Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A031005.348ON37237216870.0
TDEL0E027905.348ON4112143122e-31
Kpol_1051.45.348ON4263542841e-27
Suva_2.4865.348ON4151832726e-26
YDR317W (HIM1)5.348ON4141622612e-24
Skud_4.5835.348ON4151622542e-23
ZYRO0F00550g5.348ON4151832453e-22
Smik_4.5765.348ON4151542444e-22
KAFR0C018805.348ON3451652301e-20
CAGL0H07161g5.348ON4242012198e-19
TPHA0D020605.348ON4961942172e-18
SAKL0G08910g5.348ON5051931862e-14
AGR348W5.348ON5421631862e-14
KLTH0H14784g5.348ON5141631675e-12
Ecym_81855.348ON4711591612e-11
Kwal_34.159895.348ON5061561542e-10
KLLA0B10120g5.348ON348511247e-07
NCAS0E02080singletonON2251861155e-06
KAFR0G027507.148ON2251191083e-05
Suva_5.917.148ON229731051e-04
YER004W (FMP52)7.148ON231731051e-04
Smik_5.1187.148ON231731013e-04
Skud_5.1037.148ON22776987e-04
TDEL0H031107.148ON224104970.001
KNAG0L00930singletonON22993960.001
TBLA0A105007.148ON237114950.002
ZYRO0D09548g7.148ON22574900.007
ADR005W7.148ON224127870.017
KLTH0H00264g7.148ON22271860.023
KLLA0D13684g7.148ON22498810.11
Kpol_312.97.148ON22176800.13
TBLA0F033107.148ON16174730.79
TPHA0L007607.148ON226130684.0
CAGL0G04279gsingletonON66075677.8
Smik_16.4527.545ON16357657.9
NDAI0A071703.81ON44377669.3
NDAI0A061003.63ON53559669.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A03100
         (372 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.3...   654   0.0  
TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {O...   124   2e-31
Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..997...   114   1e-27
Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W ...   109   6e-26
YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Prot...   105   2e-24
Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317...   102   2e-23
ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON...    99   3e-22
Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317...    99   4e-22
KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {O...    93   1e-20
CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {...    89   8e-19
TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.3...    88   2e-18
SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {...    76   2e-14
AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic ...    76   2e-14
KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weak...    69   5e-12
Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}...    67   2e-11
Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {...    64   2e-10
KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some s...    52   7e-07
NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON}      49   5e-06
KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.14...    46   3e-05
Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W (R...    45   1e-04
YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protei...    45   1e-04
Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W (...    44   3e-04
Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W (...    42   7e-04
TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.14...    42   0.001
KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON}               42   0.001
TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7....    41   0.002
ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar...    39   0.007
ADR005W Chr4 (712873..713547) [675 bp, 224 aa] {ON} Syntenic hom...    38   0.017
KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}...    38   0.023
KLLA0D13684g Chr4 complement(1180483..1181157) [675 bp, 224 aa] ...    36   0.11 
Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..222...    35   0.13 
TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON...    33   0.79 
TPHA0L00760 Chr12 (143784..144464) [681 bp, 226 aa] {ON} Anc_7.1...    31   4.0  
CAGL0G04279g Chr7 complement(404144..406126) [1983 bp, 660 aa] {...    30   7.8  
Smik_16.452 Chr16 complement(774523..775014) [492 bp, 163 aa] {O...    30   7.9  
NDAI0A07170 Chr1 (1633101..1634432) [1332 bp, 443 aa] {ON} Anc_3...    30   9.3  
NDAI0A06100 Chr1 (1382892..1384499) [1608 bp, 535 aa] {ON} Anc_3...    30   9.7  

>TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.348
           YDR317W
          Length = 372

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/372 (88%), Positives = 330/372 (88%)

Query: 1   MEQETNYXXXXXXXXXXXXXXXXXXXXXXYLQAKDPQSAIDNLPQDFQWQACDDSLDLYL 60
           MEQETNY                      YLQAKDPQSAIDNLPQDFQWQACDDSLDLYL
Sbjct: 1   MEQETNYIFFGSTGMTGFTTLTNLLNINSYLQAKDPQSAIDNLPQDFQWQACDDSLDLYL 60

Query: 61  VKNIFCINRRFFDSPIYLDEKXXXXXXXXXYKDKTFELQFQSNTNSVSNNITEQNELKLP 120
           VKNIFCINRRFFDSPIYLDEK         YKDKTFELQFQSNTNSVSNNITEQNELKLP
Sbjct: 61  VKNIFCINRRFFDSPIYLDEKIISSNISINYKDKTFELQFQSNTNSVSNNITEQNELKLP 120

Query: 121 LVSTDCLRYFIDTGNIQLETTPGKENQILTTDEVWYHFNQQLCQLNFKQIXXXXXXXXXX 180
           LVSTDCLRYFIDTGNIQLETTPGKENQILTTDEVWYHFNQQLCQLNFKQI          
Sbjct: 121 LVSTDCLRYFIDTGNIQLETTPGKENQILTTDEVWYHFNQQLCQLNFKQINLNENENDND 180

