Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A028205.435ON92592547120.0
CAGL0A02838g5.435ON8288653872e-37
KAFR0E038305.435ON8454323612e-34
TDEL0E019005.435ON7624093593e-34
NDAI0B056805.435ON8564433166e-29
YDR369C (XRS2)5.435ON8544673151e-28
Kpol_1016.55.435ON8124453042e-27
Skud_4.6385.435ON8432453024e-27
NCAS0F033905.435ON8614702981e-26
Smik_4.6355.435ON8631402891e-25
SAKL0G02552g5.435ON8344362819e-25
Suva_2.5415.435ON8691392739e-24
ZYRO0F10054g5.435ON6601662504e-21
KNAG0C049005.435ON7691112381e-19
KLTH0F16038g5.435ON7924222254e-18
Kwal_55.214225.435ON7821362131e-16
TPHA0J025905.435ON7751201801e-12
Ecym_47615.435ON7982241729e-12
AER402C5.435ON8693051551e-09
KLLA0E02201g5.435ON8351341010.003
Skud_5.3018.225ON75260771.6
Kwal_56.236388.295ON492292744.3
SAKL0F03432g3.474ON57563735.2
KLLA0E13333g3.144ON16372705.4
TPHA0B048901.17ON309169725.9
CAGL0H08261g5.609ON734127726.2
Kpol_1032.253.144ON20193707.1
KLLA0A10219g4.385ON47546709.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A02820
         (925 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...  1819   0.0  
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...   153   2e-37
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...   143   2e-34
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...   142   3e-34
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...   126   6e-29
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...   125   1e-28
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....   121   2e-27
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...   120   4e-27
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...   119   1e-26
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...   115   1e-25
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   112   9e-25
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...   109   9e-24
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   100   4e-21
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...    96   1e-19
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...    91   4e-18
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...    87   1e-16
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...    74   1e-12
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...    71   9e-12
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...    64   1e-09
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...    44   0.003
Skud_5.301 Chr5 complement(485678..487936) [2259 bp, 752 aa] {ON...    34   1.6  
Kwal_56.23638 s56 (632586..647354) [14769 bp, 4922 aa] {ON} YLR1...    33   4.3  
SAKL0F03432g Chr6 complement(274302..276029) [1728 bp, 575 aa] {...    33   5.2  
KLLA0E13333g Chr5 (1178639..1179130) [492 bp, 163 aa] {ON} highl...    32   5.4  
TPHA0B04890 Chr2 (1146969..1147898) [930 bp, 309 aa] {ON} Anc_1....    32   5.9  
CAGL0H08261g Chr8 (810168..812372) [2205 bp, 734 aa] {ON} weakly...    32   6.2  
Kpol_1032.25 s1032 complement(53514..54119) [606 bp, 201 aa] {ON...    32   7.1  
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    32   9.8  

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score = 1819 bits (4712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 895/925 (96%), Positives = 895/925 (96%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGXXX 60
           MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTG   
Sbjct: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGNLN 60

Query: 61  XXXXXXXXGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIPIE 120
                   GKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIPIE
Sbjct: 61  NQLSLLNQGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIPIE 120

Query: 121 FQQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSIIXXXXX 180
           FQQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSII     
Sbjct: 121 FQQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSIILKSSF 180

Query: 181 XXXXXXXXXXXXXXFNIDFQNLLDASKIEDFRNINLESLKVELTGIKLIVLNDNTTDLIY 240
                         FNIDFQNLLDASKIEDFRNINLESLKVELTGIKLIVLNDNTTDLIY
Sbjct: 181 LTSLLNLLNPNVTTFNIDFQNLLDASKIEDFRNINLESLKVELTGIKLIVLNDNTTDLIY 240

Query: 241 FIAAMEVINLPTITTEDDTIFINTVKSHSEERLILLTTSNSRHIETIKVHTFKDFYQGIK 300
           FIAAMEVINLPTITTEDDTIFINTVKSHSEERLILLTTSNSRHIETIKVHTFKDFYQGIK
Sbjct: 241 FIAAMEVINLPTITTEDDTIFINTVKSHSEERLILLTTSNSRHIETIKVHTFKDFYQGIK 300

Query: 301 NQNINHLIQVIKKDSPHTIERNSRETISLNNENQTYSQLSPYIEDNNKVNSNTISDSLLK 360
           NQNINHLIQVIKKDSPHTIERNSRETISLNNENQTYSQLSPYIEDNNKVNSNTISDSLLK
Sbjct: 301 NQNINHLIQVIKKDSPHTIERNSRETISLNNENQTYSQLSPYIEDNNKVNSNTISDSLLK 360

Query: 361 QTSELIKPSVNDHAPEKPPVKRRRLNRKRVQPLDSLHFFVGGNTNPTQNNLSQTESDLKN 420
           QTSELIKPSVNDHAPEKPPVKRRRLNRKRVQPLDSLHFFVGGNTNPTQNNLSQTESDLKN
Sbjct: 361 QTSELIKPSVNDHAPEKPPVKRRRLNRKRVQPLDSLHFFVGGNTNPTQNNLSQTESDLKN 420

Query: 421 VANPRNVFSQRKSNDKIDKDEIIVSQPYTKEPFLKEDLSIPTSITKQMSLSNNETLQYPS 480
           VANPRNVFSQRKSNDKIDKDEIIVSQPYTKEPFLKEDLSIPTSITKQMSLSNNETLQYPS
Sbjct: 421 VANPRNVFSQRKSNDKIDKDEIIVSQPYTKEPFLKEDLSIPTSITKQMSLSNNETLQYPS 480

Query: 481 NSQHSPVSLQEPICSNIGSNIPSIGKEDTNPSLVTNKIMAASTSKKDVKILAARSKKPLN 540
           NSQHSPVSLQEPICSNIGSNIPSIGKEDTNPSLVTNKIMAASTSKKDVKILAARSKKPLN
Sbjct: 481 NSQHSPVSLQEPICSNIGSNIPSIGKEDTNPSLVTNKIMAASTSKKDVKILAARSKKPLN 540

Query: 541 DSIDMDMSDQAELTDIHSAATDQQYEKKTLSNYILNNKPDDQANSLKRSKEQEKGTVSPV 600
           DSIDMDMSDQAELTDIHSAATDQQYEKKTLSNYILNNKPDDQANSLKRSKEQEKGTVSPV
Sbjct: 541 DSIDMDMSDQAELTDIHSAATDQQYEKKTLSNYILNNKPDDQANSLKRSKEQEKGTVSPV 600

Query: 601 KRSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISE 660
           KRSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISE
Sbjct: 601 KRSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISE 660

Query: 661 GKKNNESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDNGVASFIRNSAFLLAREYVP 720
           GKKNNESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDNGVASFIRNSAFLLAREYVP
Sbjct: 661 GKKNNESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDNGVASFIRNSAFLLAREYVP 720

Query: 721 MQEFKMNNQGNRIQEFPEFPVEYSPQQAEQLPSNGASMNTITQTFSSDDLETLEQSFSFS 780
           MQEFKMNNQGNRIQEFPEFPVEYSPQQAEQLPSNGASMNTITQTFSSDDLETLEQSFSFS
Sbjct: 721 MQEFKMNNQGNRIQEFPEFPVEYSPQQAEQLPSNGASMNTITQTFSSDDLETLEQSFSFS 780

Query: 781 RASGGDINNNVYPHITKTTKGNSLFVTEDDDDDATISQNFDTETSPDHNLVANLARNMVS 840
           RASGGDINNNVYPHITKTTKGNSLFVTEDDDDDATISQNFDTETSPDHNLVANLARNMVS
Sbjct: 781 RASGGDINNNVYPHITKTTKGNSLFVTEDDDDDATISQNFDTETSPDHNLVANLARNMVS 840

Query: 841 IDDTHPNISIDQNNDLGIEISMSGNDDNHIRSTSSNMNSLNRNHSTKLHNSRSLPSNNSR 900
           IDDTHPNISIDQNNDLGIEISMSGNDDNHIRSTSSNMNSLNRNHSTKLHNSRSLPSNNSR
Sbjct: 841 IDDTHPNISIDQNNDLGIEISMSGNDDNHIRSTSSNMNSLNRNHSTKLHNSRSLPSNNSR 900

Query: 901 QSFRVMEGSEDDDDDAPKFKFSRKR 925
           QSFRVMEGSEDDDDDAPKFKFSRKR
Sbjct: 901 QSFRVMEGSEDDDDDAPKFKFSRKR 925

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score =  153 bits (387), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 211/865 (24%), Positives = 364/865 (42%), Gaps = 171/865 (19%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGXXX 60
           MW++ YSY      +  VSCC++QN  Y+IGRS K+ L +KNDKSISRQHV+  W+    
Sbjct: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60

Query: 61  XXXXXXXXGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIPIE 120
                   GKLT+ + + L   E + ++AD E   E+ LG  PV +  +  + +++IP  
Sbjct: 61  CIELTNT-GKLTKSSEKYLGSNELITYSAD-ETQIEMLLGVAPVKIILSRIDELFDIPNS 118

Query: 121 FQQFESQLKDYGFNINF--GPQKNEAITYVIDIEPRPM-----NNNFISGTLYYSLVNKS 173
             QF   L+  G  I+       + ++  V D   R +     + N  S  L   + NK 
Sbjct: 119 LSQFRETLETLGIQISVDNANVNSTSLITVGDFGYRELFAACNDINIYSSGLLTEICNKL 178

