp,
           266 aa] {ON} Anc_8.322 YLR128W
          Length = 266

 Score =  206 bits (525), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 108/273 (39%), Positives = 163/273 (59%), Gaps = 20/273 (7%)

Query: 5   DQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKILGIEY 64
           D  ++EF  L +S    A+KYL  N W L YALN+FYD E+G F + D+ R       EY
Sbjct: 2   DSIVREFQQLTSSSNKVARKYLSGNDWNLNYALNEFYDQELGGF-VHDVPR-------EY 53

Query: 65  VRPLTELYNHYAIDSGVLGT-----------EGLVKLVDDLGYTVDHLVTLCLAKLVGCI 113
              L EL+  Y     V G+           +GL++ ++DLGY ++ L TLCLA ++GC 
Sbjct: 54  PAELIELFERYNNQKYVDGSSGNEEDVGIDADGLIQFIEDLGYELEDLTTLCLANVMGCN 113

Query: 114 HFTTPILLSNFIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGK 173
           + T  I  + F+++    KC +++DIK+ L      L+++  Y+T+IY+  F L+ EE  
Sbjct: 114 NLTDCITRNQFLEAWYNKKCSNIKDIKDELETVGENLRSDINYFTYIYNYSFGLITEENM 173

Query: 174 KTIDSETAQEYWDLFFACQNYPIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKF 233
           K+I  +TA+EYW LFF     P+ ++ +Q   W K+L+ +  K ITKD+W M+L FFKKF
Sbjct: 174 KSIQIDTAKEYWKLFFG-DGTPLHIEKEQLDNWNKFLTISGKKTITKDEWKMILEFFKKF 232

Query: 234 PSLSELQRKYSEDSAWPYIFDEYYEYLEDNNKI 266
           P+++E + +Y     WPYI DEY+EYLE+N K+
Sbjct: 233 PTVTEFKDEYDPMDPWPYIMDEYHEYLEENGKL 265

>TDEL0F04480 Chr6 (840526..840528,840597..841376) [783 bp, 260 aa]
           {ON} Anc_8.322 YLR128W
          Length = 260

 Score =  202 bits (513), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 104/267 (38%), Positives = 157/267 (58%), Gaps = 8/267 (2%)

Query: 1   MMASDQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKIL 60
           M   D  + EF+SL   +  TA+ +L+RN+W+LEYALND+YD   G F+      +    
Sbjct: 1   MPQKDDLVSEFVSLTQCESKTAKDFLRRNQWKLEYALNDYYDQMPGGFI------EEPHT 54

Query: 61  GIEYVRPLTELYNHYAI-DSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPI 119
            + Y   L  LY+ Y + D   +  +G+++L++DL Y ++ LVT+CLAKL+ C      I
Sbjct: 55  PVTYPEELLALYDKYVLEDQNKIDIDGMIQLIEDLDYKLEDLVTICLAKLLHCTRLADGI 114

Query: 120 LLSNFIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSE 179
               F+ +     C +L  ++++L++ D KL T+ EY T IY+  F+L L++ K+ +D++
Sbjct: 115 SKDQFLHNWYMQGCSTLPQMRHVLDDLDTKLHTDLEYMTDIYNYTFDLALDQNKRDLDTD 174

Query: 180 TAQEYWDLFFACQNYPIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSEL 239
           TA EYW LFF      + V       W  +L +     +T+D W MLL FFK+FPSLS +
Sbjct: 175 TAAEYWRLFFQ-PGTAVHVNPALLNSWLAFLDSEQKTVVTRDTWKMLLEFFKQFPSLSAV 233

Query: 240 QRKYSEDSAWPYIFDEYYEYLEDNNKI 266
           +  Y+E  AWPYI DEYYEYLED+  I
Sbjct: 234 KTSYNEADAWPYIIDEYYEYLEDSRLI 260

>Kpol_1036.68 s1036 (188159..188161,188259..189026) [771 bp, 256 aa]
           {ON} (188159..188161,188259..189026) [771 nt, 257 aa]
          Length = 256

 Score =  197 bits (501), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 103/259 (39%), Positives = 160/259 (61%), Gaps = 9/259 (3%)

Query: 9   KEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKILGIEYVRPL 68
           +EF+ L N D   A KYLKRN W L YALN++YD E+GSFL+++          EY   L
Sbjct: 6   EEFIGLTNCDKKVATKYLKRNNWNLNYALNEYYDKEVGSFLVEEEVI-------EYPEEL 58

Query: 69  TELYNHYAIDSG-VLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSNFIDS 127
            +++  Y+ D+G  + T+G ++L++DL Y ++ +VT+CLA+L+ C   + PI    F+ +
Sbjct: 59  IQIFKKYSNDNGESIDTDGFIQLINDLDYQLEDIVTICLAELMHCKSLSLPITKDQFLST 118

Query: 128 LKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQEYWDL 187
                C  L+ +K LL++ D+KL+ +  YYT IY   F+L+ +  +K I+ + A EYW L
Sbjct: 119 WYEQGCSQLKHMKILLDDLDHKLQNDIRYYTHIYRYSFDLIRDSNEKCIEKDMAIEYWKL 178

Query: 188 FFACQNYPIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQRKYSEDS 247
           FF+ +  PI +   Q   W ++++   I+ IT+D W  LL +FKK+P+L  L + Y+E  
Sbjct: 179 FFSSKC-PITINELQLNSWIEFINVNEIESITRDVWERLLEYFKKYPTLEILSKNYNELD 237

Query: 248 AWPYIFDEYYEYLEDNNKI 266
            WPYI DEYYE+LED  +I
Sbjct: 238 PWPYIMDEYYEFLEDTKRI 256

>YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {ON}
            DCN1Scaffold-type E3 ligase required for cullin
           neddylation and ubiquitin ligase activation; contains a
           ubiquitin-binding domain (UBA) for ubiquitin and Nedd8
           (Rub1p) interaction and a PONY domain involved in cullin
           binding and neddylation
          Length = 269