Query: 181 XVQEKFIKLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSN 240
            VQEKFIKLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSN
Sbjct: 181 NVQEKFIKLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSN 240

Query: 241 IVLPKLEDIQVMICTLGTNLLCDQKKIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSK 300
           IVLPKLEDIQVMICTLGTNLLCDQKKIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSK
Sbjct: 241 IVLPKLEDIQVMICTLGTNLLCDQKKIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSK 300

Query: 301 TFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHVLNPSEEQAVVLNHSTKILKQL 360
           TFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHVLNPSEEQAVVLNHSTKILKQL
Sbjct: 301 TFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHVLNPSEEQAVVLNHSTKILKQL 360

Query: 361 WFYKTFFSNHKC 372
           WFYKTFFSNHKC
Sbjct: 361 WFYKTFFSNHKC 372

>TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {ON}
           Anc_5.348 YDR317W
          Length = 411

 Score =  124 bits (312), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 115/214 (53%), Gaps = 27/214 (12%)

Query: 156 YHFNQQLCQLNFKQIXXXXXXXXXXXVQEKFIKLNYIINIYQFVLPKSDTWLEVLPNIFK 215
           YH + Q  Q+ +K              ++  I  N++I   Q   P S  W E+LP+IF 
Sbjct: 141 YHRSMQTYQVEYKS----------ENSKKLLITFNFVI--LQIACPDSSKWCELLPDIFS 188

Query: 216 PTTILHSKINCTWNYIDQFTNEKSNIVLPKLEDIQVMICTLGTNLLCDQKK---IDFDLT 272
               L S+        D  TN+     LP L++I  MICTLG      + K   +D++LT
Sbjct: 189 GCVALRSEAE-----PDGTTNK-----LPPLDEIPTMICTLGAGSRQSKAKRHYVDYELT 238

Query: 273 FQLSNWFSNRLGKKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPG 332
           F+L+  F+N  GK+LVIVT FNN L+     YF  K++LE  L++ L   LG+LV+LRPG
Sbjct: 239 FKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPG 298

Query: 333 PLLGTHVLNPSEEQAVVLNHSTKILKQLWFYKTF 366
           PL+G H       +++ + HST +LKQ+ +YK +
Sbjct: 299 PLVGEH--GRPLTKSLTIGHSTNMLKQILYYKEY 330

>Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..9972)
           [1281 nt, 427 aa]
          Length = 426

 Score =  114 bits (284), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 98/354 (27%), Positives = 172/354 (48%), Gaps = 68/354 (19%)

Query: 32  QAKDPQSAIDNLPQDFQWQACDDSLDLYLVKNIFCINRRFFDSPIY-LDEKXXXXXXXXX 90
           Q  +P+S I+ +P + Q         + +VKNIFCINRR     ++  D           
Sbjct: 51  QKLNPRSDIE-IPSNHQKMNT-----IKIVKNIFCINRRSQTLDLFNKDALESVKVGRIK 104

Query: 91  YKDKTFEL-QFQSNTNSVSNNITEQNELKLPLVSTDCLRYFIDTGNIQLETTPGKENQIL 149
           +KD  + L +    T+  S+ +T  NE++   ++ DC   F                   
Sbjct: 105 FKDLEYRLDKTPGETSYESSYLT--NEIESGKINFDCEHPF------------------- 143

Query: 150 TTDEVWYHFNQQLCQLNFKQIXXXXXXXXXXXVQEKFIKLNYIINIYQFVLPKSDTWLEV 209
               + +   ++  QL +K              +   +++ + I++Y  ++P S+ W  +
Sbjct: 144 --SPLSFELQKKRAQLTYKA------------KEGNMLQIQFEISVYHIIIPTSNQWPTL 189

Query: 210 LPNIFKPTTILHSKINCTWNYIDQFTNEKSNIV---LPKLEDIQVMICTLGTNLL----- 261
           LP IF P T+           I++  +++++I+   LP L++I  MI +LG N       
Sbjct: 190 LPRIFNPATV-----------IEKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITR 238

Query: 262 -CDQKKIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLD 320
               + IDFDLT +L+  F+N   KKLV++T FNN ++SK F YF+ K ++E++L+ +L+
Sbjct: 239 EKSYRAIDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELN 298

Query: 321 FPLGELVILRPGPLLG---THVLNPSEEQAVVLNHSTKILKQLWFYKTFFSNHK 371
             L +LVILRPGP++G   T  +NP  E   +L  S  +++Q    K +  ++K
Sbjct: 299 PKLSQLVILRPGPIVGVPMTDAINP--EFNPILKKSDNLVEQSILLKKYLLDYK 350

>Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  109 bits (272), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 67/183 (36%), Positives = 102/183 (55%), Gaps = 18/183 (9%)

