Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A028105.436ON48148125350.0
TDEL0E018905.436ON4744783193e-31
SAKL0G02574g5.436ON4844843105e-30
Kpol_1062.285.436ON4654933071e-29
ZYRO0F10076g5.436ON4824882946e-28
TPHA0E017505.436ON4594742796e-26
KLLA0E02223g5.436ON4804952636e-24
Kwal_55.214185.436ON4844892503e-22
KLTH0F16016g5.436ON4844762479e-22
Ecym_47605.436ON4784882442e-21
AER403C5.436ON4804952424e-21
NDAI0G007102.304ON491100990.002
SAKL0E07194g2.304ON495101870.046
NCAS0G038602.304ON461101840.089
NCAS0G037502.304ON461101840.089
Ecym_33422.304ON495106790.46
KLTH0G10824g2.304ON495106780.53
KAFR0A08120singletonON79347760.98
Skud_14.3022.304ON484102732.1
KLLA0E08735g2.304ON49241732.3
TBLA0B060602.304ON50341713.6
Kpol_1003.512.304ON478110695.9
Kpol_1009.217.234ON112648706.1
Suva_14.851.100ON123064697.4
AGL156W8.359ON910132689.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A02810
         (481 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436    981   0.0  
TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436    127   3e-31
SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {...   124   5e-30
Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON} (62316....   122   1e-29
ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {...   117   6e-28
TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436    112   6e-26
KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {...   105   6e-24
Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026...   100   3e-22
KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON} cons...   100   9e-22
Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar...    99   2e-21
AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}...    98   4e-21
NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {O...    43   0.002
SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {...    38   0.046
NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {O...    37   0.089
NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON}               37   0.089
Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar t...    35   0.46 
KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} simila...    35   0.53 
KAFR0A08120 Chr1 complement(1634616..1636997) [2382 bp, 793 aa] ...    34   0.98 
Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026...    33   2.1  
KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} simila...    33   2.3  
TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON} Anc_2...    32   3.6  
Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON} (1170...    31   5.9  
Kpol_1009.21 s1009 complement(50805..54185) [3381 bp, 1126 aa] {...    32   6.1  
Suva_14.85 Chr14 complement(155326..159018) [3693 bp, 1230 aa] {...    31   7.4  
AGL156W Chr7 (403828..406560) [2733 bp, 910 aa] {ON} Syntenic ho...    31   9.3  

>TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436
          Length = 481

 Score =  981 bits (2535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/481 (100%), Positives = 481/481 (100%)

Query: 1   MTEYISLDTNKRTPSNDLNSTKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNL 60
           MTEYISLDTNKRTPSNDLNSTKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNL
Sbjct: 1   MTEYISLDTNKRTPSNDLNSTKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNL 60

Query: 61  KTTLQTFENIEDKLYQTDLFEDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITAN 120
           KTTLQTFENIEDKLYQTDLFEDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITAN
Sbjct: 61  KTTLQTFENIEDKLYQTDLFEDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITAN 120

Query: 121 IFIKPNKPLVDPNYTWTISNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFK 180
           IFIKPNKPLVDPNYTWTISNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFK
Sbjct: 121 IFIKPNKPLVDPNYTWTISNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFK 180

Query: 181 FDGLSTYPLVPFTSVKSVSGISLFKPLQQSKDYIQYLVESGFRKDMRFPEEVGVKSSNLY 240
           FDGLSTYPLVPFTSVKSVSGISLFKPLQQSKDYIQYLVESGFRKDMRFPEEVGVKSSNLY
Sbjct: 181 FDGLSTYPLVPFTSVKSVSGISLFKPLQQSKDYIQYLVESGFRKDMRFPEEVGVKSSNLY 240

Query: 241 TGLAINGAIKDEGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFNI 300
           TGLAINGAIKDEGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFNI
Sbjct: 241 TGLAINGAIKDEGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFNI 300

Query: 301 YYEYVLNGLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPSIN 360
           YYEYVLNGLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPSIN
Sbjct: 301 YYEYVLNGLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPSIN 360