 Score =  192 bits (489), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 93/257 (36%), Positives = 158/257 (61%), Gaps = 5/257 (1%)

Query: 6   QTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKILGIEYV 65
           + ++ F SL   D   ++KYL+RN W + YALND+YD EIG+F  +     +  +   Y 
Sbjct: 16  EAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTDEVSTVAHPPV---YP 72

Query: 66  RPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSNFI 125
           + LT+++ HY I++ +   + LVK +++LGY ++ L TLCLA L+G      P+   +F+
Sbjct: 73  KELTQVFEHY-INNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKKLEEPLKREDFL 131

Query: 126 DSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQEYW 185
            +     C ++ D++  +   D KL  + +Y+T IY+  FNL+L+  +K ID++   +YW
Sbjct: 132 STWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRKDIDTDEGIQYW 191

Query: 186 DLFFACQNYPIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQRKYSE 245
            LFF  + YP++++ D  + WF++L +     I+KD W MLL FFK++P++ ++   Y E
Sbjct: 192 KLFFQPE-YPVRMEPDLLEAWFRFLRDEGKTTISKDTWRMLLLFFKRYPTIQKIISDYDE 250

Query: 246 DSAWPYIFDEYYEYLED 262
            +AWP+I DE+YE L+D
Sbjct: 251 TAAWPFIIDEFYECLQD 267

>SAKL0H15576g Chr8 complement(1356651..1357499) [849 bp, 282 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 282

 Score =  185 bits (469), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 94/263 (35%), Positives = 151/263 (57%), Gaps = 9/263 (3%)

Query: 1   MMASDQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKIL 60
           M    +T+ EFMSL N    TA KYL RN W L YALN++YD + G F+       NK  
Sbjct: 23  MAQPKETINEFMSLTNCTKDTATKYLSRNSWALSYALNEYYDKKQGGFV-------NK-K 74

Query: 61  GIEYVRPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPIL 120
            ++Y   L E ++ YA     +  E L+K ++DLGY ++ L T+CLA+L+ C      I 
Sbjct: 75  PVKYSHELVETFDKYADSKRCITVENLMKYIEDLGYCLEDLATICLAELLKCEKIDKDIT 134

Query: 121 LSNFIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSET 180
              F+ S   + C+++  +K+ L + + +L  + +Y++ IY+  ++L++EE ++ ++ +T
Sbjct: 135 EQQFLSSWTEHGCKNMIHMKHELQDLEEQLHQDQDYFSHIYNYTYDLIVEESERHLNIDT 194

Query: 181 AQEYWDLFFACQNYPIKVQSDQYQQWFK-YLSNANIKEITKDQWAMLLRFFKKFPSLSEL 239
           A EYW+LFF   +Y + +   + + W + Y   +    +TKD W M L+F  KFP    L
Sbjct: 195 AAEYWELFFHNSHYAVTISDSRLKTWIEFYTKKSGRSTVTKDTWTMFLKFIIKFPDDESL 254

Query: 240 QRKYSEDSAWPYIFDEYYEYLED 262
            R Y E  AWP +FDEYYEY+++
Sbjct: 255 IRGYDEMDAWPLVFDEYYEYMDE 277

>ZYRO0F10362g Chr6 (840411..840413,840483..841235) [756 bp, 251 aa]
           {ON} similar to uniprot|Q12395 Saccharomyces cerevisiae
           YLR128W DCN1 Hypothetical ORF
          Length = 251

 Score =  179 bits (453), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 96/262 (36%), Positives = 147/262 (56%), Gaps = 18/262 (6%)

Query: 8   LKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKILGIEYVRP 67
           +  F SLA     TA+ YL  + W +  ALND+YD+E      QD +         Y   
Sbjct: 5   VATFKSLAQCSDRTARDYLNTHNWDVNQALNDYYDSEHD----QDQS---------YSPE 51

Query: 68  LTELYNHYAIDSG---VLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSNF 124
           L +L+  YA+ +    ++ T+GL++ + DLGY +D+L T+CLA+L+ C   T  I    F
Sbjct: 52  LPQLFRKYAVVTPHGFIMDTDGLIRYIGDLGYEIDNLATICLAQLLHCQRLTDGITEGQF 111

Query: 125 IDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQEY 184
             + + N C SL  +  L+   D+KL+T+ +Y   IY+  F L L+ G KT+++ TA +Y
Sbjct: 112 SYNWQQNGCTSLHQMGKLVQRLDHKLRTDQDYTAQIYNYTFELALDPGAKTLETHTAVQY 171

Query: 185 WDLFFACQNYPIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQRKYS 244
           W LFFA   YP+ V+   +Q W  ++     + I++D W ML  FF +F +L  ++  Y+
Sbjct: 172 WTLFFATGQYPVIVEQQFFQLWISFVQQE--QSISRDTWRMLFPFFNRFSNLQSVRDNYN 229

Query: 245 EDSAWPYIFDEYYEYLEDNNKI 266
           E  AWPYI DE+YEYL D  +I
Sbjct: 230 EADAWPYIIDEFYEYLADKGEI 251

>KAFR0H02270 Chr8 complement(434219..435025) [807 bp, 268 aa] {ON}
           Anc_8.322 YLR128W
          Length = 268

 Score =  176 bits (446), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 88/265 (33%), Positives = 157/265 (59%), Gaps = 6/265 (2%)

Query: 5   DQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKILGIEY 64
           ++ +  F+     + + A+KYL +N+W + YALNDFYD+E+G F  ++  R N+     Y
Sbjct: 7   EEAIVHFIGFTQCEPAMARKYLSKNRWNINYALNDFYDSELGGF-TKEHERSNR--RAVY 63