Query: 187 IKLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIVLPKL 246
           IK N+I+   Q V+P+S +W ++LP +F  T  L      + +Y+       S+  LP L
Sbjct: 162 IKYNFIVT--QLVIPQSTSWPKLLPEVFSGTQKLERFDVDSRDYV-------SDKSLPAL 212

Query: 247 EDIQVMICTLGTNLLCDQKK------IDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSK 300
             I  M+C LG++    +K       +D+ L+F L+  F+N   KKLV++T+FNN  LS+
Sbjct: 213 NSIGTMVCALGSSAARVRKSQVPNSFVDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSR 272

Query: 301 TFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHVLNPSEEQAVVLNHSTKILKQL 360
           TF YF +K +LE  L+  L   L EL+ILRPGP+ G H  NP   +  +  + T  L + 
Sbjct: 273 TFEYFRIKAKLENDLEEALPNKLKELIILRPGPMCGQHG-NPVHVEMDIQQNPT--LSER 329

Query: 361 WFY 363
           +FY
Sbjct: 330 FFY 332

>YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Protein
           of unknown function involved in DNA repair
          Length = 414

 Score =  105 bits (261), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 63/162 (38%), Positives = 88/162 (54%), Gaps = 13/162 (8%)

Query: 183 QEKFIKLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIV 242
           +EK I++     + Q ++P+S+TW ++LP IF  T  L        NY+   +       
Sbjct: 156 KEKGIEIICNFTVTQLIIPRSETWPKLLPRIFSGTQKLEKFDIDNKNYVPGRS------- 208

Query: 243 LPKLEDIQVMICTLGTNLLCDQKK------IDFDLTFQLSNWFSNRLGKKLVIVTAFNNS 296
           LP L DI  M+C+LG+     ++        D+ L F L+  F+N   K+LV+ TAFNN 
Sbjct: 209 LPSLCDISTMVCSLGSTSARVRRTQVPSSFADYYLPFNLAQEFTNTTNKRLVVTTAFNND 268

Query: 297 LLSKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTH 338
            LSKTF YF +K +LE  L   L   L ELVILRPGP+ G H
Sbjct: 269 FLSKTFEYFRIKAKLENDLDEALPNKLKELVILRPGPMCGQH 310

>Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  102 bits (254), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 58/162 (35%), Positives = 86/162 (53%), Gaps = 13/162 (8%)

Query: 183 QEKFIKLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIV 242
           +E+   + Y   + Q ++P S++W  +L  IF     L         Y+       ++  
Sbjct: 156 KEESFGIKYNFTVTQLIIPPSESWPRLLSRIFSKEQKLEKFDIDNKTYV-------ADKS 208

Query: 243 LPKLEDIQVMICTLGTNLLCDQKK------IDFDLTFQLSNWFSNRLGKKLVIVTAFNNS 296
           LP L DI  M+CTLG+     ++       +D+ L F L+  F+N   K+LV+VT+FNN 
Sbjct: 209 LPSLRDIGTMVCTLGSTSARVRRTQVPNSFVDYHLVFSLAQEFANTTNKRLVVVTSFNND 268

Query: 297 LLSKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTH 338
           LL +TF YF +K +LE  L+  L   L ELVILRPGP+ G H
Sbjct: 269 LLMRTFEYFRIKAKLENDLEEALPNKLKELVILRPGPMCGQH 310

>ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 415

 Score = 99.0 bits (245), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 100/183 (54%), Gaps = 21/183 (11%)

Query: 189 LNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIVLPKLED 248
           + +   I Q V   S  W ++LP+IF     L          + + +N  S   LP L+ 
Sbjct: 170 ITFHFTIVQLVFEDSTRWADLLPSIFSGEVEL----------VPEESNHTSP-RLPHLDQ 218

Query: 249 IQVMICTLGTNLLC------DQKKIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKTF 302
           ++ MICTLG N         D+  +++ LTFQ+   F++   K+LVI+T+FNNSL+S  F
Sbjct: 219 VKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHIF 278

Query: 303 NYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHV-LNPSEEQAVVLNHSTKILKQLW 361
            YF  K QLE  L+  +   L +LV+LRPGP++G HV LN   ++ + L +S  + +QL 
Sbjct: 279 PYFKAKYQLENDLQNKVAPALAQLVVLRPGPIVGNHVNLN---DRDLRLRYSPSLCEQLK 335

Query: 362 FYK 364
            YK
Sbjct: 336 HYK 338

>Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score = 98.6 bits (244), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 80/154 (51%), Gaps = 13/154 (8%)

Query: 191 YIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIVLPKLEDIQ 250
           Y   + Q ++P+S+ W  +L  IF  T  L         Y+       +   LP L DI 
Sbjct: 164 YKFTVTQLIIPRSENWSRLLSYIFSGTQKLEKFDANNKTYV-------AGKSLPNLRDIS 216

Query: 251 VMICTLGTNLLCDQKK------IDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKTFNY 304
            M+CTLG+     ++       +D+ L F L+  F+N   K+LVI+T+FNN  LS TF Y
Sbjct: 217 TMVCTLGSTSARVRRTQVPNSFVDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEY 276