Query: 361 MFNWETKRREANEFPVPSYLEERPHEKNDGIAFYNVCLNASVPLFSKCKFSPLRFQNSIQ 420
           MFNWETKRREANEFPVPSYLEERPHEKNDGIAFYNVCLNASVPLFSKCKFSPLRFQNSIQ
Sbjct: 361 MFNWETKRREANEFPVPSYLEERPHEKNDGIAFYNVCLNASVPLFSKCKFSPLRFQNSIQ 420

Query: 421 LERYNNCCPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISF 480
           LERYNNCCPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISF
Sbjct: 421 LERYNNCCPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISF 480

Query: 481 L 481
           L
Sbjct: 481 L 481

>TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436
          Length = 474

 Score =  127 bits (319), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 126/478 (26%), Positives = 221/478 (46%), Gaps = 35/478 (7%)

Query: 21  TKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQTDLF 80
           TKPLYISK++I   N    +S S  K++L+  LS P+QN+ ++L TF +I  KL  T L+
Sbjct: 15  TKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRRKLLCTGLY 74

Query: 81  EDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKPNKPLVDPNYTWTISN 140
           +DV+I+L+  Q   +K     +  S  +  ++SP+   A I +KP+        T ++ +
Sbjct: 75  QDVRITLE--QDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGVYNSTAGTTSLVD 132

Query: 141 NKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFKFDGLSTYPLVPFTSVKSVSG 200
           + +  + S++++N L RAD    +    Y+  ++KW+     G  + PL    SV++   
Sbjct: 133 DSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNPSVRASLN 192

Query: 201 ISLFKPLQQSKDYI---------QYLVESGFRKDMRFPEEVGVKSSNLYTGL-AINGAIK 250
               K  Q+SK YI         QY + +G +K  R+  E      N Y G+ + N  I 
Sbjct: 193 FDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQK--RWILEQTNSVPNFYAGITSTNRDIS 250

Query: 251 DEGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFNIYYEYVLNGLN 310
             G     V +    +    + K S+ SKF  D+R +    P  G    +  EYV++   
Sbjct: 251 GLGAQASKVFSNYSGK----FNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQTK 306

Query: 311 DSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPSINMFNWETKRRE 370
            S ++ P+     N S+F  + + + + +++ +  SL ++ G  I      F+ +T+   
Sbjct: 307 GSSQVLPQ---EDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIP-----FSEKTEVHP 358

Query: 371 ANEFPVPSYLEERPHEKNDGIA------FYNVCLNASVPLFSKCKFSPLRFQNSIQL-ER 423
            +++ +   L+     + +G+       FY V L AS  L +    SPLR    + L   
Sbjct: 359 MDKWYLGG-LDSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNA 417

Query: 424 YNNCCPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISFL 481
           +N+           TG + L YK+  A  D+ Y  P+   +   TK GF+   + S+ 
Sbjct: 418 FNDLNTATNSYAAATG-ISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474

>SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  124 bits (310), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 138/484 (28%), Positives = 219/484 (45%), Gaps = 44/484 (9%)

Query: 20  STKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQTDL 79
           +TKPLYI+ V++   N+   +SD+  KS+L+PVLS PLQN+   +  F  I+ KL+ T L
Sbjct: 23  ATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDNAMNNFSEIKKKLFFTGL 82

Query: 80  FEDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKP---NKPLVDPNYTW 136
           F+DVKI+LD N  + +    L +++S  +  V+ P+P  A I + P   NK  +    T 
Sbjct: 83  FQDVKITLD-NDVSGASFDFLKENVS-KEYGVELPLPTVAKIDLIPALYNKLCL----TS 136

Query: 137 TISNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFKFDGLSTYPLVPFTSVK 196
             S+  S      ++IN+L +A+   + +   Y   S K      DG    PL    S+K
Sbjct: 137 GTSDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKSLDGKFLLPLQKNPSIK 196

Query: 197 SV-----SGISLFKPLQQSKDYIQYLVESGFRKDMRFPEEVGVKSSNLY--TGLA----- 244
           +V     +GI LFK          +L      K  ++   +GV+ + L   TG A     
Sbjct: 197 AVIDVNYAGIDLFKQ--------PFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAPILFN 248

Query: 245 -INGAIKD-EGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFNIYY 302
            ++  I++  G N+   ++++I +    + K+S +S+ + D+R FV   P  GS FN+  
Sbjct: 249 GVSTVIRNLYGFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVN 308