Query: 174 IIXXXXXXXXXXXXXXXXXXXFNIDFQNLLDASKIEDFRNINLESLKVELTGIK----LI 229
           +                    F+ +++++  +      RN++LE L  +  GI+     +
Sbjct: 179 V---------------NDHDNFDAEWRSMQSSY----HRNLDLEGLLSQFGGIRGKFFFL 219

Query: 230 VLNDNTTDLIY---FIAAMEVINLPTITTEDDTIFINTVKSHSEERLILLTTSNSRHI-- 284
           +   +   + Y   F+  + V    +I   DD + + + K  ++E  I+++    +++  
Sbjct: 220 LYKIDWFIISYLKPFLLKLSVEIHDSIHKNDDLLRLISSK-QADEIPIVISNEKIKYLPE 278

Query: 285 ETIKVHTFKDFYQGIKNQNINHLIQVIKKDSPHTIERNSRETISLNN-ENQTYSQLSPYI 343
           +T+++H+  D Y+ I++ ++            + I   S E   + + E++T + + P  
Sbjct: 279 DTLQIHS-DDIYKFIESGDLYR----------NAIRYQSMERKPIYDLEDETTNAIIP-- 325

Query: 344 EDNNKVNSNTISDSLLKQTSELIKPSVNDHAPEKPPVKRRRLNRKRVQPLDSLHFFVGGN 403
           +  +  N++  +D+ L+ T                  K++R+ R +V+PL+SL FF  G 
Sbjct: 326 QKRSLANTSQPTDTSLEST------------------KKKRVRRHKVEPLNSLSFF-AGG 366

Query: 404 TNPTQNNLSQTESDLKNVANPRNVFSQRKSNDKID-----------KDEIIVSQPYT--- 449
            +P              V    N ++Q K N  +D           +++ I  Q +T   
Sbjct: 367 ISP--------------VPGTNNEYNQSKVNGHLDSEISPDSASTTREQKIPGQSHTIST 412

Query: 450 --KEPFLKEDLSIPTSITKQMS---------LSNNETLQYPSNSQHSPVSLQEPICSNIG 498
              E  L +D S PT + + ++         + N+E ++   +  H P   +  I  N  
Sbjct: 413 TRMEHALTDDNSEPTIVQRSIAEGISHRDQLIGNDEVVE---DQHHLPDRKKRDIHENTM 469

Query: 499 SNIPSIGKEDTNPSLVTNKIMAASTSKKDVKILAARSKKPLNDSIDMDMSDQAELTDIHS 558
            N    G    N SL          S     +L +   +  N+  ++   +      I S
Sbjct: 470 YNNSYNG----NKSL-----YGVENSLTQSNLLQSMGYEKSNNKTELSKKNAG---GIMS 517

Query: 559 AATDQQYEKKTLSNYILNNKPDDQANSLKRSKEQEKGTVSPVKRSPTPNNFISALQDAKN 618
              +   ++  L +  LN+  D   N  KR+ +         KR     + +  +Q  K 
Sbjct: 518 TEKNLDAQRPNLKSQTLNSLED---NDPKRTLQ---------KRDI---DIVKLVQTTKE 562

Query: 619 RETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISEGKKNNESITDIDPKWKGR 678
            E  RL S  VKI D ELTEEAINK ++L +VE   D++ ++   +  + T    +WK R
Sbjct: 563 SEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSDISANNTT--QQQWKNR 620

Query: 679 KNFKNFVKQLPKYRMKTMPSGDNGVASFIRNSAFLLAREYVPMQEFKMNNQGNRIQEFPE 738
           KNFK FVK  PKY  K+  S    ++  IR S  +L RE++  +                
Sbjct: 621 KNFKKFVKICPKY--KSEQSSIESMSRHIRGSGEILTREFLQTK---------------N 663

Query: 739 FPVEYSPQQAEQ---------LPSNGASMNTITQTFSSDDLETLEQSFSFSRASGGDINN 789
            PV+Y     +Q          P    S + + Q       E  E SFSF+R + G  N 
Sbjct: 664 VPVDYYNSHHDQNDFVDEINTAPQANKSNSFVHQILPEIGDEN-ENSFSFTRTAIG--NG 720

Query: 790 NVYPHITKTTKGNSLFVTEDDDDDA 814
           N             LFV +DD +D+
Sbjct: 721 NNNSANEINNSNQQLFVVDDDFEDS 745

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 128/432 (29%), Positives = 198/432 (45%), Gaps = 43/432 (9%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHW----- 55
           MWI+ Y  +  D TL  VSCCL++ + YSIGRS K+PL +KNDKSISRQH+T  W     
Sbjct: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60

Query: 56  -TGXXXXXXXXXXXGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHV 114
            TG           GKLT ++   +   E+  F+ +      V+LG  PVVV  +WT   
Sbjct: 61  GTG---TVLSVVNQGKLTAIDENYMKSDESKAFDDETYSTVVVKLGTKPVVVRISWTPIF 117

Query: 115 YNIPIEFQQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSI 174
           +++  +F QFE  +   G            I+ VI+ E     +N+    + ++L+ ++ 
Sbjct: 118 WDLSKDFLQFEKSINSMGICTQMQSSNVRDISLVINDE----KSNW--SRIMFALLKQNC 171

Query: 175 IXXXXXXXXXXXXXXXXXXXFNIDFQNLLDASKIEDFRNINL-ESLKVELTGIKLIVLND 233
                                N D    + A   E F N  +     VE   I L    D
Sbjct: 172 TLVKPVLLSEVCNVLLADCQTNFD---EIWAQLFESFSNYTVYPGFTVEGNDI-LRAFQD 227

Query: 234 ---------NTTDLIYFIAAMEVI--NLPTITTEDDTI-FINTVKSHSEERLILLTTSNS 281
                    +  DL+Y  A +  +  N  +  T DD + +I TV +H+  + I L   + 
Sbjct: 228 VQFYTVGSISHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTV-NHNLLKCIALKQEDP 286

Query: 282 R--HIETIKVHTFKDFYQGIKNQNINHLIQVIKKDSPHTIERNSRETISLNNENQTYSQL 339
               I+ IK++  K+  Q I + N  +L   I + S  + +RN  ++IS  NE+   +Q 
Sbjct: 287 APDEIQGIKIYAIKEIVQAILDGNFKNLPTHIGR-SNTSRKRNFTDSISHYNED---AQR 342

Query: 340 SPYIEDNNKVNSNTISDSLLKQTSELIKPSVNDHAPEK----PPVKRRRLNRKRVQPLDS 395
           + ++  +N    NT + + +   +E  +       P       P KRRRL R+ V+PLDS
Sbjct: 343 NSHVHPDNTSTLNTNTHATISAAAEASREGGESLEPPTVMGPSPTKRRRLVRRTVKPLDS 402

Query: 396 LHFFVGGNTNPT 407
           L FF GG+TNP+
Sbjct: 403 LSFFAGGSTNPS 414

 Score =  105 bits (261), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 105/349 (30%), Positives = 157/349 (44%), Gaps = 65/349 (18%)

Query: 584 NSLKRSKEQ--EKGTVSPVKRSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAI 641
           N L R  E    K  VS  KRS +P  FI A+Q  K RE  R+ +K V +   EL+EEAI
Sbjct: 555 NILSRKSESGPHKFDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAI 614

Query: 642 NKFSNLAVVETNVDIVISEGKKNNESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDN 701
           NK SNL +VE+N +++       N+S+ D+   WKGR+NFK F K  P++R        +
Sbjct: 615 NKLSNLTIVESNPNLIRERRADKNDSVNDM---WKGRRNFKKFNKVWPQHR--------D 663

Query: 702 GVASFIRNSAFLLAREYVPMQEFKMNNQGNRIQEFPEFPVEYSPQQAEQLPSNGASMNTI 761
           G  S +RN+AFL+ R YV ++ +      N   +F E    ++ +   ++   G      
Sbjct: 664 GYDS-LRNNAFLIIRNYVELKPYDGKRNDNDSSDFHEGRSHFNDENDYEVIRRG------ 716

Query: 762 TQTFSSDDLETLEQSFSFSRASGGDINNNVYPHITKTTKGNSLFVTEDDDDDATISQNFD 821
               S DD+                +N      I  T  GN        D+D T   N D
Sbjct: 717 NPAVSEDDIL---------------LNEMRTKAIGLTDNGN--------DEDFTRIANSD 753

Query: 822 TETSPDHNLVANLARNMVSIDDTHPNISIDQNNDLGIEISMSGN-DDNHI----RSTSSN 876
                 H     ++R  V+ DD+      D+  +  +E     N + NH      STS  
Sbjct: 754 QAVPTVH----GVSRLFVADDDSE-----DELQEERLEKGFGSNRNSNHSFVKEGSTSGI 804

Query: 877 MNSLNRNHSTKLHNSRSLPSNNSRQSFRVMEGSEDDDDDAPKFKFSRKR 925
           +N  +++   + H  R       +++F  ++ S D+DDD PKFKF R R
Sbjct: 805 LNDFSKDTVLRSHLGR-------KKAFTQID-SGDEDDDGPKFKFRRNR 845

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score =  142 bits (359), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 112/409 (27%), Positives = 183/409 (44%), Gaps = 38/409 (9%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGXXX 60
           MWI+ Y+Y+  D T+  VS CL + +T+SIGRS K+PL +KNDKSISR H++  W     
Sbjct: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVW-DSEV 59

Query: 61  XXXXXXXXGKLTRVNSRILNPAETLLFNAD--IEHPAEVELGATPVVVCGAWTNHVYNIP 118
                   G+LT    + L   E++ F     I  P  +ELG  P+ V   W + V+++P
Sbjct: 60  KLIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLP 119