Query: 65  VRPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSNF 124
            + L +L+  Y  +   +  +G++KL+ D G  ++ L T+CLA ++   +    I   +F
Sbjct: 64  PKELVQLFRDYCSEDTYIDFQGMIKLIKDCGLAIEDLATICLAHILHWENLQDKIYRDDF 123

Query: 125 IDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKK--TIDSETAQ 182
           +  L    C ++ DIK +L + + KL T+  Y+T IY+  F L+L++  +  +ID + A 
Sbjct: 124 LQYLFEQGCCTVNDIKVVLKDLNEKLNTDPTYFTTIYNFSFGLILDDDTRNQSIDMDIAI 183

Query: 183 EYWDLFFACQNY-PIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQR 241
           EYW LFF  ++   +++ ++    WF++L++   K+++KD W M+L FF+KF  L  L+ 
Sbjct: 184 EYWKLFFLNESIQSVEISNELLSLWFQFLADERKKQVSKDIWQMILEFFRKFKDLESLKE 243

Query: 242 KYSEDSAWPYIFDEYYEYLEDNNKI 266
            Y E+  WP++ DE+YEYL+D  K+
Sbjct: 244 SYDENDPWPFVIDEFYEYLQDTGKL 268

>NDAI0G02590 Chr7 complement(594115..594975) [861 bp, 286 aa] {ON}
           Anc_8.322 YLR128W
          Length = 286

 Score =  176 bits (447), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 104/289 (35%), Positives = 157/289 (54%), Gaps = 48/289 (16%)

Query: 22  AQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKILGIEYVRP--------LTELYN 73
           A+KYL RN WRL YALN++YD EIGSF+      D+   G + + P        L  L+ 
Sbjct: 2   AKKYLSRNNWRLNYALNEYYDKEIGSFI----GDDDDDDGCKTILPDLNKYPQELIALFK 57

Query: 74  HYAIDSG-----VLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSNFIDSL 128
            Y+  +       +  +GL+  ++DL Y ++ LVT+CLAKL+ C +    I    F+ + 
Sbjct: 58  KYSSKNNDSLYEFIDVDGLINYINDLKYNLEDLVTICLAKLLHCENLKDGINKQQFLSNW 117

Query: 129 KANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLE--EGKKT----------- 175
               C +LE ++++LN+ D KL  +  Y+T IY+  F+L+++  +G  T           
Sbjct: 118 YLQGCSTLEQMQHVLNDLDVKLHQDASYFTQIYNYTFDLIIDVDDGDSTRNNTNIGDDTT 177

Query: 176 -----------------IDSETAQEYWDLFFAC-QNYPIKVQSDQYQQWFKYLSNANIKE 217
                            +D ETA  YW +FF   + YP+KV  +    WF++L+    KE
Sbjct: 178 NSNDTSIVIVPRMKDNNLDVETAIAYWKVFFNVNEQYPVKVNKELLSLWFQFLNEERKKE 237

Query: 218 ITKDQWAMLLRFFKKFPSLSELQRKYSEDSAWPYIFDEYYEYLEDNNKI 266
           ITKDQW MLL FFKKF +L  +++ Y E +AWPY+ DE+YEYL+D  +I
Sbjct: 238 ITKDQWQMLLEFFKKFSNLEMMKQNYDETAAWPYMIDEFYEYLQDTGRI 286

>Kwal_56.23914 s56 (773777..774574) [798 bp, 265 aa] {ON} YLR128W -
           Hypothetical ORF [contig 171] FULL
          Length = 265

 Score =  170 bits (431), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 92/261 (35%), Positives = 141/261 (54%), Gaps = 10/261 (3%)

Query: 1   MMASDQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKIL 60
           M+  D+ ++EF++L       AQ++L  N W L+YALND+YD   G F   D     ++L
Sbjct: 8   MLQRDRDVEEFVALTKCSKKIAQQFLSNNNWALDYALNDYYDTVHGGFTTDDRPYSPELL 67

Query: 61  GIEYVRPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPIL 120
            +           + + D   +   GL + ++DLG  ++  VTLCLA+L+ C      I 
Sbjct: 68  KV--------FQKYKSEDKNSITMIGLTRFIEDLGLELEDPVTLCLAELMECSSLQEDIS 119

Query: 121 LSNFIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSET 180
           +  FI S     C +  D+K  + E + KL+T+  Y+  IY+  F L LE  +K +  ET
Sbjct: 120 MDTFIQSWHDRLCENFNDMKLHVKELEKKLRTDVSYFESIYNYTFTLALEPQQKQLGLET 179

Query: 181 AQEYWDLFFA-CQNYPIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSEL 239
           +  YW+L F+  + Y IKV  ++ Q W +YLS   + ++ +D W M L+F   FP    L
Sbjct: 180 SIAYWELLFSPAKPYAIKVPQERLQSWIQYLS-GEVAKVHRDVWKMFLKFAVAFPDNEAL 238

Query: 240 QRKYSEDSAWPYIFDEYYEYL 260
           ++ YSED AWP + DEYYEYL
Sbjct: 239 KKGYSEDDAWPLVIDEYYEYL 259

>KNAG0G02440 Chr7 (556204..557001) [798 bp, 265 aa] {ON} Anc_8.322
           YLR128W
          Length = 265

 Score =  164 bits (415), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 87/264 (32%), Positives = 152/264 (57%), Gaps = 10/264 (3%)

Query: 5   DQTLKEFMSLAN-SDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFL--IQDLARDNKILG 61
           +  + +F+ L    D   A++YL+ + W + YALNDFYD E+G+F    +D+ +DN +  
Sbjct: 3   EDAIHDFIELTQCRDRKKAERYLRESHWNVNYALNDFYDKEVGNFFSTYKDVPQDNVV-- 60

Query: 62  IEYVRPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILL 121
             Y   L  +++ Y+ ++GV+  EG++  + DL  ++D LVT+CLA+L+G  +   PI  
Sbjct: 61  --YPPELIHVFDQYS-EAGVITFEGMITYIGDLSLSIDDLVTICLAQLLGWENLLAPITR 117