Query: 303 EYVLNGLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPSINMF 362
           EYVL       K  P+    +N  +  +++E++ +   + I  SL    G  I       
Sbjct: 309 EYVLTQAFSKNKTVPQ---ENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKAA 365

Query: 363 NWETKRREANEFPVPSYLEERPHEKN-----DGIAFYNVCLNASVPLFSKCKFSPLRFQN 417
              T  R    F +      +  E N      G  FY + + +S  L +    SPLRFQ 
Sbjct: 366 IVHTMDR----FYLGGLKSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQV 421

Query: 418 SIQLERYNNCCPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNAS 477
                   N     Q     TG   LVYK+  A  D+ Y LP+ +      K GF+    
Sbjct: 422 FFNAGDSLNKRELPQSFAAATG-FSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVE 480

Query: 478 ISFL 481
           +SF 
Sbjct: 481 LSFF 484

>Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON}
           (62316..63713) [1398 nt, 466 aa]
          Length = 465

 Score =  122 bits (307), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 133/493 (26%), Positives = 233/493 (47%), Gaps = 83/493 (16%)

Query: 21  TKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQTDLF 80
           TKPLYIS+V++ + + D  +S SFL+++L  V+S P+QN+ T L +F +I+  L  T L+
Sbjct: 22  TKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIKRNLLFTGLY 81

Query: 81  EDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKPNKPLVDPNYTWTISN 140
            DV ++L  ++  S  +  L   +    I ++S +P +A I +KPN  + +   T+T ++
Sbjct: 82  NDVDVTLGADKGGS--LLNLSLKMVTDKIGIESIVPTSATIRLKPNDLVTNLQTTFTTTS 139

Query: 141 NKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFKFDGLSTYPLVPFTSVKSVSG 200
           N    ++ K W N L  AD+  I+  A Y+L ST W    F G     ++PFT V S+  
Sbjct: 140 NDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYFKG---EFILPFTKVPSLRT 196

Query: 201 ISLFKPLQQSKDYIQYL---VESGFRK-----DMR-FPEEVGVKSSNLYTGLAINGAIKD 251
           +      +    ++Q L    ++G +K     D+  FP          Y+GL+I      
Sbjct: 197 VLSVDVSEDKVSHLQRLNCNYKAGIQKLWLKDDLNTFPV--------FYSGLSI------ 242

Query: 252 EGNNNCLVLNKTILENMQIYKKT-----SILSKFSTDSRIFVKGIPRYGSYFNIYYEYVL 306
              NN  + N  I  ++   ++T       L+ FS DS  ++   P  G   N+  EYVL
Sbjct: 243 --VNNKPIFNGEIPIDVPSPEQTPSYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEYVL 300

Query: 307 NGLN-DSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPSINMFNWE 365
           + L+ D+K ++      +N++RF  NFEKY ++    ++ ++L+  G             
Sbjct: 301 SQLDSDNKPIN------TNINRFEANFEKYVSILNSRVITTVLMNGGF------------ 342

Query: 366 TKRREANEFPV-----PSYLEERPHEKNDGIAFYNVCLNASVPLFSKCKF---------- 410
                  +FP+      +++ E   ++N  I   ++ LN S   F KC F          
Sbjct: 343 -------QFPIDESTRSTFVGESWDKRNSLIK--DIILNKSDMNF-KCGFISSFKLPNTE 392

Query: 411 --SPLRFQNSIQLE-RYNNCCPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHD 467
             SPLR Q S   E ++     +       TG + LVYK++     + Y +P+ + +   
Sbjct: 393 LDSPLRLQISALTENKFKGLANYFDGCAADTG-VSLVYKTKDTNMALSYKVPLMQSSNSP 451

Query: 468 TKAGFAMNASISF 480
             +GF+ + +I++
Sbjct: 452 ATSGFSFDIAITY 464

>ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {ON}
           similar to gnl|GLV|KLLA0E02222g Kluyveromyces lactis
           KLLA0E02222g and some similarites with YNL026W
           uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 482

 Score =  117 bits (294), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 131/488 (26%), Positives = 224/488 (45%), Gaps = 51/488 (10%)

Query: 19  NSTKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQTD 78
           N TKPLYISK+ +   N    +SDS  +++    L+ PLQ+++ ++  FE+I  KL  T 
Sbjct: 21  NETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINIFEDIRKKLLFTG 80

Query: 79  LFEDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKPNKPLVDPNY---- 134
           LF DV I+LD +  T+S +  L  +IS     +++P+   A + +K       P+Y    
Sbjct: 81  LFSDVNITLDKDPDTTS-LSQLNKEIS-ESYGIETPLSTQAKVLLK------RPDYNTIS 132

Query: 135 -TWTISNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKW--KNFKFDGLSTYPLVP 191
            T T+S++    + SK W N L +AD   +     ++  +++W  K+ +F    + PLV 
Sbjct: 133 GTTTLSDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFS--FSLPLVK 190

Query: 192 FTSVKSV---SGIS---LFKPLQQSKD---YIQYLVESGFRKDMRFPEEVGVKSSNLYTG 242
             SV+++    GI      KP    +D     QY V +GF+K  R+   +      LYTG
Sbjct: 191 VPSVRAIVEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQK--RWICNISKSVPLLYTG 248

Query: 243 LAINGAIKDEGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFNIYY 302
           +++   ++   N      ++        + KTS ++ F+ D+R F+   P  G  F +  
Sbjct: 249 VSV---VRRNLNEFKPTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNN 305

Query: 303 EYVLNGLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPSINMF 362
           EYV   ++ S+  S +L H +N ++   + E + + ++D I  S  ++ G  I P   + 
Sbjct: 306 EYV---ISQSQGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQ-GGGIYP---LG 358

Query: 363 NWETKRREANEFPVPSYLEERPHEKNDGIA------FYNVCLNASVPLFSKCKFSPLRFQ 416
           +        + F +      +    N G+       FY + L+ S  L +    SPLR Q
Sbjct: 359 SEAQTVHPLDRFQLGGLNSLKGFHLN-GVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQ 417

Query: 417 NSIQLERYNNCCPHK---QRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFA 473
               L   N    +K         TG L LVYK+  A  D+ Y  P+       +K G +
Sbjct: 418 YFFNLG--NASSDYKTIFNSYAAATG-LSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLS 474

Query: 474 MNASISFL 481
           +  S++F 
Sbjct: 475 LGVSLTFF 482

>TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436
          Length = 459

 Score =  112 bits (279), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 120/474 (25%), Positives = 230/474 (48%), Gaps = 40/474 (8%)

Query: 21  TKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQTDLF 80
           TKP+Y+++V + +    + +SD+F +++L  V+S P+++++     F+NI + L  + L+
Sbjct: 11  TKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNNLILSGLY 70

Query: 81  EDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKPNKPLVDPNY-TWTIS 139
           ++V + LD ++  S    +L   +S   I ++S +PI+A + + P       NY T+  S
Sbjct: 71  KNVDVKLDLDERASLLNHSL--KLSTEQIGIESVVPISATLNMTPLYLTPYKNYVTFNTS 128

Query: 140 NNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFK--FDGLSTYPLVPFTSVKS 197
           N ++  S +++WIN    +D   I  SA  DL+ TK +  K   D   T PL+  +S+++
Sbjct: 129 NTQNSVSLNRDWINLFGTSDTGTIKLSA--DLNQTKSEIDKKSIDAKFTMPLLRNSSIRT 186

Query: 198 V--SGISLFKPLQQSKDYIQYLVESGFRKDMRFPEEVGVKSSNL-YTGLAIN------GA 248
           +  S  S+ KP   +    Q+ +  G  K        G+KS  + Y+GL I       G 
Sbjct: 187 ILESKCSIAKPRNDTMK--QFELNIGLTKLKLIG---GIKSLPIFYSGLNIQRKQTTLGP 241

Query: 249 IKDEGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFNIYYEYVLNG 308
           + DE +   ++ N +     ++    S+ S++ TDSR +    P  G  F + +++V   
Sbjct: 242 LSDEESETEIIGNIS----DEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLVHQHV--- 294

Query: 309 LNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPSINMFNWETKR 368
           LN++  +S E+    N+S   ++FEK+ +   D I  S +      +       N  +  
Sbjct: 295 LNETNSISNEI--KKNISNINMSFEKHISTLNDQITSSFIFDGHVGVPLQSTFANLNSGE 352