Query: 119 IEFQQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSIIXXX 178
            +  QF   L   G  +      N + T ++       +    +    + L+N ++I   
Sbjct: 120 SQLSQFIDTLDHVGIGVKADTVDNRSTTIIV------TDKIKFAYKCLFGLINGAVIRNS 173

Query: 179 XXXXXXXXXXXXXXXXFNIDFQNLLDASKIEDFRNINLESLKVELTGIKLIVLNDNTTDL 238
                           F   + +L+       + N NL   +V L G K  ++  +   +
Sbjct: 174 QFLVEVTNILSKPTTTFEESWDSLIQNESYMLYPN-NLGPHEVILKGYKFYLIASDVITM 232

Query: 239 IYFIAAMEVINLPTITTEDDTIFINTVKSH-SEERLILLTTSNSRHI--ETIKVHTFKDF 295
            Y   A+E  N   I  E+    ++ +K   S + LI+L    +  I  + IK+HT  D 
Sbjct: 233 AYVQEALERGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDKIKLHTLVDL 292

Query: 296 YQGIKNQNINHLIQVIKKDSPHTIERNSRETISLNNENQTYSQLSPYIEDNNKVNSNTIS 355
              + +  +  L+  +       +E    + I  +    T +++S         +S ++S
Sbjct: 293 VNAVSHNTVKTLLGGVPP-----MEAGPGDVIGSHQPTLTKTEVS---------SSQSLS 338

Query: 356 DSLLKQTSE-LIKPSVNDHAPEKPPVKRRRLNRKRVQPLDSLHFFVGGN 403
           +   + T E  + P+      EKPPVKRRR N  RV+PLDSL FF GG+
Sbjct: 339 NK--EHTPEHTVTPA------EKPPVKRRRYN--RVKPLDSLMFFAGGD 377

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 87/270 (32%), Positives = 138/270 (51%), Gaps = 39/270 (14%)

Query: 547 MSDQAELTDIHSAATDQQYEKKTLSNYILNNKPDDQANSLKRSKEQEKGTVS-PVKRSPT 605
           + D A+  +++   ++QQ E+  L+      +P     + K++ +  K TV+ P   + +
Sbjct: 459 VKDIAQQIEMNHPESEQQSEQANLNMVETTPRP----TARKKTLQDFKSTVNNPDNSASS 514

Query: 606 PNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISEGKKNN 665
               +  ++DAK+RE  RL S  V++  +ELTE+AIN+  +LA+V+ N  ++  +   + 
Sbjct: 515 TEGLVDLIKDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSA 574

Query: 666 E-SITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDN---GVASFIRNSAFLLAREYVPM 721
           E S  D  P W GRKNFKNFVK   KY+ + M  G+N   G + FIRNS +LL R+YVP 
Sbjct: 575 ETSRNDQHPPWDGRKNFKNFVKVQAKYKEQRM--GENYREGSSDFIRNSGYLLTRQYVPS 632

Query: 722 QEFKMNNQGNRIQEFPEFPVEYSPQQAEQLPSNGASMNTITQTFSSDDLETLEQSFSFSR 781
           + +        +Q+FP    E S Q + Q         ++ Q    DD E  E  F+F+R
Sbjct: 633 KIY-TKESSKEMQDFP----EASEQTSRQF--------SVPQVI--DDPEDAE-PFTFTR 676

Query: 782 ASGGDINNNVYPHITKTTKGNSLFVTEDDD 811
                       H + T   N LFV ++DD
Sbjct: 677 ------------HTSGTPANNGLFVVDEDD 694

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score =  126 bits (316), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 131/443 (29%), Positives = 190/443 (42%), Gaps = 68/443 (15%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGXXX 60
           MWI+ Y Y   D  +  VS CL+++  YSIGRS K+PL +KNDKSISRQH+T  W     
Sbjct: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKW--EPS 58

Query: 61  XXXXXXXXGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIPIE 120
                   GKLT V  R L   E+L+FN       +V LG  PV+V   W      IP  
Sbjct: 59  GQLHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPNM 118

Query: 121 FQQFESQLKDYGFNINFG-PQKNEAITYVIDIEPRPMNNNFISGTLYYSL---VNKSIIX 176
           ++QF   L  YG  +     Q++  IT V+ + P    N++    L  +L   V KS   
Sbjct: 119 YEQFRGLLTKYGIEVTSDILQEDSHITAVV-MTP----NDYYVPLLALALGIPVFKS--- 170

Query: 177 XXXXXXXXXXXXXXXXXXFNIDFQNLLDASKI---EDFRNIN-LESLKVELTGIKLIVLN 232
                             +  +  N+L    I    D + IN +ESLK+    +    L+
Sbjct: 171 -----------------QYLTEVSNMLRPDNITFDTDVQKINSMESLKL----VPSFSLS 209

Query: 233 DNTTDLIYFIAAMEVINLPTITTEDDTIFINTVKS----HSEERLI------------LL 276
           +N+ +       +  +N  +++   D  FI   KS      EE +I            +L
Sbjct: 210 NNSKNFFQDYFFIITLNKSSVSEHADKSFI-LRKSLQLIGGEEEIIKDPTELQNSVTKIL 268

Query: 277 TTSNSRHIETIKVHTFKDFYQGIKNQNINHLIQVIKKDSPHTIERNSRETISLNNENQTY 336
           +TS    +        K      + +N+  +     K+ P  ++ N  ET          
Sbjct: 269 STSGKNIVIVTDEDNGKRMIMNFECRNVKDIFDSFVKNDPKLLKSNLTET-------GVV 321

Query: 337 SQLSPYIEDNNKVNSNTISDSLLKQTSELIKPSVN-DHAPEKPP----VKRRRLNRKRVQ 391
           S  +P I +N K+        +    +E    S N  H P +P     VK+RRL RKRV+
Sbjct: 322 SPKAPEIFENEKLMVEIQEPPIEAAITEESTSSKNLKHTPPEPVTTHIVKKRRLARKRVK 381

Query: 392 PLDSLHFFVGGNTNPTQNNLSQT 414
           PL+SL FFVGG+T  T    S T
Sbjct: 382 PLESLDFFVGGSTTGTPFETSST 404

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score =  125 bits (315), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 131/467 (28%), Positives = 216/467 (46%), Gaps = 76/467 (16%)

Query: 356 DSLLKQTSELIKPSVNDHAPEKPPV-KRRRLNRKRVQPLDSLHFFVGG-NTNPTQNNLSQ 413
           D + +  S ++K S        P V K+R+LNR+RV PLDSL FF GG +T     N S 
Sbjct: 328 DQISEGMSTILKTSRAPEVEASPVVSKKRKLNRRRVLPLDSLDFFAGGLSTKTLSENRSL 387

Query: 414 TESDLKNVANPRNVFSQRKSNDKIDKDEIIVSQPYTKE------PFLKEDLSIPTSITKQ 467
           T++   N                  + + ++S P   E      PFL+  L     I K+
Sbjct: 388 TDAKRLNCG---------------AESKTVISSPNIAEADEKHAPFLQNALKPTEDIGKK 432

Query: 468 MSLSNNETLQYPSNSQHSPVSLQEPICSNIGSNIPSIGKEDTNPSLVTNKIMAASTSKKD 527
                        +S    + +  P    + ++  S+ K     SL ++K+   S  +  
Sbjct: 433 -----------SGHSSPGAIIVSSPNLGTVNTSEDSLDK-----SLQSHKLPQPSLPE-- 474

Query: 528 VKILAARSKKPLNDSIDMDMS-----DQAELTDIHSAATDQQYEKKTLSNYILNNKPDDQ 582
             +    S+   ++S D + +     D AE+T        Q  E+ + +   L+N   + 
Sbjct: 475 --VAGIGSQTISSNSADYETAAVNSMDDAEVTKNFRVNHHQNIEQPSKNIRKLSNYSREI 532

Query: 583 ANSLKRSKEQEKGTVSPVKRSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAIN 642
           ++ L+ + +     +S  ++S TP+ F+ A+Q+ KNRE  R+ S  V++ DEEL+EEAIN
Sbjct: 533 SSPLQENCKSPVKELSIKEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAIN 592

Query: 643 KFSNLAVVETNVDIVI----SEGKKNNESITD-----IDPKWKGRKNFKNFVKQLPKYRM 693
           +  NLA+VE + +++     SEG K + +        ++P+W  RKNFK FVK  PK + 
Sbjct: 593 QLKNLAIVEPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKA 652

Query: 694 KTMPSGDNGVAS-FIRNSAFLLAREYVPMQEFKMNNQGNRIQEFPEFPVEYSPQQAEQLP 752
                 +N  +S FIRN+AFL+ R YVP++++   +   +     E    ++  + E+  
Sbjct: 653 HKEEGKNNTQSSDFIRNAAFLITRNYVPLKKYSKKDTTTKWGT-EENEDMFALTEMERFG 711

Query: 753 SN---------------GASMNTITQTFSSDDLETLEQSFSFSRASG 784
           SN                 ++N  T   SS++ E  E SFSFSR SG
Sbjct: 712 SNTFMSDNINSNTIQKRSQALNRFTNEDSSNEGE--EDSFSFSRCSG 756

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 79/139 (56%), Gaps = 6/139 (4%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHW----- 55
           MW++ Y     D +++ +SCCL+  +TYSIGRS K+PL +KNDKSISRQH+TF W     
Sbjct: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60