Query: 122 SNFIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETA 181
             F+       C ++ ++K +L + + KL+ +  Y+  IY   F LL+E  +  +D+ + 
Sbjct: 118 EQFLAQWFLQGCSTINEMKTVLADLNGKLEKDRGYFKEIYMYTFPLLVEPDQNKLDAAST 177

Query: 182 QEYWDLFFACQ-NYPIKVQSDQYQQWFKYLS-NANIKEITKDQWAMLLRFFKKFPSLSEL 239
            EYW LFF  +  YP+ +  +    WF YL   +    +T+D W M+ +FF +F SL ++
Sbjct: 178 IEYWKLFFDQEKKYPMIIDQELLDPWFVYLGEQSENMSVTEDIWKMVYQFFNRFRSLGDV 237

Query: 240 QRKYSEDSAWPYIFDEYYEYLEDN 263
           ++ Y E +AWP + DE+ EYL+D 
Sbjct: 238 KQGYDEMAAWPILIDEFIEYLQDT 261

>CAGL0M04257g Chr13 (467785..468606) [822 bp, 273 aa] {ON} similar
           to uniprot|Q12395 Saccharomyces cerevisiae YLR128w
          Length = 273

 Score =  162 bits (411), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 96/269 (35%), Positives = 146/269 (54%), Gaps = 15/269 (5%)

Query: 6   QTLKEFMSLAN-SDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKILGIEY 64
           + +K F SL + +D   A++YL  N W + YALN++YD E+G F    + R       +Y
Sbjct: 8   ELMKTFQSLTSCTDEGKAKRYLSANNWNINYALNEYYDKEVGGFTEDHMIRHQ----FKY 63

Query: 65  VRPLTELYNHYAI-----DSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPI 119
              L  L+ HYA       +  +  +GL+  + DLGY ++ LVT+ LA  + C +   PI
Sbjct: 64  PDELVSLFGHYAALIEEDGTQSITPDGLIDYIQDLGYNLEDLVTISLAHFLQCKNLENPI 123

Query: 120 LLSNFIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSE 179
               F+       C +LE +++ L + + KL  + +Y+T IY+  F+L   + +  ++++
Sbjct: 124 TEKQFLYFWYNEGCYTLEQMRHYLEDCERKLCNDWKYFTTIYNYSFDLNASK-QGVVETD 182

Query: 180 TAQEYWDLFFACQNYP----IKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPS 235
            A EYW LFF          IKV       W K+L + + K I KD W MLL FFKKFPS
Sbjct: 183 IAIEYWKLFFEENRTKLSGIIKVDQAHLDLWCKFLQDEHKKLIHKDTWQMLLLFFKKFPS 242

Query: 236 LSELQRKYSEDSAWPYIFDEYYEYLEDNN 264
           L  ++ +Y+E  AWPY  DE+YEYLE+ N
Sbjct: 243 LDAIKTEYNEADAWPYTIDEFYEYLEERN 271

>AGL194C Chr7 complement(333654..334421,334470..334472) [771 bp, 256
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR128W (DCN1); 1-intron
          Length = 256

 Score =  160 bits (404), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 143/261 (54%), Gaps = 13/261 (4%)

Query: 6   QTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKILGIEYV 65
           + ++EF+++ ++  + A+ YL+RN W L++AL+DFY    G    +           +Y 
Sbjct: 9   ELIREFLAVTSATSAAAETYLERNHWSLDHALDDFYTQSGGGGRAE-----------QYS 57

Query: 66  RPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSNFI 125
             L   +  YA   G + TE LV+ V DLG+ ++ + TLCLA+L+     T  I    F+
Sbjct: 58  AELVATFERYAA-GGAMDTEALVRYVGDLGFQLEDVATLCLARLLKVEELTADISRFQFL 116

Query: 126 DSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQEYW 185
            +     C SL D++  ++  + +L+T+  Y+  +Y   F L L+ G + +  ETA  YW
Sbjct: 117 STWHGLGCSSLPDMRAAVDALELRLRTDAAYFRALYAYTFGLGLDAGGRRLSVETAIAYW 176

Query: 186 DLFFACQNYPIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQRKYSE 245
            LFF    Y + V + + + WF++L  A    +++D W M  RF ++FP  +EL   Y+E
Sbjct: 177 SLFFLDHTYAVTVPAPRLRSWFEFL-RAGDHSVSRDTWDMFPRFAQRFPDDTELLEHYNE 235

Query: 246 DSAWPYIFDEYYEYLEDNNKI 266
            ++WP + DEYYE+++  N++
Sbjct: 236 LASWPLVIDEYYEWVKGRNQL 256

>KLLA0D16346g Chr4 (1375653..1375790,1375880..1376647) [906 bp, 301
           aa] {ON} similar to uniprot|Q12395 Saccharomyces
           cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 301

 Score =  159 bits (401), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 86/268 (32%), Positives = 151/268 (56%), Gaps = 24/268 (8%)

Query: 9   KEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDN--EIGSFLIQDLARDNKILGIEYVR 66
           KEFM+L     S AQ+YL++N  R+EYALND+YDN   IG             +   Y  
Sbjct: 48  KEFMNLTGCTYSVAQEYLRKNGGRVEYALNDYYDNVDTIGG------------MRQSYNP 95

Query: 67  PLTELYNHYAIDSGVLGTE----GLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLS 122
            L  ++  Y+  +GV  TE    GL++ ++DLG +++  +TLCL++++     T P+   
Sbjct: 96  SLVAIFEKYS--NGVSATEWDSSGLIRFIEDLGISIEDPITLCLSQMLCIDDLTKPVSRE 153

Query: 123 NFIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQ 182
            F+++     C +L  +K  L+  + +L+T+ +Y+  IY   F L  +EG + +  + A 
Sbjct: 154 QFLNAWSDLCCDTLRKMKAYLHTLEERLETDKDYFKSIYSYTFPLNTDEGSRHLPKDVAI 213