Query: 305 FNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTH 338
           F +K +LE  L+  L     EL+ILRPGP+ G H
Sbjct: 277 FRIKAKLENDLEEVLPNKPKELIILRPGPMCGQH 310

>KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {ON}
           Anc_5.348 YDR317W
          Length = 345

 Score = 93.2 bits (230), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 89/165 (53%), Gaps = 14/165 (8%)

Query: 188 KLNYIINIY--QFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIVLPK 245
           +LN   N++  Q V  +S+ W ++LP +F       ++I       D+   E     L  
Sbjct: 143 QLNVTYNVFHVQIVYNESEKWPDLLPILFTG----ENEIKIARKRKDRLFPEL--FKLAN 196

Query: 246 LEDIQVMICTLGTNLLCDQK------KIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLS 299
           + DI  ++CTLG +    +K      KID+DLT+ L   F+    KK++IVT+FNN+L+S
Sbjct: 197 INDISTVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTENKKVIIVTSFNNALIS 256

Query: 300 KTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHVLNPSE 344
             F YF  K +LE  LK  L+ P+ EL ILRPGP+ G H    SE
Sbjct: 257 NIFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKHRSKESE 301

>CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317w
          Length = 424

 Score = 89.0 bits (219), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 64/201 (31%), Positives = 100/201 (49%), Gaps = 25/201 (12%)

Query: 182 VQEKFIKLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFT-NEKSN 240
            +   +KLN+I N  Q ++  S +W  V+P IF              + ++  +  EK  
Sbjct: 168 AEGNLLKLNFIFNHIQLIIKNSFSWPSVIPIIFS-------------DEVEAISFREKMP 214

Query: 241 I--VLPKLEDIQVMICTLGTNLLCDQ------KKIDFDLTFQLSNWFSNRLGKKLVIVTA 292
           +    P L DI+ MI T+GT    ++        ID+ L   L   FSN   K ++IVT+
Sbjct: 215 LKRYFPLLSDIKTMISTIGTTTNRNKISNTTYNDIDYQLNVDLVKAFSNTDDKSVIIVTS 274

Query: 293 FNNSLLSKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHV-LNPSEEQAVVLN 351
           FNN+++S    YF +K +LE +L   +  PL  L ILRPGPL+G H  + P+ +   +L 
Sbjct: 275 FNNTIISTVSPYFKIKMKLESTLANAITPPLKTLTILRPGPLVGRHSDIYPTNDS--ILK 332

Query: 352 HSTKILKQLWFYKTFFSNHKC 372
           +S+   + L   K F  N +C
Sbjct: 333 NSSLFERALLHKKAFLQNMEC 353

>TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.348
           YDR317W
          Length = 496

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 101/194 (52%), Gaps = 15/194 (7%)

Query: 186 FIKLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIVLPK 245
            +K+N+ + +Y      S  W  +LP +F   T L        N ID  TNEK    LP 
Sbjct: 235 ILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNTKLVPNKGLIEN-ID-LTNEK----LPL 288

Query: 246 LEDIQVMICTLGTNLLCDQ----KKIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKT 301
           L +++VM+ +LG+     +    K ID+ L   L N F+N   KK++I+T+ N  + +  
Sbjct: 289 LSEVKVMLNSLGSRSHSPKNETFKNIDYKLNLSLINSFNNTSDKKVIIITSVNKKIYTFF 348

Query: 302 FNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHV---LNPSEEQAVVLNHSTKILK 358
             Y N K  LE+ LK +LD  + ELVILRPGPL+GT +   L P     +  N S+  LK
Sbjct: 349 SRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMTTKLIPGLTAHLKRNDSS--LK 406

Query: 359 QLWFYKTFFSNHKC 372
           QL  YK F  ++K 
Sbjct: 407 QLINYKRFAFDYKV 420

>SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {ON}
           weakly similar to uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W Hypothetical ORF
          Length = 505

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 95/193 (49%), Gaps = 25/193 (12%)

Query: 193 INIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIVLPKLEDIQVM 252
           IN+ Q + P S  W  +L + F  T       N   +   Q     + ++ P L  +  +
Sbjct: 247 INVIQILEPNSKLWPLLLHSTFGDT-----DTNVALHVQGQV---PTPMIFPSLSKVNTL 298

Query: 253 ICTLGTNLLCDQKK-------IDFDLTFQLSNWFS-----NRLGKKLVIVTAFNNSLLSK 300
           +  LG+    +QKK       +D+DL F+++  F+     + + KK+V++T+FNN  LS 
Sbjct: 299 VSALGSTTF-EQKKSHVSRDFVDYDLNFKMAEEFTTNSSEHGIKKKVVVITSFNNFALSS 357