Query: 56  TGXXXXXXXXXXXGKLTRVNSRILNPAETLLFNA-DIEHPAEVELGATPVVVCGAWTNHV 114
           +            GKLT +N + +   ET   NA D+     +ELG TP+ +   W N V
Sbjct: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120

Query: 115 YNIPIEFQQFESQLKDYGF 133
           +NIP    QF + L +YG 
Sbjct: 121 WNIPPHLTQFRTMLSEYGI 139

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 123/445 (27%), Positives = 207/445 (46%), Gaps = 101/445 (22%)

Query: 359 LKQTSELIKPSVNDHAPEKPPVKRRRLNRKRVQPLDSLHFFVGGNTNPTQNNLSQTESDL 418
           ++QT+E +  S N    E  P K+RRLNR RV+PLDSL+FF GG T+   + L     + 
Sbjct: 328 VEQTTEAVPISKNVEIYEPQP-KKRRLNRSRVKPLDSLNFFAGGVTSIGASQLPLPVEEA 386

Query: 419 KNVANPRN---VFSQRKSNDKIDKD-------EIIVSQPYTKEPFLKEDLSIPTSITKQM 468
            N+   ++   + SQ K    I+ +       E++ +    K+P  K D+        Q+
Sbjct: 387 NNITRKKDKEVIKSQGKGEINIETEMDESGNGELLSTASEFKKP--KSDVQHKLEKRMQV 444

Query: 469 SLSNN-ETLQYPSNSQHSPVSLQEPICSNIGSNIPSIGKEDTNPSLVTNKIMAASTSKKD 527
           ++  + E ++ P   ++  +S+Q+ + + + S        DT+  L+  +I   S +K  
Sbjct: 445 AIDRSPEKIKKPKLEEN--ISIQQLLSNKVKST------SDTSSVLIETQIAKESNTK-- 494

Query: 528 VKILAARSKKPLNDSIDMDMSDQAELTDIHSAATDQQYEKKTLSNYILNNKPDDQANSLK 587
                         +I+     Q  LTD +   +D++ E+ ++                 
Sbjct: 495 --------------AIEYGKVRQKTLTD-YKHTSDERIERPSV----------------- 522

Query: 588 RSKEQEKGTVSPVKRSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNL 647
                               + + A+QD K RET R+ +  V+I + ELTEEAINKFS+L
Sbjct: 523 --------------------DLVHAIQDIKERETLRVKTSIVEIKENELTEEAINKFSDL 562

Query: 648 AVVETNV----DIVISEGKKNNESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDNG- 702
            VV+ N     D  +   K  N +  ++D  W G+KNFK FVK +PKY+ ++  +G +  
Sbjct: 563 TVVDINTRLFKDKSLDINKPANSNQNNMD--WSGKKNFKKFVKMVPKYK-RSQGNGQHAD 619

Query: 703 -VASFIRNSAFLLAREYVPMQEFKM---NNQGNRIQEFPEFPVEYSPQQAEQLPSNGASM 758
             ++FIRNSA L+ R +VPM+++     N+  N + +F    V   P +  +        
Sbjct: 620 SCSTFIRNSAMLITRNFVPMKQYSKLDNNSNSNEMTDFSNIEVNKKPVEKNR-------- 671

Query: 759 NTITQTFSSDDLETLEQSFSFSRAS 783
               + +SSDD    E SF+F+R S
Sbjct: 672 ----EAYSSDD-SVDEPSFTFTRNS 691

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 68/133 (51%), Gaps = 2/133 (1%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGXXX 60
           MW++ Y Y   D ++  +SCC++  ETY +GRS K+ L V+NDKSISRQ ++  W     
Sbjct: 1   MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQW-DRDK 59

Query: 61  XXXXXXXXGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIPIE 120
                   GK+T V  R L+  ETL F +       +++G TP+VV  +W     N    
Sbjct: 60  DCIMVKNLGKVTMVEERYLSDGETLSFQSK-NDLVTMKIGTTPIVVNLSWEVKRCNYMKT 118

Query: 121 FQQFESQLKDYGF 133
                  L+ YGF
Sbjct: 119 DMDMVHLLQSYGF 131

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score =  120 bits (302), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 131/245 (53%), Gaps = 45/245 (18%)

Query: 598 SPVK------RSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVE 651
           SPVK      +S TP +F+ A+Q+ KNRE +R  S  V++ D+EL+EE IN+  NLA+VE
Sbjct: 534 SPVKELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVE 593

Query: 652 TNVDI-----------VISEGKKNNESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPS-G 699
            N D+           V +  +KN   I  +  +W  RKNFK F+K  PK++M+   + G
Sbjct: 594 PNEDLLRKPQILGTNSVRTRAQKNESGI--MRQEWHERKNFKTFIKVWPKFKMQNEGNKG 651

Query: 700 DNGVASFIRNSAFLLAREYVPMQEFKMNNQGNRIQEFPEFPVEYSPQQAEQLPSN-GASM 758
           D   + FIR++AFL+ R YVP++++  NN+        E        + E L SN G S 
Sbjct: 652 DTQNSDFIRSAAFLITRNYVPLRKYSKNNKATECNG-KENEDMLGLIEMENLVSNTGVSG 710

Query: 759 NT----ITQ------TFSSDDL--ETLEQSFSFSRASGGDINNNVYPHITKTTKGNSLFV 806
           NT    I Q      TF ++D+  E  +QSFSFSR S           I +  K N LFV
Sbjct: 711 NTSSAVIQQGPRTQNTFINEDISDEGNQQSFSFSRHS----------DIAQPAK-NKLFV 759

Query: 807 TEDDD 811
           TEDDD
Sbjct: 760 TEDDD 764

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 82/149 (55%), Gaps = 10/149 (6%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHW----- 55
           MW+I Y     D  ++++SCCL+ +++YSIGRS K+ L +KNDKSISRQH+TF W     
Sbjct: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60

Query: 56  TGXXXXXXXXXXXGKLTRVNSRILNPAETLLFNA-DIEHPAEVELGATPVVVCGAWTNHV 114
                        GKLT +N + L   E  +  A ++ +   +ELG +P  +  AW + +
Sbjct: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120

Query: 115 YNIPIEFQQFESQLKDYGF----NINFGP 139
           +NIP    +F + L  +G     +I+ GP
Sbjct: 121 WNIPSHLTEFRTTLSQFGISTESSIDDGP 149

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score =  119 bits (298), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 132/470 (28%), Positives = 192/470 (40%), Gaps = 111/470 (23%)

Query: 378 PPVKRRRLNRKRVQPLDSLHFFVGGNTNPTQNNLSQTESDLKNVANPRNVFSQRKSNDKI 437
           P VK+RRLNR+RV+PLDSL FF GG                   A+P+      +   + 
Sbjct: 372 PIVKKRRLNRQRVKPLDSLAFFAGG-------------------ASPKIGSPAVQETAQA 412

Query: 438 DKDEIIVSQPYTKEPFLKEDLSIPTSITKQMSLSNNETLQYPSNSQHSPVSLQEPICSNI 497
            KDE   S  +                      +NN   Q   NSQ  P+   EPI    
Sbjct: 413 TKDESAESDKFR---------------------TNNGLTQPSGNSQ--PLIHSEPIV--- 446

Query: 498 GSNIPSIGKEDTNPSLVTNKIMAASTSKKDVKILAARSKKPLNDSIDMDMSDQAELTDIH 557
              +  + + D N ++      A       V ++ ++S +PL      + ++Q + ++I 
Sbjct: 447 ---LKEVLEADHNKNIQEGPTTA-------VPVIQSKSTQPL------EHTEQNKNSEIG 490

Query: 558 SAATDQQYEKKTLSNYILNNKPDDQANSLKRSKEQEKGTVSPVKRSPTPNNFISALQDAK 617
           S A     E  T +     N P   +     S  +EK  +        P +F+ A+Q+ K
Sbjct: 491 SVAATPTPEVLTGNGVERPNTPQVPSTQALVSNHKEKKNLKS-NSLEEPKSFVQAIQETK 549

Query: 618 NRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISEGKK------NNESITDI 671
           NRE  RL S  V+I  +ELTE AIN+  +L +VE N  ++  +  +        E     
Sbjct: 550 NREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCECRTPTGEDSDKT 609

Query: 672 DPKWKGRKNFKNFVKQLPKYRMKTMPSGDNGVASFIRNSAFLLAREYVPMQEF--KMNNQ 729
             +W  RKNFK FVK  PKY  K   S        IRN+AFL+ R YVPM++F  + NN 
Sbjct: 610 AREWSRRKNFKKFVKIYPKYMKKDTES---DTTDLIRNNAFLITRNYVPMKKFTGQYNNV 666

Query: 730 GNRIQEFPE-------------------------FPVEYSPQQAEQLPSNGASMNTITQT 764
            N  ++  E                          P     Q+  Q+ S  A +      
Sbjct: 667 PNDDEDMYEHHDYERENIENGDGDLAIPPVVNDFIPSSQLSQRRLQIDSQSARIKDTQPD 726

Query: 765 FSSDDLETLEQSFSFSRASGGDINNNVYPHITKTTKGNSLFVTEDDDDDA 814
           FS D+     QSFSF R+           +  KTT  N LFV ++DD D+
Sbjct: 727 FSDDE----GQSFSFRRSMA---------NAKKTTANNGLFVVDEDDLDS 763

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 73/135 (54%), Gaps = 4/135 (2%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGXXX 60
           MW++ Y Y   D +   +S C++++  Y+IGRS K+ L +KNDKSISRQH++  W     
Sbjct: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKW--EDR 58