Query: 183 EYWDLFFACQNYPIKVQSDQYQQWFKYL----SNANIKEITKDQWAMLLRFFKKFPSLSE 238
           EYW++FF    Y +K+  ++   W +++    S+   + I+ D W M  +F +++P+   
Sbjct: 214 EYWNIFFKDNKYALKISKERLNSWLEFINSDDSDPRKQNISNDIWLMFYKFIEQYPNDES 273

Query: 239 LQRKYSEDSAWPYIFDEYYEYLEDNNKI 266
           L++ Y E +AWP + DEYYE+LE+N+K+
Sbjct: 274 LKQNYDEMAAWPLLIDEYYEFLEENDKL 301

>Ecym_4253 Chr4 (526313..526315,526404..527177) [777 bp, 258 aa]
           {ON} similar to Ashbya gossypii AGL194C 1-intron
          Length = 258

 Score =  151 bits (381), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 84/258 (32%), Positives = 138/258 (53%), Gaps = 15/258 (5%)

Query: 8   LKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKILGIE--YV 65
           +K+FMS+ + + +TA+K+L  N+W L+YAL+D Y             R    L  E  Y 
Sbjct: 11  IKQFMSITSMNRATAEKFLNDNRWSLDYALDDLY------------TRGTSYLNTERTYD 58

Query: 66  RPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSNFI 125
             L   + +YA ++G + T+ L+K V DLGY ++  VT+CLA+L+   + T  I    F+
Sbjct: 59  AELYSTFQNYASENGRMDTDTLIKYVTDLGYQLEDPVTICLAQLLKVENLTADIEEEQFL 118

Query: 126 DSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQEYW 185
            +     C +L D+   +N  D KL  +  Y+  IY   F++ ++  ++ +  +TA  YW
Sbjct: 119 STWADLGCSNLNDMSEYMNTLDTKLHEDPVYFKTIYSYTFSIAVDGKRRQLSIDTAISYW 178

Query: 186 DLFFACQNYPIKVQSDQYQQWFKYLSNANIKE-ITKDQWAMLLRFFKKFPSLSELQRKYS 244
            L F   ++  K+   + + WF++L   N    +T+D W ML +F  KFP    L  +YS
Sbjct: 179 TLLFLDHSFATKIPRTRLESWFRFLREQNDANFVTRDTWDMLFKFALKFPDDKTLLSEYS 238

Query: 245 EDSAWPYIFDEYYEYLED 262
           E  AWP I DEYY ++++
Sbjct: 239 EMGAWPLIMDEYYGWIKE 256

>KLTH0G12320g Chr7 complement(1047486..1048247,1048313..1048315)
           [765 bp, 254 aa] {ON} similar to uniprot|Q12395
           Saccharomyces cerevisiae YLR128W DCN1 Hypothetical ORF
          Length = 254

 Score =  150 bits (380), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 127/252 (50%), Gaps = 14/252 (5%)

Query: 5   DQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGSFLIQDLARDNKILGIEY 64
           +Q ++EF++L  +  STA+ YL  N W LEYALNDFYD   G F  +             
Sbjct: 3   NQDIEEFIALTKASRSTARAYLSNNNWALEYALNDFYDTVQGGFTSRPPPPQ-------- 54

Query: 65  VRPLTELYNHYAI-DSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSN 123
              L  L+N Y   +   + T+GL++ + DLG  ++   TLC+A  + C   +  +    
Sbjct: 55  ---LLTLFNEYKKGEEDTISTDGLIRFIGDLGLDLEDPTTLCVADAMHCTSLSQSVSKEM 111

Query: 124 FIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQE 183
           F+     N C +L+ IK  + E D KL+ +  Y+  IY   + L LE  +K +D ETA  
Sbjct: 112 FVQGWHDNLCENLQQIKEKVKELDEKLRRDSAYFEHIYSFTYTLALEPNEKQLDLETAIA 171

Query: 184 YWDLFFACQN-YPIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQRK 242
           YW L F     Y I++   +   W  +L+  N+  I  D W M L+F + FP    L++ 
Sbjct: 172 YWHLLFPTDGAYAIQIPQKRLCSWTAFLTR-NVSRIHHDIWKMFLKFARMFPDNKTLKQG 230

Query: 243 YSEDSAWPYIFD 254
           Y+ED AWP + D
Sbjct: 231 YNEDDAWPVLID 242

>Suva_10.221 Chr10 (407427..407963) [537 bp, 178 aa] {ON} YLR128W
           (REAL)
          Length = 178

 Score =  144 bits (364), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 109/178 (61%), Gaps = 1/178 (0%)

Query: 85  EGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSNFIDSLKANKCRSLEDIKNLLN 144
           + L+K ++DLGY ++ L TLCL  L+G      P+    F+ +     C +L ++K  + 
Sbjct: 2   DSLIKFIEDLGYNLEDLATLCLVHLLGYKKLEEPLDRETFLSAWFMQGCSTLPNMKKCVK 61

Query: 145 EFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQEYWDLFFACQNYPIKVQSDQYQ 204
             D KL  + +Y+T IYD  F+L+L+  +K ID+E A +YW L F  + YPI ++    +
Sbjct: 62  GLDAKLHEDLQYFTEIYDYTFHLILDTNRKDIDTEEAIQYWTLLFQPE-YPIHMEPGLLE 120

Query: 205 QWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQRKYSEDSAWPYIFDEYYEYLED 262
            WF++L +   + ITKD W MLL+FFK++P++  +   Y E +AWP+I DE+YE+L D
Sbjct: 121 AWFRFLHDEGKRTITKDAWHMLLQFFKQYPTIRSIIDDYDEAAAWPFIIDEFYEFLRD 178

>Skud_12.197 Chr12 (381665..382204) [540 bp, 179 aa] {ON} YLR128W
           (REAL)
          Length = 179