Query: 369 REANEFPVPSYLEERPHEKNDGIAFYNVCLNASVPLFSKCKFSPLRFQNSI-QLERYNNC 427
              NE  +   L +     ND    + V L +S  + +    SP+RFQ S+  + +    
Sbjct: 353 FWDNEKEIFKTLCQ-----NDIKVSHKVGLVSSFRVPNIPITSPIRFQLSVLGINKSKRM 407

Query: 428 CPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTK-AGFAMNASISF 480
             + +     TG + LVYK + +   + Y +P+  I G+D K +G + + ++++
Sbjct: 408 AEYLKNYSADTG-VSLVYKGDHSQMKLSYQIPL--IHGNDNKHSGLSFDVAVTY 458

>KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {ON}
           conserved hypothetical protein
          Length = 480

 Score =  105 bits (263), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 122/495 (24%), Positives = 216/495 (43%), Gaps = 56/495 (11%)

Query: 17  DLNSTKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQ 76
           D +  K +Y +KVT+   N+   VSD   +S+ N +L+ PLQ + +  ++ E+I+ KL  
Sbjct: 12  DGSCNKTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLF 71

Query: 77  TDLFEDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKP---NKPLVDPN 133
           T LF+  +I+LD +    S  + L +++    + ++ PIP  A + + P   NK     +
Sbjct: 72  TGLFQSAEITLDHDVDVRSS-RLLTENVP-KTLDIELPIPTIAQVKLVPAVYNK----GS 125

Query: 134 YTWTISNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFKFDGLSTYPLVPFT 193
            + T  +  S       WIN    A+   +     Y   + K            P     
Sbjct: 126 LSTTTRDTYSSAGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNP 185

Query: 194 SVKSV-----SGISLFKPLQQSKDYIQYLVESGFRKDMRFPEEVGVKSSNLYTG-----L 243
           SVK+      + + LFK          ++ ES   K  +F    G++ + LY        
Sbjct: 186 SVKAAVYANHTYLDLFKQ--------PFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIE 237

Query: 244 AING----AIKDEGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFN 299
             NG    A    G  + L ++ +I +    + K+S +S+  +DSR F    P  G    
Sbjct: 238 TFNGMTMVARNIYGFADALAVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQ 297

Query: 300 IYYEYVLN-GLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPS 358
           +++EY+L+ G  +SK L     H SN  +  +++E +   F   ++ SL +  G      
Sbjct: 298 LFHEYILSQGFTNSKPLP----HESNFDKLSVSYETHRPFFNTKLVTSLHLDAGA----- 348

Query: 359 INMFNWETKRREANEFPVPSYLEE----RPHEKN-----DGIAFYNVCLNASVPLFSKCK 409
             +F W+ K +         YL      +  E+N      G+ FY + +++S  L +   
Sbjct: 349 --IFPWKNKSKPLVHLLDSFYLGGPKSLKGFERNCVGNRGGLYFYKLGISSSFKLPNTPI 406

Query: 410 FSPLRFQNSIQL-ERYNNCC-PHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHD 467
            SPLR Q+ I   +  NN    + +RKP ++  + L+Y +  A  D+ Y+LP+ ++  +D
Sbjct: 407 DSPLRLQSFINFGDVLNNWRDANLERKPALSTGISLIYSASFANLDLSYSLPL-RVRDYD 465

Query: 468 -TKAGFAMNASISFL 481
             K G      +SF 
Sbjct: 466 IAKPGLTFGLDLSFF 480

>Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026W -
           Essential protein with similarity to S. pombe
           hypothetical protein E241976 [contig 130] FULL
          Length = 484

 Score =  100 bits (250), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 124/489 (25%), Positives = 209/489 (42%), Gaps = 54/489 (11%)

Query: 19  NSTKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQTD 78
           +S KPLY + +++    +   +SD+   S+L PVLS PLQ L+ +L  F  I+ KL  T 
Sbjct: 22  SSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPLQTLEQSLANFTEIKKKLIYTG 81

Query: 79  LFEDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKPNKPLVDPNYTWTI 138
           +F DVKISLD +  + + +K L  D ++ ++ ++SP+P  A I +   KPL      +T 
Sbjct: 82  MFSDVKISLDKD-TSGNGLKDLHQD-AIKELSLESPVPTIARILL---KPLEFNKLCFTS 136