Query: 61  XXXXXXXXGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIPIE 120
                   GKLT +  + L+  ++L F     +   ++LG  PV+V   + +  + IP  
Sbjct: 59  NDIHIINQGKLTYIGEQYLDVGQSLTFGN--VNSLSIKLGTKPVMVHLEFYSSNWLIPNG 116

Query: 121 FQQFESQLKDYGFNI 135
             QF   LKD+G N+
Sbjct: 117 LTQFHETLKDFGVNV 131

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 80/140 (57%), Gaps = 6/140 (4%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGXXX 60
           MW++ Y     D T++ +SCCL+ +++YSIGRS K+PL +K+DKSISRQH+T  W     
Sbjct: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60

Query: 61  X-----XXXXXXXGKLTRVNSRILNPAETLLFNA-DIEHPAEVELGATPVVVCGAWTNHV 114
                        GKLT +N++ +   ET +  A  + +   +ELGATP+ +   W N V
Sbjct: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120

Query: 115 YNIPIEFQQFESQLKDYGFN 134
           +NIP    QF + L  +G +
Sbjct: 121 WNIPSHLAQFRTALSQFGIS 140

 Score = 95.1 bits (235), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 106/355 (29%), Positives = 158/355 (44%), Gaps = 68/355 (19%)

Query: 520 AASTSKKDVKILAARSKKPLNDSIDMDMSDQ----AELTDIHSAATDQQYEKKTLSNYIL 575
           A  TSK+ + I       P   S +M   D     A+  +  +AAT    E K    Y +
Sbjct: 450 AVRTSKRFLDI------SPQQSSTNMTRRDSQKKSADFVNFETAATSSMEEDKATKAYSI 503

Query: 576 NNKPDDQAN------------SLKRSKEQEKGTVSPVK------RSPTPNNFISALQDAK 617
              P                 S K S   +    SPVK      +S  P++F+ A+Q  K
Sbjct: 504 TGHPTHSVTQTSEGSHELFNYSQKLSFPLKADLESPVKEVSFREKSSAPHSFVQAIQQTK 563

Query: 618 NRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDI-----------VISEGKKNNE 666
            RE  R+ S  V++ D+EL+EEAIN+   LA+VE N D+           V S  +K   
Sbjct: 564 KREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRLNTVSSSTEKGGN 623

Query: 667 SITDIDPKWKGRKNFKNFVKQLPKYRMKTMPS-GDNGVASFIRNSAFLLAREYVPMQEFK 725
            +  I  +W+ RKNFK FVK  PK++ +   S  D   + FIR +AFL+ R YVP++++ 
Sbjct: 624 GV--IRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLITRNYVPLKKYS 681

Query: 726 MNNQGNRIQEFPEFPVEYSPQQAEQLPSNGASMNTITQTF---------------SSDDL 770
             N+  +  +  E    ++  + E++ SN    +T   T                SSD+ 
Sbjct: 682 KKNKVTKWDK-EESDDMHALTEMEKIGSNAYISDTTNSTTIHKRPQTQRIFISEDSSDNG 740

Query: 771 ETLEQSFSFSRASGGDINNNVYPHITKTTKGNSLFVTEDDDDDATISQNFDTETS 825
           E  E SFSFSR  G D   N  P   K      LF+T+D+ +D    + +D  +S
Sbjct: 741 E--EDSFSFSR--GSDAAPNAQPGTIK------LFITDDNGNDNKSDRVYDKGSS 785

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  112 bits (281), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 119/436 (27%), Positives = 184/436 (42%), Gaps = 61/436 (13%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGXXX 60
           MWI+ Y Y + D    ++SCCLKQ   Y IGRS KSPL +KNDKSISR+H+         
Sbjct: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLKVN--KE 58

Query: 61  XXXXXXXXGKLTRVNSRILNPAETLLFNADIEHPA---EVELGATPVVVCGAWTNHVYNI 117
                   GKLT +N+ +L   ++L F     HP     +ELG  P++    W + V+ +
Sbjct: 59  NELNLLNTGKLTTLNAEVLMVDQSLNF-----HPKGQLRLELGIKPIIATIEWQDQVWKV 113

Query: 118 PIEFQQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSIIXX 177
             +   + S  K   FN ++G      ++   +++    N +  S  L +SLV    I  
Sbjct: 114 SHDL-LYNSMFKRQEFN-SYGISVTTTMSTRTNLQIIKQNQDTYSNCL-FSLVKGIDIVR 170

Query: 178 XXXXXXXXXXXXXXXXXFNIDFQNLLD--------ASKIEDFRNI----------NLESL 219
                            ++  ++NLL          + +  F+NI          NL   
Sbjct: 171 ESFLSDFQSHLYMTPTDYDGIWKNLLQKHMVFPNFTTCVSIFQNISIIVASKSIYNLFKY 230

Query: 220 KVELTGIKLIVLNDNTTDLIYFIA----AMEVINLPTITTEDDTIFINTVKSHSEERLIL 275
            +E+ G +L+   +N      FI     + +VI L  IT  + T   N+    SE+    
Sbjct: 231 TIEVAGGELLYC-ENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNSNIDMSED---- 285

Query: 276 LTTSNSRHIETIKVHTFKDFYQGIKNQNINHLIQVIKKDSPHTIERNSRETISLNNENQT 335
                +R +E +K         G K  ++N L+  + K  P  +       IS  +E   
Sbjct: 286 -----ARKLEELKAAAES---LGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDL 337

Query: 336 YSQLSPYIEDN------NKVNSNTISDSLLKQTSELIKPSVNDH--APEKPPVKRRRLNR 387
                P   D       +KV+        L+ ++     + ND     +K PVKR+R NR
Sbjct: 338 EEPKLPLKIDEFITPVPDKVSETAPFKGQLENST-----ARNDFEIMEQKIPVKRKRTNR 392

Query: 388 KRVQPLDSLHFFVGGN 403
            +V+PLDSL FF GGN
Sbjct: 393 SKVRPLDSLDFFAGGN 408

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 94/323 (29%), Positives = 144/323 (44%), Gaps = 69/323 (21%)

Query: 609 FISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISEGKKNNESI 668
            + A+QD K+RE  RL +  ++I   ELTE AIN  SNLA+VE     +I +  +    I
Sbjct: 575 LVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEKKD--LIRKNSERGHCI 632

Query: 669 TDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDNGVASFIRNSAFLLAREYVPMQEFKMNN 728
           +     W+GRKNFK F+K  P  R     + D+   + ++NSAFL+ REYVP+++F  N 
Sbjct: 633 SSDTCLWEGRKNFKKFIKVQP--RRSQRETFDSDGKNIVKNSAFLITREYVPLKKFDPNE 690

Query: 729 QGNRIQEF------PEFPVEYSPQQAEQLPSNGASMNTITQTFSSDDLETLEQSFSFSRA 782
           +      F       E P+   P++ ++           T  F+ D+   +   F+F R 
Sbjct: 691 KEQIDDTFFLNHSANEGPIPAQPRRIDE-----------TSNFTDDEEGPV---FNFKRT 736

Query: 783 SGGDINNNVYPHITKTTKGNSLFVTEDDDDDATISQNFDTETSPDHNLVANLARNMVSID 842
              D   ++ P    T     + + E               TS   N      R  V+ +
Sbjct: 737 KSKD--PSISPRKEHTLTNGDIEMKE---------------TSRSEN------RLFVTDE 773

Query: 843 DTHPNISIDQNNDLGIEISMSGNDDNHIRSTSSNMNSLNRNHSTKLHNSRSLPSNNSRQS 902
           D   +++I  N+    E S+S    N +R        +N   S+  + SR LP       
Sbjct: 774 DDFQSLNITDNSIEAPERSIS----NPLR--------VNDKPSSGGNTSR-LP------- 813

Query: 903 FRVMEGSEDDDDDAPKFKFSRKR 925
            R  E S DDDDD P+F+FS +R
Sbjct: 814 -RFTEAS-DDDDDEPRFRFSSRR 834

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score =  109 bits (273), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 78/139 (56%), Gaps = 6/139 (4%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHW----- 55
           MW+I Y     D ++ ++SCCL+ +++YSIGRS K+ L +KNDKSISRQHVTF W     
Sbjct: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60

Query: 56  TGXXXXXXXXXXXGKLTRVNSRILNPAETLLFNA-DIEHPAEVELGATPVVVCGAWTNHV 114
                        GKLT +N + +   ET   +   + +  E+ELG TP+ +   W + +
Sbjct: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120

Query: 115 YNIPIEFQQFESQLKDYGF 133
           +NIP    QF++ L  +G 
Sbjct: 121 WNIPSNLAQFQTILSQFGI 139

 Score = 77.8 bits (190), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 73/229 (31%), Positives = 120/229 (52%), Gaps = 32/229 (13%)

Query: 585 SLKRSKEQEKGTVSPVK------RSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTE 638
           S K    Q+ G  SP++      +S TP++F+ A+Q  KNRE  R+ S  V++ D+EL+E
Sbjct: 546 SQKTPSHQQAGHNSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELEDDELSE 605

Query: 639 EAINKFSNLAVVETNVDIV---ISEGKKNNESIT------DIDPKWKGRKNFKNFVKQLP 689
           EAIN+ +NLA+VE + +++    S G     S         I  +W  RKNFK F K  P
Sbjct: 606 EAINQLNNLAIVEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNFKTFAKVWP 665

Query: 690 KYRM-KTMPSGDNGVASFIRNSAFLLAREYVPMQEF-KMNNQGNRIQEFPEFPVEYSPQQ 747
             +  K    G+N  + FIR++AFL+ R YVP++++ K +   N  +E  +  +  +  +
Sbjct: 666 NSKTPKEGDKGNNQNSDFIRSAAFLITRNYVPLKKYSKKDRASNWDKENNDDVLALTEME 725