 Score =  141 bits (356), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 109/179 (60%), Gaps = 1/179 (0%)

Query: 85  EGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSNFIDSLKANKCRSLEDIKNLLN 144
           + LVK ++DLGY+++ L TLCL  L+G  +   P+    F+ +     C +L D++  + 
Sbjct: 2   DSLVKFIEDLGYSLEDLATLCLVDLLGYKNLEEPLKRETFLSTWFMQGCSTLPDMQGCIK 61

Query: 145 EFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQEYWDLFFACQNYPIKVQSDQYQ 204
             D KL  + +YYT +YD  F L+L+  +K ID + A +YW LFF    YP+ ++S+  +
Sbjct: 62  RLDVKLHEDLQYYTQVYDYAFRLILDSNRKNIDIDDAIQYWTLFFQ-PVYPVHIESNLLE 120

Query: 205 QWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQRKYSEDSAWPYIFDEYYEYLEDN 263
            WF +L +     I+KD W MLL FF+++ ++  +   Y E +AWP+I DE+YEYL+D+
Sbjct: 121 SWFHFLRDEGKTLISKDTWHMLLLFFQQYLTIQSIIDGYDETAAWPFIIDEFYEYLQDH 179

>NCAS0C03270 Chr3 complement(643154..643708) [555 bp, 184 aa] {ON}
           Anc_8.322 YLR128W
          Length = 184

 Score =  132 bits (331), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 68/184 (36%), Positives = 108/184 (58%), Gaps = 3/184 (1%)

Query: 85  EGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSNFIDSLKANKCRSLEDIKNLLN 144
           +GL+  + DLG  ++ LVT+CL  L+ C +    I    F+ +     C  +  +K +L 
Sbjct: 2   DGLMNYMSDLGLDLEDLVTICLTHLLHCKNIKDDITRDQFLGNWFLQGCSDIAQMKQVLV 61

Query: 145 EFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQEYWDLFFACQN--YPIKVQSDQ 202
           + ++KL ++ +Y+  IY+  F L+ +  K  ++ ETA  YW LF   +   +P++V    
Sbjct: 62  DLNDKLHSDKQYFIDIYNYTFGLITDPDKD-LEVETAVAYWKLFLQPKEGEFPVRVDPTL 120

Query: 203 YQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQRKYSEDSAWPYIFDEYYEYLED 262
              WF++L   N K IT+D W ML+ FF+KFP+L+ ++  Y E +AWPYI DEYYEYL+D
Sbjct: 121 LNLWFQFLDEENKKFITQDYWHMLVVFFQKFPNLNVIKEGYDETAAWPYIIDEYYEYLQD 180

Query: 263 NNKI 266
            N I
Sbjct: 181 TNHI 184

>Smik_12.191 Chr12 (380387..380764) [378 bp, 125 aa] {ON} YLR128W
           (REAL)
          Length = 125

 Score =  106 bits (264), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 50/126 (39%), Positives = 78/126 (61%), Gaps = 1/126 (0%)

Query: 139 IKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQEYWDLFFACQNYPIKV 198
           ++  +   D KL+ N +Y+T IY+  F+LLL+  +K ID     +YW LFF  + YP+ +
Sbjct: 1   MQECMKRLDIKLRQNLQYFTLIYNYTFHLLLDSYRKDIDINECIQYWKLFFRPE-YPVSI 59

Query: 199 QSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQRKYSEDSAWPYIFDEYYE 258
           + +  + WF++L +     I KD W MLL FFKK+ ++ E+   Y E +AWP+I DE+YE
Sbjct: 60  EQNLLEAWFRFLHDEGKMMINKDTWQMLLVFFKKYSTVREIMDDYDESAAWPFIIDEFYE 119

Query: 259 YLEDNN 264
           YL+D  
Sbjct: 120 YLQDQQ 125

>ABR211C Chr2 complement(800856..802025) [1170 bp, 389 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YBL058W
          (SHP1)
          Length = 389

 Score = 38.5 bits (88), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (65%)

Query: 4  SDQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNE 44
          SD+ +++FM L NS    A+KYL  ++  LE ALN FY N+
Sbjct: 2  SDEQIQQFMMLTNSSAEVARKYLGEHEDDLEDALNGFYANQ 42

>Smik_15.456 Chr15 (787294..788580) [1287 bp, 428 aa] {ON} YOR274W
           (REAL)
          Length = 428

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 42/73 (57%), Gaps = 5/73 (6%)

Query: 122 SNFIDSLKANKCRSLEDIKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETA 181
           +NFI+++   + R+ ED+++LL+E +  +K   ++  F  + C N   ++GK  +     
Sbjct: 336 NNFINNVPIEQERAPEDLRDLLSEGETTMKKLADWTHFTCNVCRN---QDGKNVV--AIG 390

Query: 182 QEYWDLFFACQNY 194
           Q+YW++  + + +
Sbjct: 391 QKYWNIHLSSRRH 403

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score = 34.3 bits (77), Expect = 0.35,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 6/77 (7%)

Query: 2   MASDQTLKEFMSLANSDLSTAQKYLKRNKW--RLEYALNDFYDNEIGSFLIQDLARDNKI 59
           +AS  T  E +    ++ ST   Y+++NKW   +E  LN+F DNE  S L     +  + 
Sbjct: 711 LASKATTFEELQFPFTE-STISTYIRQNKWCGEIEETLNNFMDNEGKSSLHFKPMKPPQR 769

Query: 60  LGIEYVRPLTELYNHYA 76
           L   ++R L + YN Y+
Sbjct: 770 L---FIRELAKAYNLYS 783

>TDEL0C01700 Chr3 (297260..298432) [1173 bp, 390 aa] {ON}
          Anc_7.377 YBL058W
          Length = 390