Query: 301 TFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHVLN--PSEEQAVVLNHSTKILK 358
           T  YF+ K +LE+ L   +   L ELVILRPGPL+G+H     P +      N   K L 
Sbjct: 358 TSPYFHTKLKLEQDLATRIP-ELDELVILRPGPLIGSHTPEFIPGDPPKST-NGLLKPLS 415

Query: 359 QLWFYKTFFSNHK 371
            + +YK    +HK
Sbjct: 416 TVCYYKKACYDHK 428

>AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR317W
          Length = 542

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 77/163 (47%), Gaps = 25/163 (15%)

Query: 190 NYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIVLPKLEDI 249
           N  IN+ Q V P S  W ++   +F                +  F N  S I +P + +I
Sbjct: 281 NATINVVQVVQPDSRRWPDLFNKMFT-------------GGVRTF-NAYSEIYMPAVTEI 326

Query: 250 QVMICTLGTNLLCDQKK------IDFDLTFQLSNWFSN--RLG--KKLVIVTAFNNSLLS 299
           + +I TLG+     +K       +D+ L  Q++  F+   + G  K +VIVT+FN+  L 
Sbjct: 327 ETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALG 386

Query: 300 KTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHVLNP 342
               YF  K +LE  L YD+   L  L ILRPGPLLG H   P
Sbjct: 387 MVSQYFRTKQRLENDLTYDVPG-LTHLTILRPGPLLGEHGSKP 428

>KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weakly
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 514

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 79/163 (48%), Gaps = 18/163 (11%)

Query: 186 FIKLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIVLPK 245
            +KLN  IN+   +   S  W  +L ++F    +    I        Q     S+   P 
Sbjct: 253 MVKLN--INVICVIDTDSQRWPALLTDVFGEQPMKRGLIP-----QGQGLEGISHWEFPS 305

Query: 246 LEDIQVMICTLGTNLLCDQKK------IDFDLTFQLSNWFSNRLG----KKLVIVTAFNN 295
           L D+  ++  LG+    ++K       +D++L   L+  F  R      KK+V+VT+FN+
Sbjct: 306 LGDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNS 365

Query: 296 SLLSKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTH 338
           SLLS   NYF  K +LE+ L Y     +  LV+LRPGPL+G H
Sbjct: 366 SLLSTVSNYFQTKLKLEQDL-YTKVHGMDNLVLLRPGPLVGNH 407

>Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AGR348W
          Length = 471

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 25/159 (15%)

Query: 190 NYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIVLPKLEDI 249
           N  +N++Q +   S  W +    +F            T N   +  N++  + LP ++ +
Sbjct: 211 NVTVNVFQIIQNDSKKWDKTFSELF------------TGNR--KPLNDRIEVYLPSIDQV 256

Query: 250 QVMICTLGTNLLCDQKK------IDFDLTFQLSNWFS----NRLGKKLVIVTAFNNSLLS 299
           + +I TLG++    +K       +D+ L   ++  F+      L K +VIVT+FNN  L 
Sbjct: 257 ETLISTLGSSSWESRKMKTPRSFVDYTLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALG 316

Query: 300 KTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTH 338
               YF  K +LE  L YD+   L  L ILRPGPL+G H
Sbjct: 317 VLSPYFRTKQKLENDLTYDVPG-LTHLTILRPGPLIGQH 354

>Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {ON}
           YDR317W - Hypothetical ORF [contig 272] FULL
          Length = 506

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 73/156 (46%), Gaps = 18/156 (11%)

Query: 193 INIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIVLPKLEDIQVM 252
           +NI   V   S  W  +L  IF        K       I + T E      P L  I  M
Sbjct: 253 VNIILIVEEDSQKWPMLLTRIF-------GKHASKRPLIVKDTEEPILWTAPPLTQINTM 305

Query: 253 ICTLGTNLLCDQKK------IDFDLTFQLSNWF----SNRLGKKLVIVTAFNNSLLSKTF 302
           + +LG+     +K        D++L   L++ F    +  L KK+VI+T+FNN  LS T 
Sbjct: 306 VSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIVIITSFNNLFLSSTS 365

Query: 303 NYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTH 338
           +YF  K  LE+ L   +   L +LV+LRPGPL+G H
Sbjct: 366 DYFQSKLMLEQDLVTKVQ-ALDKLVLLRPGPLVGNH 400

>KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some
           similarities with uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W
          Length = 348

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 34/51 (66%)

Query: 288 VIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTH 338
           +I+T+FNN  +S+ F YF  K +LE + ++ L      +VILRPGPL+G H
Sbjct: 183 IIMTSFNNFAISRMFPYFKAKQELETNTQFLLQNHRASIVILRPGPLIGKH 233

>NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 46/186 (24%), Positives = 85/186 (45%), Gaps = 25/186 (13%)

Query: 183 QEKFIKLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIV 242
            EK  K N I+ + +  LPKSD+   +   I +P        N  W+++     E +  +
Sbjct: 20  AEKTGKFNTIVTLTRRALPKSDS---IATQIVEPD-------NSKWSHL---IPENTKYL 66