Query: 748 -------------AEQLPSNGASMNTITQTFSSDDLETLEQSFSFSRAS 783
                        A  +     + +++ +  +SDD++  E+SFSFSR S
Sbjct: 726 NLESDTHIPDNTDASVIQERSYAQDSVMKENNSDDMK--ERSFSFSRRS 772

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 93/166 (56%), Gaps = 9/166 (5%)

Query: 579 PDDQANSLKRSKEQEKGTVSPVKR--SPTPNNFISALQDAKNRETDRLGSKFVKIYDEEL 636
           P   A     ++   K T+S  ++  SP+ N+ I  +QD KN E  RL S  +++ DEEL
Sbjct: 428 PTSAAEKPNNARPHRKPTLSDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEEL 487

Query: 637 TEEAINKFSNLAVVETNVDIVISEGKKNNESITDIDPKWKGRKNFKNFVKQLPKYRMKTM 696
           TE+AIN+  NL +V+ N +++    +  + ++   +P W  RKNFKNFVK  PKY  +  
Sbjct: 488 TEDAINQLGNLVLVDRNDNLM--RRRDRSPTVDSHNPNWNNRKNFKNFVKVWPKYGGQDS 545

Query: 697 PSGDNGVASFIRNSAFLLAREYVPMQEFKMNNQGNRIQE----FPE 738
            S + G +  IRN AFLL R+YVP + +   +   + QE    FPE
Sbjct: 546 TSRE-GSSDTIRNRAFLLTRQYVPTRTYTSGDSSKQAQEDLYDFPE 590

 Score = 99.8 bits (247), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 74/135 (54%), Gaps = 2/135 (1%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGXXX 60
           MWI+ Y Y   D  L +VSCCL+  ETY+IGRS K+ L +KNDKSISRQHV+  W G   
Sbjct: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDG-KD 59

Query: 61  XXXXXXXXGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIPIE 120
                   GK+T V+ + L   E++ F   +     VELG  P+ +   W + ++ +P  
Sbjct: 60  RQLKLINQGKMTAVSEKYLKMGESISFGKSM-GTVLVELGTKPLKMQLQWMDSIWMVPQG 118

Query: 121 FQQFESQLKDYGFNI 135
            +   S L++ G  +
Sbjct: 119 SRSDHSALEELGIEV 133

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/44 (54%), Positives = 29/44 (65%), Gaps = 4/44 (9%)

Query: 376 EKPPVKRRRLNRKRVQPLDSLHFFVGGNTNPTQNNLSQTESDLK 419
           EKP  K+RRLNR RV+PLD L FF GG++       SQ ES +K
Sbjct: 313 EKPVTKKRRLNRPRVKPLDILSFFAGGDSMKE----SQGESTMK 352

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 63/111 (56%), Gaps = 3/111 (2%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKS-PLFVKNDKSISRQHVTFHWTGXX 59
           MWI+ YSY+S D     VSCCL+++  YSIGRS K+  L +KNDKSISRQH++F W    
Sbjct: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVS-- 58

Query: 60  XXXXXXXXXGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAW 110
                    GKLT +N   L P ET   +        +++G+ PV+V   W
Sbjct: 59  HDYVDIVNDGKLTYINDAFLKPKETTRISISASKETNIKVGSAPVIVNLVW 109

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (53%), Gaps = 14/121 (11%)

Query: 607 NNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISEGKKNNE 666
           ++ +  +Q  K+ ET RL      +   ELT+EAI  FSN+A+VE  V+IV  +     E
Sbjct: 545 SSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKPAMVTE 604

Query: 667 SITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDNGVASFIRNSAFLLAREYVPMQEFKM 726
           S    D     R NFK F+K  PK R      G++     +RN+A+L+ R+YVPM+ +  
Sbjct: 605 SSIRSD-----RPNFKKFMKVWPKAR-----KGNDS----LRNNAYLITRDYVPMKAYNR 650

Query: 727 N 727
           N
Sbjct: 651 N 651

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 24/29 (82%)

Query: 379 PVKRRRLNRKRVQPLDSLHFFVGGNTNPT 407
           P+K+RRLNR++VQPL+ L FF GG+T  T
Sbjct: 344 PLKKRRLNRRKVQPLNPLEFFAGGDTATT 372

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 103/422 (24%), Positives = 174/422 (41%), Gaps = 62/422 (14%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGXXX 60
           MWI+ Y Y     +   VSCCLK+   Y +GRS KSPL +K DKSISR+HV         
Sbjct: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEV--RQN 58

Query: 61  XXXXXXXXGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIPIE 120
                   GKLT++    +   + L F AD      +E+GA PV     +   ++ IP +
Sbjct: 59  SKLEVLNAGKLTKIGGDNVKMDQMLEFGAD--QSVALEMGAGPVKGTVTYEPAIWKIPHD 116

Query: 121 FQQFES---QLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSIIXX 177
               ES    L  Y   +        ++  + + +          G   ++LV K  I  
Sbjct: 117 LAITESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKS-------HGNCLFALVKKIPIMC 169

Query: 178 XXXXXXXXXXXXXXXXXFNIDFQNLLDASKIEDFRNINLESLKVELTGIKLIVLNDNTTD 237
                              IDF    +   +++   + L++      G+  +V N  T  
Sbjct: 170 EGFIGDFVSQFADT----QIDFDAKWEQITLKNAPFLELQTKDAAFKGLNFVVTNQKTFA 225

Query: 238 LIYFI---------AAMEVINLPT-----ITTEDDTIFINTVKSHSEERLILLTTSNSRH 283
           +   I            +V NL T     I +E+  I I+ ++   E   +    +NS H
Sbjct: 226 IYKSIIDAGSGNLWLCGDVSNLGTFIEKQIKSENVVILIHLIE---EAPALASEQNNSMH 282

Query: 284 IETIKVHTFKDFYQGIKNQNINHLI-QVIKKDSPHTIERNSRETISLNNENQTYSQLSPY 342
           I+  K+   K    G K +++N ++  V+K D    ++R  +E      EN     ++  
Sbjct: 283 IQEAKLLKNKARSLGFKTRDVNDIVDAVLKNDILSLLDRVPQEKAL--EENSAGGSIA-- 338

Query: 343 IEDNNKVNSNTISDSLLKQTSELIKPSVNDHAPEKPPVKRRRLNRKRVQPLDSLHFFVGG 402
               ++V ++ ++D+          P++ +        KR+R NR+ +QPL+SL FF GG
Sbjct: 339 ---GSQVLADIVADA----------PNLRN--------KRKRANRQ-IQPLNSLAFFGGG 376

Query: 403 NT 404
           ++
Sbjct: 377 SS 378

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 87/334 (26%), Positives = 143/334 (42%), Gaps = 65/334 (19%)

Query: 597 VSPVKRSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDI 656
           V  +KR   P + I A Q+AK  E  RL      +  EELTEEAINK  NLA VE  VD+
Sbjct: 519 VQAIKR---PRSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVE-KVDL 574

Query: 657 VI--SEGKKNNESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDNGVASFIRNSAFLL 714
           +   SE  +N+      +P+W  RKNFK FVK  P +  ++ P  DN +   +RN A+L+
Sbjct: 575 MRRPSEVPENSNQRILTNPQWARRKNFKKFVKLWPSHSSRSSP--DN-ITDAVRNKAYLI 631

Query: 715 AREYVPMQEFKMNNQGNRIQEFPEFPVEYSPQQAEQL---PSNGASMNTITQTFSSDDLE 771
            R+YV +  +      +    F +   +++  +   L   P N A +    +   +    
Sbjct: 632 TRDYVSLCPYDGTRNNSADDGFGDACQQHAAAEQSNLTASPGNLALLGVEVENGPA---- 687

Query: 772 TLEQSFSFSRASGGDINNNVYPHITKTTKGNSLFVTEDDDDDATISQNFDTETSPDHNLV 831
                F+F      +            ++ NSLF   ++ D+  +      E SP+ N  
Sbjct: 688 -----FAFQSQRAAN------------SQANSLF---NETDNRRVE-----ERSPERNQ- 721

Query: 832 ANLARNMVSIDDTHPNISIDQNNDLGIEISMSGNDDNHIRSTSSNMNSLNRNHSTKLHNS 891
                 +V  DD+ P ++   NN               +    S +   +++      + 
Sbjct: 722 ---ELFVVDEDDSQPQVACYSNN---------------VSQVPSRLEDADQSLQP---DE 760

Query: 892 RSLPSNNSRQSFRVMEGSEDDDDDAPKFKFSRKR 925
           R +P   S ++   ++   DD DD P+F+F  +R
Sbjct: 761 RRVPRVASLRN--TVQHESDDSDDEPQFRFQSRR 792

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 75/136 (55%), Gaps = 4/136 (2%)

Query: 601 KRSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISE 660
           + +  P +F  A+++ K+ E DRL    V +  EELTEEAINK   LA+VET  D++ ++
Sbjct: 515 REAKRPVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVETK-DLMRAD 573

Query: 661 GKKNNESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDNGVASFIRNSAFLLAREYVP 720
            +      +    +W GRKNFK FVK  P    +  P   +   + +RN A L+ REYVP
Sbjct: 574 REYAVCGQSGGSEQWAGRKNFKKFVKLWPSRSSRNSP---DSATNALRNRAHLITREYVP 630