 Score = 33.5 bits (75), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 4  SDQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNE 44
          SD ++++FM+LAN  L+ AQKYL+     L  ALN +Y  E
Sbjct: 5  SDDSIQQFMALANCSLAVAQKYLEEF-GDLTEALNAYYAAE 44

>KLTH0C07040g Chr3 (611631..611723,611832..612896) [1158 bp, 385
          aa] {ON} similar to uniprot|P34223 Saccharomyces
          cerevisiae YBL058W SHP1 UBX (ubiquitin regulatory X)
          domain- containing protein that regulates Glc7p
          phosphatase activity and interacts with Cdc48p
          interacts with ubiquitylated proteins in vivo and is
          required for degradation of a ubiquitylated model
          substrate
          Length = 385

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 10/86 (11%)

Query: 4  SDQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFY----DNE-----IGSFLIQDLA 54
          SD+ +++FM+L+N+ L TAQ YL      L  ALN FY    DN       G+   +  +
Sbjct: 2  SDENIQQFMTLSNASLETAQSYLGEFP-DLGDALNAFYAAQNDNPSSQPASGTSTQEPRS 60

Query: 55 RDNKILGIEYVRPLTELYNHYAIDSG 80
          R ++ L  +    L++  +  A  SG
Sbjct: 61 RPSRSLSPKNSPALSQSSSRAAKKSG 86

>SAKL0G01320g Chr7 complement(110958..113066) [2109 bp, 702 aa] {ON}
           similar to uniprot|P36148 Saccharomyces cerevisiae
           YKR067W GPT2 Glycerol-3-phosphate acyltransferase
           located in both lipid particles and the ER involved in
           the stepwise acylation of glycerol-3-phosphate and
           dihydroxyacetone which are intermediate steps in lipid
           biosynthesis
          Length = 702

 Score = 32.7 bits (73), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 37/96 (38%), Gaps = 10/96 (10%)

Query: 147 DNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQEYWDLFFACQNYPIKVQSDQYQQW 206
           DN    +     ++ D   N  L +G+   D   A E+   F A                
Sbjct: 126 DNLKPVDSRIQIYLPDPINNPCLLKGRVVSDETVAPEFTRRFTA----------KALVGL 175

Query: 207 FKYLSNANIKEITKDQWAMLLRFFKKFPSLSELQRK 242
             YL NA I+EI  D+  +L + FK  P + EL  K
Sbjct: 176 PNYLGNAQIREIVDDETLLLEKPFKDTPKIQELLAK 211

>Kwal_YGOB_Anc_7.377 s27 (549860..549952,550053..551114) [1155 bp,
          384 aa] {ON} ANNOTATED BY YGOB -
          Length = 384

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 4  SDQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGS 47
          SD+ +++FM+L+N+ LS AQ YL      L  AL+ FY  + GS
Sbjct: 2  SDENIQQFMALSNASLSVAQSYLSEFP-DLGDALDAFYAAQNGS 44

>TBLA0C05150 Chr3 complement(1247347..1248633) [1287 bp, 428 aa]
          {ON} Anc_7.377 YBL058W
          Length = 428

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 5/45 (11%)

Query: 4  SDQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFY----DNE 44
          SD  +++FM L NS +S AQ+YL   K  ++ A+N FY    DNE
Sbjct: 2  SDDKIQKFMELTNSSISVAQQYLNDYK-EIDTAVNAFYADRLDNE 45

>Skud_8.260 Chr8 (457563..459305) [1743 bp, 580 aa] {ON} YHR194W
           (REAL)
          Length = 580

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 37/78 (47%), Gaps = 4/78 (5%)

Query: 142 LLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGKKTIDSETAQEYWDLFFACQNYPIKVQSD 201
           +L E  N+L    + YT    S F L+     +T+D     +Y+ + F+ + Y +K +  
Sbjct: 424 ILTEIGNRLLKEAKRYT----SSFPLVGPGFSRTVDEIDPNDYFIMDFSLKLYNVKAEVP 479

Query: 202 QYQQWFKYLSNANIKEIT 219
            +     Y++NA I+ I 
Sbjct: 480 LFTSGLTYINNALIRPIV 497

>Ecym_4698 Chr4 (1366090..1367274) [1185 bp, 394 aa] {ON} similar
          to Ashbya gossypii ABR211C
          Length = 394

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 24/38 (63%)

Query: 4  SDQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFY 41
          SDQ +++FM+L N     A +++ ++   LE A+N +Y
Sbjct: 2  SDQQIQQFMTLTNCSADVATQFINKSNGDLEDAINKYY 39

>SAKL0F12078g Chr6 complement(940018..941082,941150..941242) [1158
          bp, 385 aa] {ON} similar to uniprot|P34223
          Saccharomyces cerevisiae YBL058W SHP1 UBX (ubiquitin
          regulatory X) domain- containing protein that regulates
          Glc7p phosphatase activity and interacts with Cdc48p
          interacts with ubiquitylated proteins in vivo and is
          required for degradation of a ubiquitylated model
          substrate
          Length = 385

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 4  SDQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEI 45
          SDQ +++F++L NS  S AQ+YL      L  ALN +Y  ++
Sbjct: 2  SDQDIQQFIALTNSSFSVAQQYLTEF-GDLSNALNAYYAAQV 42

>YBR199W Chr2 (618909..620303) [1395 bp, 464 aa] {ON}  KTR4Putative
           mannosyltransferase involved in protein glycosylation;
           member of the KRE2/MNT1 mannosyltransferase family
          Length = 464

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 46/99 (46%), Gaps = 2/99 (2%)

Query: 136 LEDIKNLLNEFDNKLKTN-GEYYTFIYDSCFNLLLEEGKKTI-DSETAQEYWDLFFACQN 193
           LEDI + + + + +   N G  YTF+ D  F    ++G K+I   +   E+  +     N
Sbjct: 146 LEDIISSIQQLEEEYNKNFGYPYTFLNDEEFTDEFKDGIKSILPKDRVVEFGTIGPDNWN 205