Query: 243 LPKLEDIQVMICTLGTNLLCDQKKIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKTF 302
              L      + +       +Q KID DL  +L+     +    +V+V++   SL S+ F
Sbjct: 67  FTGLS-----MTSYALGGFDNQYKIDHDLNLELAKAAKAKGCSTIVVVSSDRASLDSR-F 120

Query: 303 NYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHVLNPSEEQAVVLNHSTKILKQLWF 362
           +Y  +K ++E+ +   LDF     +ILRPG LLG    +P        + + +++  + F
Sbjct: 121 SYMRMKGEIERDI-VALDFD--HTIILRPGILLGER--DPQTAHKSFTHDAMRMIGGM-F 174

Query: 363 YKTFFS 368
           Y++  +
Sbjct: 175 YRSRLA 180

>KAFR0G02750 Chr7 (569916..570593) [678 bp, 225 aa] {ON} Anc_7.148
           YER004W
          Length = 225

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 60/119 (50%), Gaps = 11/119 (9%)

Query: 222 SKINCTWNYIDQFTNEKSNIVLPKLEDIQVMICTLGTNLLCD----QKKIDFDLTFQLSN 277
           SK+N   + +D+ ++  SNI+    E+I V+   L T         Q KID DL  +L+ 
Sbjct: 43  SKLN---SIVDKDSSNWSNIISGLDENIDVLFTALATTRAVGGTGYQYKIDHDLNVELAK 99

Query: 278 WFSNRLGKKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLG 336
               +    +VIVTA      S+ F Y  +K ++E+ +  DL F     +ILRPG LLG
Sbjct: 100 AAREKGCSTIVIVTAHGAHADSRFF-YTKMKGEIERDIS-DLGFN--RTIILRPGILLG 154

>Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W
           (REAL)
          Length = 229

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 42/73 (57%), Gaps = 4/73 (5%)

Query: 264 QKKIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFPL 323
           Q KID DL  QL+    +R    +V+V++    + S+ F Y  +K ++E+ +   L+F  
Sbjct: 86  QYKIDHDLNMQLARAAKDRGCDTIVLVSSAGAHVDSR-FGYMKMKGEIERDI-IALNFK- 142

Query: 324 GELVILRPGPLLG 336
              +ILRPGPLLG
Sbjct: 143 -HTIILRPGPLLG 154

>YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protein
           of unknown function, localized to the mitochondrial
           outer membrane; induced by treatment with
           8-methoxypsoralen and UVA irradiation
          Length = 231

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 42/73 (57%), Gaps = 4/73 (5%)

Query: 264 QKKIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFPL 323
           Q KID DL  QL+     +  + +V+V++      S+ F Y  +K ++E+ +   LDF  
Sbjct: 86  QYKIDHDLNLQLAQAAKEKGCETIVLVSSAGAHPDSR-FGYMKMKGEIERDV-IALDFK- 142

Query: 324 GELVILRPGPLLG 336
             ++ILRPGPLLG
Sbjct: 143 -HIIILRPGPLLG 154

>Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W
           (REAL)
          Length = 231

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 4/73 (5%)

Query: 264 QKKIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFPL 323
           Q KID DL  QL+    ++  + +V+V++      S+ F Y  +K ++E+ +   L+F  
Sbjct: 86  QYKIDHDLNLQLARAAKDKGCETIVLVSSAGAHADSR-FGYMKMKGEIERDV-IALNFK- 142

Query: 324 GELVILRPGPLLG 336
              +ILRPGPLLG
Sbjct: 143 -HTIILRPGPLLG 154

>Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W
           (REAL)
          Length = 227

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 43/76 (56%), Gaps = 4/76 (5%)

Query: 261 LCDQKKIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLD 320
           L +Q KID DL  QL+     +  + +V+V++      S+ F Y  +K ++E+ +   L+
Sbjct: 83  LDNQYKIDHDLNLQLARAAKEKGCETIVLVSSAGAHPDSR-FGYMKMKGEIERDV-IALN 140

Query: 321 FPLGELVILRPGPLLG 336
           F     +ILRPGPLLG
Sbjct: 141 FK--HTIILRPGPLLG 154

>TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.148
           YER004W
          Length = 224

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 50/104 (48%), Gaps = 10/104 (9%)

Query: 264 QKKIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFPL 323
           Q KID DL  +L+     +     V+V++   +     F Y  +K ++E+ +   L    
Sbjct: 83  QYKIDHDLNIELAKVAKEKGCSTFVLVSS-GGAKEDSMFAYMKMKGEIERDI---LALGF 138

Query: 324 GELVILRPGPLLGTHVLNPSEEQAVVLNHSTKILKQLWFYKTFF 367
              +ILRPGPLLG  + +    + ++ +  +KI    W YK+ F
Sbjct: 139 DHTIILRPGPLLGDRLTS----KGLITDVFSKI--GSWMYKSRF 176

>KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 44/93 (47%), Gaps = 7/93 (7%)