Query: 139 SNNKSIFSWSKNW--INSLNRADQHYINASATYDLDSTKWKNFKFDGLSTYPLVPFTSVK 196
           S N ++ S    +  +N+L +A+   + +   Y            D     PL    SVK
Sbjct: 137 STNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVVVPLQKNPSVK 196

Query: 197 SV-----SGISLF-KPLQQSKDYIQYLVESGFRKDMRFPEEVGVK----------SSNLY 240
           +V     + I L  +P  + KD           +  +    VGV+          S   Y
Sbjct: 197 AVFDTNYANIDLHGQPFVEKKDQ---------HRQRQVSVNVGVQKQWLTSKMNLSPVFY 247

Query: 241 TGLAINGA----IKDEGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGS 296
            G ++       + +E +      N   L+N       S +S+   D+R F    P  G 
Sbjct: 248 NGFSVVARNLHDVPNEASGAIRQFNAPFLKN-------SFVSQLVIDNRKFFGLFPASGV 300

Query: 297 YFNIYYEYVLNGLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIK 356
              +  EYVL+   + K    ++      ++  ++ E   + F++ I+ SL +  G  I 
Sbjct: 301 KIALNNEYVLSQRFE-KDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACG-GIL 358

Query: 357 PSINMFNWETKRREANEFPVPSYLEERPHEKN-----DGIAFYNVCLNASVPLFSKCKFS 411
           P+    N  +     ++F +      +  E+N      G  FY + + +S  L    + S
Sbjct: 359 PT---GNSASLVHHMDKFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQS 415

Query: 412 PLRFQNSIQLERYNNCCPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAG 471
           PLR Q  +     +N  P        +G + L+YKS  A  D+ Y LP+   A    K G
Sbjct: 416 PLRLQFFLNAGEVSNEKPTSVSCAASSG-ISLLYKSPLANMDLTYALPLSNRAQDVAKPG 474

Query: 472 FAMNASISF 480
           F+   S+S 
Sbjct: 475 FSFGVSLSL 483

>KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score = 99.8 bits (247), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 126/476 (26%), Positives = 202/476 (42%), Gaps = 28/476 (5%)

Query: 19  NSTKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQTD 78
           +S KPLY + +++   N    +S++   S+L PVL  PLQ L  +L  F  I+ KL  T 
Sbjct: 22  SSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQSLSNFAEIKKKLIYTG 81

Query: 79  LFEDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKPNKPLVDPNYTWTI 138
           LF DVKISLD N+ +S ++++L  D+ V    ++ PIP  A I + P   L   + T   
Sbjct: 82  LFRDVKISLD-NEVSSDELQSLPKDL-VKGYALEMPIPTIARIRLTPIN-LNRASLTSFT 138

Query: 139 SNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFKFDGLSTYPLVPFTSVKSV 198
            +  S      + IN+  +A+   +     Y    + +     +     PL    SVK+V
Sbjct: 139 GDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKVLEAKLLIPLQKNPSVKAV 198

Query: 199 -----SGISL-FKPLQQSKD---YIQYLVESGFRKDMRFPEEVGVKSS---NLYTGLAIN 246
                + I L  +P  + +D     Q  V  G +K     + V +K+     LY G ++ 
Sbjct: 199 FDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQK-----QWVNIKTGLAPVLYNGFSVV 253

Query: 247 GAIKDEGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFNIYYEYVL 306
               DE        ++ I +    + K S +S+   D+R F    P  G  F+I  EYVL
Sbjct: 254 ARNLDEVRKEA---SEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSINNEYVL 310

Query: 307 NGLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGT--SIKPSINMFNW 364
           +   D KK    +       +  ++FE +   F + I+ SL +  G   S   S ++ + 
Sbjct: 311 SESFD-KKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAGKSSSLVHH 369

Query: 365 ETKRREANEFPVPSYLEERPHEKNDGIAFYNVCLNASVPLFSKCKFSPLRFQNSIQLERY 424
             K        +  + E     ++ G  FY + L +S  L +    SPLR Q        
Sbjct: 370 IDKFYLGGMSSLKGF-ERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQFFFNAGDV 428

Query: 425 NNCCPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISF 480
            N  P  Q     +  + L+YKS  A  D+ Y  P+        K GF+   S+S 
Sbjct: 429 QNKKP-TQFSCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSL 483

>Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii AER403C
          Length = 478

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 127/488 (26%), Positives = 221/488 (45%), Gaps = 58/488 (11%)

Query: 21  TKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQTDLF 80
           TKPL+I+ V +        +S+S  +S+L PVLS P QNL++TL     IE KL  T L+
Sbjct: 22  TKPLFITSVYVNDVKLSP-LSNSIFESILKPVLSQPFQNLRSTLSALGTIEKKLMYTGLY 80

Query: 81  EDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKPN--KPLVDPNYTWTI 138
           +DV I+LD  Q  S  I    ++++  +  ++ P+PI A I + P   +PL        +
Sbjct: 81  DDVNITLD--QDKSQYISDYLEEVAPKEYGLELPVPIKAQIQLVPAFYQPLS------LV 132

Query: 139 SNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFKFDG--LSTYPLVPFTSVK 196
           +  +  ++ +   ++SLN+  Q         +L+ T +   K D   LS   LVP   + 
Sbjct: 133 TTTRDSYAAAGIHLSSLNKFQQAE-TIILQGELNCTPFSG-KIDEKLLSLKCLVPLQKLP 190

Query: 197 SVSGI-----SLFKPLQQSKDYIQYLVESGFRKDMRFPEEVGVK----SSNLYTGLAING 247
           S+  +     +L    +QS     +L ES   K  +    +G++    SS+ + G  I  
Sbjct: 191 SMKAVFDINYALVDLFKQS-----WLPESDQHKQNQIGFNIGIQEQQISSSKFRGPIIYS 245

Query: 248 AIKDEGNNNCLVLNKT-ILENMQIYKKTSILS---KFSTDSRIFVKGIPRYGSYFNIYYE 303
            I   G  N L L KT +  ++  + ++S +S   +   +++ F+  +P  G  FN++ E
Sbjct: 246 GISILG-RNLLDLKKTEVSSSINSWVESSKVSYVFQILQNNKKFLGTLPISGWKFNLFNE 304

Query: 304 YVLNGLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPSINMFN 363
            VL      +K        S   +   ++E Y +  ++ I+ SL +  GT       +F 
Sbjct: 305 AVLGQTVAGEK------QESGFGKVAFSYEGYSSFLRNHIITSLDLSFGT-------IFR 351

Query: 364 W----ETKRREANEFPVPSYLEERPHEKN-----DGIAFYNVCLNASVPLFSKCKFSPLR 414
           +    E K    ++F +      +  ++N      G +FY V   +S  +      SPLR
Sbjct: 352 YKSGSELKVHIMDQFYLGGLSSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLR 411

Query: 415 FQNSIQL-ERYNNCCPHKQRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFA 473
            Q  +   + +N+     +     TG + LVY+S  A  D+ Y LP+   A    K GF+
Sbjct: 412 LQAFVNAGDVFNSERGIPEDLATATG-ISLVYQSHLASLDLTYALPLSLRAQDVAKPGFS 470

Query: 474 MNASISFL 481
              SI+++
Sbjct: 471 FGVSIAYM 478

>AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}
           NOHBY530; No homolog in Saccharomyces cerevisiae'
          Length = 480

 Score = 97.8 bits (242), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 120/495 (24%), Positives = 215/495 (43%), Gaps = 58/495 (11%)

Query: 14  PSNDL--NSTKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIE 71
           P++ L  + TKPLYI+ V +    +D  +SD  LKS+L+PVL+ PLQ+L +TL + E IE
Sbjct: 15  PTDQLGKSQTKPLYITSVQV-EDGKDYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIE 73

Query: 72  DKLYQTDLFEDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKPNKPLVD 131
             L  T L++D+ I+LD ++  S  +     +I+  +  ++ P+P+ A + + P  P   
Sbjct: 74  KNLMYTGLYQDISITLDHDK--SRLVNQFLSNIAPKEYDIELPLPVKALVKVLP-APYQR 130

Query: 132 PNYTWTISNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNFKFDGLSTYPLVP 191
            +   T  ++ +        +N    A+   + A   Y   S K  +   D      LVP
Sbjct: 131 LSLVTTTRDSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVD---LRCLVP 187