Query: 721 MQEFKMNNQGNRIQEF 736
           ++ ++  N  N+   F
Sbjct: 631 LRPYEGQNANNQDDSF 646

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 68/138 (49%), Gaps = 7/138 (5%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGXXX 60
           MWI+ Y Y + +    +VSCCLKQ   YSIGRS K+PL +K+DKSISR HV         
Sbjct: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEV--DQS 58

Query: 61  XXXXXXXXGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIPIE 120
                   GKLT+V+ + +   + L F AD E     E+GA+P+          + IP +
Sbjct: 59  CNVVLRVVGKLTKVSGKSVKAGQHLQFTADEE--VLFEMGASPIKATVVKQQSFWKIPHD 116

Query: 121 F---QQFESQLKDYGFNI 135
               Q     L D+   +
Sbjct: 117 LSLSQSLSRHLADFDIQV 134

 Score = 35.4 bits (80), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 377 KPPVKRRRLNRKRVQPLDSLHFFVGGNTNPTQNN 410
           KP  KR+R NR+ V PLDSL FF GG+   ++ N
Sbjct: 354 KPSNKRKRTNRQ-VVPLDSLAFFGGGSAAESKQN 386

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score = 73.9 bits (180), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/120 (36%), Positives = 61/120 (50%), Gaps = 12/120 (10%)

Query: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHW---TG 57
           M I+ Y    AD  +  VSCCL  +  Y+IGRS K+   +KNDKSISRQHV+  W   + 
Sbjct: 1   MIILRYKNVLADGPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWKYSSD 60

Query: 58  XXXXXXXXXXXGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPV--------VVCGA 109
                      GK+T +  + L+  ETL F   I+   EV +G +P+        VVC +
Sbjct: 61  DKNVIIQIKNFGKVTMIKDKYLSQDETLQFTL-IDKKLEVNIGTSPITLEIFNQEVVCNS 119

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 10/55 (18%)

Query: 376 EKPPVKRRRLNRKRVQPLDSLHFFVGG--------NTNPTQNNLS--QTESDLKN 420
           E P  KRRR+NR +V+PLD+L FF GG        NT P+ +  S  +TE D+ N
Sbjct: 330 EPPAPKRRRMNRSKVKPLDTLSFFAGGMSHDTHSINTKPSNDVQSHQETEKDVNN 384

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score = 70.9 bits (172), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 69/224 (30%), Positives = 114/224 (50%), Gaps = 29/224 (12%)

Query: 607 NNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISEGKKNNE 666
           ++ ++A+++ K RE  R+ +  V+I  +ELTEEAI K S LAVVE+ VD++     ++ +
Sbjct: 524 SSIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVES-VDMLRKTQSRHMK 582

Query: 667 SITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDNGVASFIRNSAFLLAREYVPMQEFKM 726
             T+ + +   R+NFK FVK  P Y  K +     G   +  N   +  + Y PM + ++
Sbjct: 583 --TETNKRHHVRRNFKRFVKVWPAYLNKAICQDPMGAQRY-SNRQCVPLKVYEPMNKNEL 639

Query: 727 NN----------QGNRI--QEFPEFPVEYSPQQAEQ-LPSNGASM--NTITQTFSSDDLE 771
            +          + N I  + F   P++++ Q A + +P +  S+  +   Q  S+ +LE
Sbjct: 640 TDDQLVDENSSEEKNDIMNETFTSDPLDHNIQMASKSIPRHHDSIYQSKYEQVLSNPELE 699

Query: 772 TLEQSFSFSRASGGDINNNVYPHITKTTKGNSLFVTEDDDDDAT 815
                FSFS       N+N    +T    GNSLFV ED+ DD T
Sbjct: 700 -----FSFSTIR----NSNSSESVT-NNPGNSLFVVEDESDDNT 733

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 95/423 (22%), Positives = 164/423 (38%), Gaps = 56/423 (13%)

Query: 1   MWIISYSYKSADD--TLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGX 58
           MWI    Y++  D  TL  +S  +K ++ Y +GR+ KS L + +++ +SR H+       
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLK---A 56

Query: 59  XXXXXXXXXXGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIP 118
                     G   ++  + +    +  F+   + P  +E+G+  +     WT   + +P
Sbjct: 57  NRNIIEITLLGAQLKIGHKTIEKGISCEFHPK-QSPLRLEVGSHSIECKLLWTQWEFKVP 115

Query: 119 ----IEFQQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSI 174
               I +          G  I F   K  +   V   + +   + ++     ++LV    
Sbjct: 116 SDLEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYL-----FALVKGLP 170

Query: 175 IXXXXXXXXXXXXXXXXXXXFNIDFQNLLDASKIEDFRNINLESLKVELTGIKLIVLNDN 234
           +                   F    + L     I  F   N   +   L G+  IV   +
Sbjct: 171 LVEVGFLKGISSLLNSDTLKFESKVKELEREFSI--FPEFN--PIPNPLKGLYFIVPEKD 226

Query: 235 TTDLIYF---IAAMEVINLPTITTEDDTIFINTVKSHSEERLILLTTSNSRHIETIKVHT 291
             D++ +   +    V N   IT ED   F+    +    ++IL+  SN           
Sbjct: 227 EFDILKYTIEVGGGTVYN--CITFED---FVKVTSTIPSSKVILIKCSN----------- 270

Query: 292 FKDFYQGIKNQN-INHLIQVIKKDSPHTIERNSRE-TISLNNENQTYSQLSPYIEDNNKV 349
             +    I  Q   +H I + K  S    + ++RE TI++ N N   + +   I D   +
Sbjct: 271 --NISPAIDTQKPTDHNILLEKAHSIGFKQHDTRELTIAVLNNNFEETLIDSSISDKRLI 328

Query: 350 NSNTISDSLLKQTSELIKPS--VNDHAP-------EKPPVKRRRLNRKRVQPLDSLHFFV 400
           + N  S+  LK TS  ++    VN  A        E PP K+RR+N   V+PLDSL FF 
Sbjct: 329 SCN--SNDKLKTTSTSLEDGLKVNVSATSGLNLNTEGPPAKKRRINS--VKPLDSLSFFA 384

Query: 401 GGN 403
           GG+
Sbjct: 385 GGS 387

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 137/305 (44%), Gaps = 54/305 (17%)

Query: 535 SKKPLNDSIDMDMSDQAELTDIHSAATDQQYEKKTLSNYILNNKPDDQANSLKRSKEQEK 594
           SKKP     D+        +++ S ++++  E+ T S   LN+  ++   S KR+  ++ 
Sbjct: 532 SKKPRMQETDL-------YSEVMSGSSEEYREELTRSK--LNSLDEESIKSRKRTSSEK- 581

Query: 595 GTVSPVKRSPTP----NNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVV 650
             V+  KR   P     N + A++  K RE +R+ +  V++  EELTE+AI +  +LA+V
Sbjct: 582 -PVNSCKRRQAPAVPEQNIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIV 640

Query: 651 ETNVDIVISEGKKNNESITDIDPKWKGRKNFKNFVKQLPKYR-MKTMPSGDNGVASFIRN 709
           +  VD++    +++        P    RKN+KNF K  PKY   K  P          RN
Sbjct: 641 QP-VDML---RQQHTVDTVGSSPLTFARKNYKNFKKVWPKYMNRKNSPE--------TRN 688

Query: 710 SAFLLAREYVPMQEFKMNNQGNRIQEFPEFPVEYSPQQAEQLPSNGASMNTITQTFSS-- 767
           +  +  R+Y+P++ ++ + Q   +     F     P+Q + + S   S + ++   +S  
Sbjct: 689 ATAISNRKYLPLELYETDLQSRTL-----FEDGAPPRQKDNI-SRSTSTSGLSNDLASNR 742

Query: 768 ------------------DDLETLEQSFSFSRASGGDINNNVYPHITKTTKGNSLFVTED 809
                             +D    E  F+FS  S  D N+         T  N+LFV +D
Sbjct: 743 GKDHPAPGSLFSNHALLGNDNAGPEPIFNFSSRSREDTNSPTASPAPNLTHDNTLFVVDD 802

Query: 810 DDDDA 814
           +++D 
Sbjct: 803 ENEDG 807

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 88/421 (20%), Positives = 155/421 (36%), Gaps = 59/421 (14%)

Query: 1   MWIISYSYKSADD--TLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGX 58
           MW+   +Y+ +     L N+SC L     + +GR+ KS L ++ +K +SR H+       
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLE---V 56

Query: 59  XXXXXXXXXXGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIP 118
                     G   +V     +    L F    + P  +E+G+  V     W    + +P
Sbjct: 57  IDDHVNILLLGSQLKVGGEDASKGSVLPFGPS-QSPVILEVGSHSVQCILEWAQWEFKVP 115

Query: 119 IEFQQFESQLKDY--GFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSIIX 176
               Q +  L +   G  I      ++A T+ I    RP  ++       ++LV    I 
Sbjct: 116 NTLLQEDPALLEVIKGLGIRVVTSFSKATTHHII---RPHEDDQDYEKYLFALVKGIPIL 172

Query: 177 XXXXXXXXXXXXXXXXXXFNIDFQNLLDASKIEDFRNINLESLKVELTGIKLIVLNDNTT 236
                             F+   +++ +      FR    ++   +L G+  IV   +  
Sbjct: 173 HLEFLKQFTALLRQPVTDFDPQLRSIQEQHYA--FRGFTKKA--ADLNGLHFIVNRKHDF 228