Query: 248 DIQVMICTLGTNLLC----DQKKIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKTFN 303
           ++ V+IC LGT        +Q  +D DLT +L+           V+V +   +     F 
Sbjct: 68  NLDVLICALGTTRARSNAEEQYAVDHDLTLELATVAKREKHAHTVVVVSSTGAHPESRFF 127

Query: 304 YFNVKNQLEKSLKYDLDFPLGELVILRPGPLLG 336
           Y  +K  +E+ +  +L F     V+LRPG LLG
Sbjct: 128 YARMKGDVERDIT-ELQF--NHTVLLRPGILLG 157

>TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7.148
           YER004W
          Length = 237

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 51/114 (44%), Gaps = 11/114 (9%)

Query: 223 KINCTWNYIDQFTNEKSNIVLPKLEDIQVMICTLGTNLLCDQKKIDFDLTFQLSNWFSNR 282
           K N  W  I  F  +K +I++  L   +             Q  ID DL    +      
Sbjct: 53  KDNSKW--ISHFPTDKIDILMTGLATTKKA-----AGGAQQQYYIDHDLNIDFAKKAKEN 105

Query: 283 LGKKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLG 336
                V+V++   S  S+ F Y  +K ++E+ LK  +DF    L+ILRPGPLLG
Sbjct: 106 GCSTFVVVSSAGASADSRFF-YLKMKGEIERDLKA-IDFD--HLIILRPGPLLG 155

>ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar to
           uniprot|P40008 Saccharomyces cerevisiae YER004W FMP52
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 225

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 10/74 (13%)

Query: 266 KIDFDLTFQLSNWFSNRLGKKLVIVTAFN---NSLLSKTFNYFNVKNQLEKSLKYDLDFP 322
           KID DL  +L+     +    +V+V++     NS+L     YF  K ++E+ +   LDF 
Sbjct: 86  KIDHDLNVELAKAAKTKGCTTMVLVSSVGANENSMLP----YFKDKGEIERDI-LALDFD 140

Query: 323 LGELVILRPGPLLG 336
               +ILRPGPLLG
Sbjct: 141 --HTIILRPGPLLG 152

>ADR005W Chr4 (712873..713547) [675 bp, 224 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER004W
          Length = 224

 Score = 38.1 bits (87), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 59/127 (46%), Gaps = 14/127 (11%)

Query: 218 TILHSKINCTWNYIDQFTNEKSNI---VLPKLEDIQVMICTLGT-----NLLCDQKKIDF 269
            ++  +I  +   ++   NE+S+     +P    + V    LGT       L +Q K+D 
Sbjct: 31  ALVRRQIPNSAARVETIVNEQSDSWPESVPA--GVDVFFSGLGTTRANAGGLENQYKVDH 88

Query: 270 DLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFPLGELVIL 329
           DL   ++     R  +  VIV+A   S+ ++   Y  +K  +E+ L   L+F     VIL
Sbjct: 89  DLNIAVAKAAKERGCRVCVIVSAIGASVNAR-LPYNKLKGDIERDL-LALEFE--RTVIL 144

Query: 330 RPGPLLG 336
           RPG LLG
Sbjct: 145 RPGVLLG 151

>KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 222

 Score = 37.7 bits (86), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 4/71 (5%)

Query: 266 KIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFPLGE 325
           K+D D+  QL+     + G    +V +   +  +  F Y   K +LE+ +   L      
Sbjct: 87  KVDHDMNLQLARSAKEK-GYSTYVVVSSTGADENSMFYYMKTKGELERDI---LALGFER 142

Query: 326 LVILRPGPLLG 336
            +ILRPGPLLG
Sbjct: 143 TIILRPGPLLG 153

>KLLA0D13684g Chr4 complement(1180483..1181157) [675 bp, 224 aa]
           {ON} similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 224

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 47/98 (47%), Gaps = 15/98 (15%)

Query: 247 EDIQVMICTLGTNLLC-----DQKKIDFDLTFQLSNWFSNRLGKKLVIVTAFN---NSLL 298
           ED  V++  L T         +Q KID D+  +L+     +  K  V+V++     NS L
Sbjct: 63  EDATVLLTGLATTRAAAGGFENQYKIDHDMNVELAKVAKAKGYKVCVLVSSLGANENSFL 122

Query: 299 SKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLG 336
                Y  +K + E+ +   LDF   + +ILRPG LLG
Sbjct: 123 P----YLKLKGETERDI-IALDFD--KTIILRPGGLLG 153

>Kpol_312.9 s312 (21577..22242) [666 bp, 221 aa] {ON} (21577..22242)
           [666 nt, 222 aa]
          Length = 221

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 261 LCDQKKIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLD 320
           L +Q KID+DL  +L+     +    LV+V++   +  S    Y  +K ++E+ +   + 
Sbjct: 79  LDNQYKIDYDLNIELAKAAKEKGCSTLVLVSSAGANEHS-WIAYLKMKGEIERDM---IK 134