Query: 194 YPIKVQSDQYQQWFKYLSNANIKEITKDQWAMLLRFFKK 232
            P  +  ++Y Q    +S  NI+    + +  + RF+ K
Sbjct: 206 MPDSIDRERYDQEMDKMSKENIQYAEVESYHNMCRFYSK 244

>ZYRO0B03014g Chr2 complement(244268..245473) [1206 bp, 401 aa]
          {ON} similar to uniprot|P34223 Saccharomyces cerevisiae
          YBL058W SHP1 UBX (ubiquitin regulatory X) domain-
          containing protein that regulates Glc7p phosphatase
          activity and interacts with Cdc48p interacts with
          ubiquitylated proteins in vivo and is required for
          degradation of a ubiquitylated model substrate
          Length = 401

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 5  DQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGS 47
          D+ +++FM+LAN   +TAQ+YL+     L  ALN +Y  E  S
Sbjct: 6  DENIQQFMALANCPFNTAQEYLQEF-GDLGEALNAYYAAEADS 47

>NCAS0F02210 Chr6 (440848..443085) [2238 bp, 745 aa] {ON} Anc_5.41
           YGR264C
          Length = 745

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 9/110 (8%)

Query: 65  VRPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVTLCLAKLVGCIHFTTPILLSNF 124
           VRP +   +H++ D  V    G  +L+ +LG  V+ L+    AK  G +    P  LSN+
Sbjct: 550 VRPESS-DSHFSWDDFVARNNG--ELLANLGNFVNRLIKFVNAKYNGVVPKYDPKQLSNY 606

Query: 125 IDSLKANKCRSLED-IKNLLNEFDNKLKTNGEYYTFIYDSCFNLLLEEGK 173
            D+LK    ++++D +K+ +NE ++  +  G        S  N  L+E K
Sbjct: 607 -DNLK----KTIDDTLKSYINEMEDGHERRGLEIAMALSSHGNQFLQENK 651

>ZYRO0A06116g Chr1 (487142..490417) [3276 bp, 1091 aa] {ON} similar
           to uniprot|Q03660 Saccharomyces cerevisiae YMR218C
           TRS130 Component of the targeting complex (TRAPP)
           involved in ER to Golgi membrane traffic
          Length = 1091

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 4/73 (5%)

Query: 154 GEYYTFI--YDSCFNLLLEEGKKTIDSETAQEYWDLFFACQNYPIKVQSDQYQQWFKYLS 211
           GEY   +  +DSC+   +E G   I  +  Q Y+D    C       + D+       LS
Sbjct: 442 GEYEKAVSLFDSCYEYYMETGWDIIGLKIVQMYYDSLIHCPQIKYLKRDDEDVSVSIVLS 501

Query: 212 NA--NIKEITKDQ 222
           NA  NI  I+KD+
Sbjct: 502 NAFLNILRISKDE 514

>Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar to
           Ashbya gossypii ABL143C
          Length = 753

 Score = 30.0 bits (66), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 59  ILGIEYVRPLTELYNHYAIDSGVLGTEGLVKLVD---DLGYTVDHLVTLCLAK-LVGCIH 114
           ++G+EY+  +   +    +D+ V+  +G+VKL+D    + +T  H  TL  A  +VG   
Sbjct: 512 LVGVEYLHSMGLAHRDLKLDNCVINRQGIVKLIDFGAAVVFTYPHSGTLVEASGIVGSDP 571

Query: 115 FTTP 118
           +  P
Sbjct: 572 YLAP 575

>NCAS0H02640 Chr8 complement(521008..522954) [1947 bp, 648 aa]
          {ON} Anc_5.543 YML013W
          Length = 648

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 5  DQTLKEFMSLAN---SDLSTAQKYLKRNKWRLEYALNDFYD 42
          ++ L EF S++     DL+   ++L+ N W LE AL  ++D
Sbjct: 42 EEKLNEFQSISGFPEDDLADIIRHLQSNSWNLELALGSYFD 82

>CAGL0A04345g Chr1 complement(429936..431114) [1179 bp, 392 aa]
          {ON} similar to uniprot|P34223 Saccharomyces cerevisiae
          YBL058w SHP1
          Length = 392

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 30/47 (63%)

Query: 1  MMASDQTLKEFMSLANSDLSTAQKYLKRNKWRLEYALNDFYDNEIGS 47
          M  SD+ +++FM+L +  +  A++YL++    L  ALN +Y +++ S
Sbjct: 1  MSDSDKVIQQFMTLTDRSIDVAREYLEQYDNDLGGALNAYYASQMES 47

>TDEL0B02520 Chr2 (455189..457624) [2436 bp, 811 aa] {ON} Anc_5.671
           YKR079C
          Length = 811

 Score = 29.6 bits (65), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 22/115 (19%)

Query: 2   MASDQTLKEFMSLANSDLSTAQKYLKRNKW---RLEYALNDFYDNEIGSFLIQDLARDNK 58
           +AS QT+    +L N D+ T  + L+R +     L  A+ D  D+ I SF  +    D +
Sbjct: 224 LASGQTI----TLENGDVITPDQVLERERHFPKILVLAIPD--DSYIQSFHEKFENYDCQ 277

Query: 59  ILGIEYVRPLTELYNHYAIDSGVLGTEGLVKLVDDLGYTVDHLVT---LCLAKLV 110
            LGI Y          Y +D+ V   + L+K ++  G TV H V+   +C   +V
Sbjct: 278 DLGIVY----------YFLDADVTINDDLIKFMERFGNTVQHFVSHPKVCPNSIV 322

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,565,671
Number of extensions: 1469350
Number of successful extensions: 5354
Number of sequences better than 10.0: 87
Number of HSP's gapped: 5476
Number of HSP's successfully gapped: 87
Length of query: 266
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 158
Effective length of database: 41,097,471
Effective search space: 6493400418
Effective search space used: 6493400418
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)