Query: 237 DLIYFIAAMEVINLPTITTED--------DTIFINTVKSHSEERLI---LLTTSNSRHIE 285
           +++ +   +E+         D         TI IN   +   +  I   +    ++R+ E
Sbjct: 229 EMLKY--TLEIGGGTVHFCHDINDLSACLKTIPINGALALKYDHGISAEVKKVDDTRYCE 286

Query: 286 TIKVHTFKDF--YQGIKNQNINHLIQVIKKDSPHTIE--RNSRETISLNNENQTYSQLSP 341
            +  H  + F  ++  K    + L Q++ K  P  ++       TIS   E +  S LSP
Sbjct: 287 VLHSHGIQLFTVHELTKAILYDKLAQLLSKRPPTMMKLVEPVPSTISQTQEMKQES-LSP 345

Query: 342 YIEDNNKVNSNTISDSLLKQTSELIKPSVNDHAPEKPPVKRRRLNRKRVQPLDSLHFFVG 401
                  + + TI D   K  +                  R+RL  K+ QPLDSL FF G
Sbjct: 346 I-----SLGNTTIKDLPRKDKT------------------RKRL--KKPQPLDSLSFFAG 380

Query: 402 G 402
           G
Sbjct: 381 G 381

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 66/134 (49%), Gaps = 11/134 (8%)

Query: 602 RSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISEG 661
           RS T  N I+A+ + K +E  RL    +++   ELTE A+  F + A + T   I I   
Sbjct: 589 RSST--NIITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINT---IQIKPR 643

Query: 662 KKNNESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDNGVASFIRNSAFLLAREYVPM 721
              +  I++ + KW GRKNFK F K  P Y  +T      G+ S   N++  + REY+ M
Sbjct: 644 VLASIPISNGNTKWLGRKNFKKFKKNWPSYLRRTT----EGLCS--DNTSNQIGREYITM 697

Query: 722 QEFKMNNQGNRIQE 735
           +++        I E
Sbjct: 698 RKYDSRKAKKHIAE 711

>Skud_5.301 Chr5 complement(485678..487936) [2259 bp, 752 aa] {ON}
           YER162C (REAL)
          Length = 752

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 1/60 (1%)

Query: 354 ISDSLLKQTSELIKPSVNDHAPEKPPVKRRRLNRKRVQPL-DSLHFFVGGNTNPTQNNLS 412
           ++++L K+  ELIK  +N+   E  P KR R  R++ QPL D+  F  G N  P ++ +S
Sbjct: 1   MNENLPKEYFELIKKVLNEKQTEGAPSKRGRRLRRKNQPLPDAKKFKAGLNEPPGESVVS 60

>Kwal_56.23638 s56 (632586..647354) [14769 bp, 4922 aa] {ON} YLR106C
            (MDN1) - Protein required for cell viability [contig 175]
            FULL
          Length = 4922

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/92 (26%), Positives = 42/92 (45%), Gaps = 4/92 (4%)

Query: 651  ETNVDIVISEGKKNNESITDIDPKWKGR----KNFKNFVKQLPKYRMKTMPSGDNGVASF 706
            E ++  VI++G K +E + D    +K R    K     + QL +       S DN    F
Sbjct: 3224 EKDISKVITDGTKISELLLDFSVSYKNRGPDDKTLAAVLNQLAQEISTFESSRDNDAVDF 3283

Query: 707  IRNSAFLLAREYVPMQEFKMNNQGNRIQEFPE 738
             R S+   +R  + + E   N+  N ++++PE
Sbjct: 3284 YRGSSVYESRRAISVVEKLWNSVSNLLKQWPE 3315

>SAKL0F03432g Chr6 complement(274302..276029) [1728 bp, 575 aa] {ON}
           similar to uniprot|Q06506 Saccharomyces cerevisiae
           YPR137W RRP9 part of small (ribosomal) subunit (SSU)
           processosome (contains U3 snoRNA) Rrp9p is an ortholog
           of the human U3-55k protein the human cDNA partially
           complements a yeast rrp9 null mutant. (Pluk et al.
           (1998) Mol. Cell. Biol. 18 488-498.) U3 small nucleolar
           ribonucleoprotein-associated protein involved in pre-
           ribosomal RNA processing.
          Length = 575

 Score = 32.7 bits (73), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 596 TVSPVKRSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVD 655
           ++SPVK  PT +     L  A  + +D+L   F    D ++   AIN+FS L V+  + D
Sbjct: 269 SLSPVKVIPTKDRRGEVLSLAFRKNSDQL---FASCADYKVRTYAINQFSQLEVLYGHQD 325

Query: 656 IVI 658
           +V+
Sbjct: 326 LVV 328

>KLLA0E13333g Chr5 (1178639..1179130) [492 bp, 163 aa] {ON} highly
           similar to uniprot|Q08230 Saccharomyces cerevisiae
           YOL071W EMI5 Non-essential protein of unknown function
           required for transcriptional induction of the early
           meiotic-specific transcription factor IME1 also required
           for sporulation
          Length = 163

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 7/72 (9%)

Query: 620 ETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISEGKKNNESITDIDPKWKGRK 679
           ETD L S+F   Y +E+T E + ++  L      +D  I      N SIT +  +WK   
Sbjct: 82  ETDLLLSRFAAKYLKEMTPEQLEEYDQLL---NELDWDIYYWATENYSITPLPDRWKN-- 136

Query: 680 NFKNFVKQLPKY 691
              N +KQL ++
Sbjct: 137 --SNILKQLQEF 146

>TPHA0B04890 Chr2 (1146969..1147898) [930 bp, 309 aa] {ON} Anc_1.17
           YCL050C
          Length = 309

 Score = 32.3 bits (72), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 77/169 (45%), Gaps = 18/169 (10%)

Query: 528 VKILAARSKKPLNDSIDMDMSD------QAELTDIHSAATDQQYEKKTLSNYILNNKPDD 581
           + ++A  +KKP  D ID+ +        + ELT ++ A  D +Y+       +LN  P  
Sbjct: 49  ICLVATLAKKPERDDIDIKVKRNPFEVPEPELTVLNDALGDGRYK------LVLNKFPVI 102

Query: 582 QANSLKRSKEQEKGTVSPVKRSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAI 641
             + L  + + E+  V P+    T  +  +A Q A++ E D  G K +  Y+  +   + 
Sbjct: 103 PEHGLLITNKFEQQKV-PL----TIEDVAAAHQLARSLENDIDGQKHIIFYNCGIDAGSS 157

Query: 642 NKFSNLAVVETNVDIVISEGK-KNNESITDIDPKWKGRKNFKNFVKQLP 689
               ++ V+       + + K   + S T ++P +  + +F +FV +LP
Sbjct: 158 QDHKHMQVLRVPEGFELLQDKIVADASATSLEPLYNKKVSFAHFVMKLP 206

>CAGL0H08261g Chr8 (810168..812372) [2205 bp, 734 aa] {ON} weakly
           similar to uniprot|Q99248 Saccharomyces cerevisiae
           YOR019w
          Length = 734

 Score = 32.3 bits (72), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 63/127 (49%), Gaps = 6/127 (4%)

Query: 765 FSSDDLETLEQSFSFSRASGGDINNNVYPHITKTTKGNSLFVTEDDDDDATISQNFDTET 824
           +S ++ + L++S+S S     +     +  +T     +SL + +DDD D+ + ++ ++  
Sbjct: 433 WSKNEQKLLDESYSISTKDKLEKRQESFTSLTTHESEDSLAIEDDDDRDSNLLESTESIV 492

Query: 825 SPDHNLVANLARNMVS----IDDTHPNISIDQNN--DLGIEISMSGNDDNHIRSTSSNMN 878
           S   ++     +NM++     D+ H NI+  +N    + + I  S N  N I++ + N++
Sbjct: 493 SKLKSIAITNRKNMMADLEEFDNEHSNINTKENQLAKVSLIIKHSLNSSNTIKNLTQNLD 552

Query: 879 SLNRNHS 885
             NR  +
Sbjct: 553 EENRGFA 559

>Kpol_1032.25 s1032 complement(53514..54119) [606 bp, 201 aa] {ON}
           complement(53514..54119) [606 nt, 202 aa]
          Length = 201

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 43/93 (46%), Gaps = 8/93 (8%)

Query: 597 VSPVKR--SPTPNNFISALQDAKNR---ETDRLGSKFVKIYDEELTEEAINKFSNLAVVE 651
           V+P+KR   P        +  ++ R   ETD L S F   Y +E+T E ++++ NL + E
Sbjct: 91  VAPIKRVNEPLDKKRARLIYQSRKRGILETDLLLSGFAAKYLKEMTPEELDEYDNL-LNE 149

Query: 652 TNVDIVISEGKKNNESITDIDPKWKGRKNFKNF 684
            + DI     K  N   T +  KWK  K  K  
Sbjct: 150 LDWDIYYWATK--NYDTTPLPDKWKDSKILKKL 180

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           some similarites with YHR206W uniprot|P38889
           Saccharomyces cerevisiae
          Length = 475

 Score = 31.6 bits (70), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%)

Query: 665 NESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDNGVASFIRNS 710
           N+  TDI PK     NF +FV+QL KY    +    N V+  I+N+
Sbjct: 75  NKFTTDILPKHFKHSNFASFVRQLNKYDFHKVKRKKNEVSEGIQNA 120

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 108,784,654
Number of extensions: 5511247
Number of successful extensions: 31372
Number of sequences better than 10.0: 1073
Number of HSP's gapped: 31469
Number of HSP's successfully gapped: 1360
Length of query: 925
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 806
Effective length of database: 39,836,145
Effective search space: 32107932870
Effective search space used: 32107932870
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)