Query: 321 FPLGELVILRPGPLLG 336
                 +ILRPG +LG
Sbjct: 135 LGFDHTIILRPGAILG 150

>TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON}
           Anc_7.148 YER004W possible pseudogene; truncated at 5'
           end
          Length = 161

 Score = 32.7 bits (73), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 4/74 (5%)

Query: 263 DQKKIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFP 322
           +Q +ID +L   L+           V+V++   +  S+ F Y  +K ++E+ L+      
Sbjct: 16  EQYRIDHNLNIHLAKKAKENGCSTFVLVSSSLANADSR-FTYLKMKGEIERDLEA---IG 71

Query: 323 LGELVILRPGPLLG 336
              L+ILRPG LLG
Sbjct: 72  FDHLIILRPGKLLG 85

>TPHA0L00760 Chr12 (143784..144464) [681 bp, 226 aa] {ON} Anc_7.148
           YER004W
          Length = 226

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 62/130 (47%), Gaps = 15/130 (11%)

Query: 217 TTILHSKINCTWN---YIDQFTNEKSNIVLPKL-EDIQVMICTLGT-----NLLCDQKKI 267
           TTI   K+  T++    I+Q  N+ S   + ++ + + V+  +L T       L +Q KI
Sbjct: 30  TTITRRKLADTYDNNTKINQIINKNSEEWVNEVPKGLDVVFTSLSTTKGAAGSLENQYKI 89

Query: 268 DFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKTFNYFNVKNQLEKSL-KYDLDFPLGEL 326
           D DL  QL    +   G K V++ + + +       Y  +K ++E+ + K   D      
Sbjct: 90  DHDLNLQLLEK-AKENGCKTVVLISSSGANEHSWAGYLKMKGEIERDVTKLGFDHT---- 144

Query: 327 VILRPGPLLG 336
           +ILRPG LLG
Sbjct: 145 IILRPGVLLG 154

>CAGL0G04279g Chr7 complement(404144..406126) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3
          Length = 660

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 38/75 (50%), Gaps = 5/75 (6%)

Query: 233 QFTNEKSNIVL-PKLEDIQVMICTLGTNLLCDQKKIDFDLTFQLSNWFSNRLGKKLVIVT 291
           QF N  S+  L PKL D++     + T     Q+ ++++L F L NW +   GK LVI  
Sbjct: 206 QFVNVTSDQYLYPKLTDLRT--GKVITKPKTKQRALEYNLNF-LRNWRNEAKGKGLVITI 262

Query: 292 AFNN-SLLSKTFNYF 305
             NN  +L K F + 
Sbjct: 263 ESNNLHILRKLFKFL 277

>Smik_16.452 Chr16 complement(774523..775014) [492 bp, 163 aa] {ON}
           YPR188C (REAL)
          Length = 163

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 9/57 (15%)

Query: 296 SLLSKTFNYFNVKNQLEKSLK-----YDLDFPLGELVILRPGPLLGTHVLNPSEEQA 347
           S++ K+ + F  + +LEKSLK     +DL+ PL E+V      L      NP EE A
Sbjct: 82  SIMGKSLSQFPEREELEKSLKSVGREHDLNVPLNEIV----SSLKEAGFENPEEEFA 134

>NDAI0A07170 Chr1 (1633101..1634432) [1332 bp, 443 aa] {ON} Anc_3.81
           YNL280C
          Length = 443

 Score = 30.0 bits (66), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 12/77 (15%)

Query: 219 ILHSKINCTWNYIDQFTN-EKSNIVLPKLEDIQVMICTLGTNLLCD-----QKKIDF--- 269
           IL S I C   YI   +N +KSN    KLE+++ +    GT LLCD      + I++   
Sbjct: 320 ILISTIMCIGYYIFHSSNMQKSNFRQGKLENLKSIQTKRGTKLLCDGWWSKSQHINYFGD 379

Query: 270 ---DLTFQLSNWFSNRL 283
               L++ L+ WF   L
Sbjct: 380 WLISLSWCLTTWFQTPL 396

>NDAI0A06100 Chr1 (1382892..1384499) [1608 bp, 535 aa] {ON} Anc_3.63
           YNL294C
          Length = 535

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 7/59 (11%)

Query: 198 FVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFT----NEKSNIVL--PKLEDIQ 250
           F++  SD W+  L  IF  T  + + +   W Y+D+ +    N+++  VL  P  ED Q
Sbjct: 302 FIIDISDVWISELSEIFSTTCYIGATV-IVWEYLDRLSVIERNDRAQSVLGRPIFEDEQ 359

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,513,692
Number of extensions: 1785436
Number of successful extensions: 4633
Number of sequences better than 10.0: 45
Number of HSP's gapped: 4744
Number of HSP's successfully gapped: 45
Length of query: 372
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 261
Effective length of database: 40,753,473
Effective search space: 10636656453
Effective search space used: 10636656453
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 66 (30.0 bits)