Query: 192 FT---SVKSVSGISLFKPLQQSKDYIQYLVESGFRKDMRFPEEVGVK----SSNLYTGLA 244
           F    S+K+V  ++       ++ +I    E    K  +    +G++    S  LY+  A
Sbjct: 188 FQNNPSIKAVFDVNYAMLDLYNQPWIN---EDDQHKQRQIGFNIGIQKQWLSKRLYSPTA 244

Query: 245 INGAIKDEGNNNCLVLNKT---ILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFNIY 301
             G      N + + L++    +        KTS +++F   +R  +   P  G  FN  
Sbjct: 245 FAGVSIVGRNLHGIQLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAV 304

Query: 302 YEYVLNGLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAIL------CSLLVRTGTSI 355
            E V   L+ +   +P+       ++F + +EK+ +  ++ +       C  L+ T  + 
Sbjct: 305 NELV---LSQTVAGTPQ---EETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAA 358

Query: 356 KPSINMFNWETKRREANEFPVPSYLEERPHEKND-----GIAFYNVCLNASVPLFSKCKF 410
           KP +++          ++F +      +   +N      G  FY + L +SV L      
Sbjct: 359 KPMVHIM---------DQFYLGGLSSLKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLD 409

Query: 411 SPLRFQ---NSIQLERYNNCCPHKQRKPDITGTLG--LVYKSESAYFDIGYTLPIGKIAG 465
           SPLR Q   N+  +  +    P      D+    G  LVY+S  A  D+ Y LP+     
Sbjct: 410 SPLRLQAFFNAGDVFHFRRQIPE-----DVAAATGLSLVYESPIANLDLTYALPLTSRPV 464

Query: 466 HDTKAGFAMNASISF 480
              K GF+   +I++
Sbjct: 465 DLAKPGFSFGVAIAY 479

>NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {ON}
           Anc_2.304
          Length = 491

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 47/100 (47%), Gaps = 7/100 (7%)

Query: 389 DGIAFYNVCLNASVPL--FSKCKFSPLRFQNSIQLERYN-----NCCPHKQRKPDITGTL 441
           D    Y + + + +P+  +SK  F    F N  +L  +N     NC     R+  I+  +
Sbjct: 392 DAFVSYGISIFSKLPIKDWSKSNFRLHWFLNGGKLINHNGMSINNCFTDLSRQHSISTGV 451

Query: 442 GLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISFL 481
           G++ +   A F++ +++P+    G D + GF     +SFL
Sbjct: 452 GILLRHPMARFELNFSVPLTIHQGDDVRKGFQFGVGLSFL 491

>SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {ON}
           similar to uniprot|P53969 Saccharomyces cerevisiae
           YNL026W SAM50 Essential component of the Sorting and
           Assembly Machinery (SAM complex) of the mitochondrial
           outer membrane the authentic non-tagged protein was
           localized to the mitochondria
          Length = 495

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 45/101 (44%), Gaps = 7/101 (6%)

Query: 388 NDGIAFYNVCLNASVPL--FSKCKFSPLRFQNSIQLERYNN-----CCPHKQRKPDITGT 440
            D    Y V L + +P+  + +  F    F N  +L  +NN     C     ++   +  
Sbjct: 395 GDAFVAYGVSLFSRLPVRRWYESNFRLHWFVNGGRLINHNNTNLSSCIKSLAQEHSTSTG 454

Query: 441 LGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISFL 481
           +GLV+K   A F++ +T+PI   +    + GF     ++FL
Sbjct: 455 VGLVFKHPVARFELNFTVPISAHSSDSVRKGFQYGIGLTFL 495

>NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 37.0 bits (84), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 22/101 (21%), Positives = 44/101 (43%), Gaps = 7/101 (6%)

Query: 388 NDGIAFYNVCLNASVPL--FSKCKFSPLRFQNSIQLERYN-----NCCPHKQRKPDITGT 440
            D    Y V + + +P+  +S   F    F N   L  +N     +C     R+   +  
Sbjct: 361 GDAFVSYGVSVFSRLPIEKWSASNFRLHGFINGGNLIDHNGQALTDCLAALSRQHSTSAG 420

Query: 441 LGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISFL 481
           +G++ +   A F++ +++P+   +G D + G      +SFL
Sbjct: 421 VGIILRHPMARFELNFSVPLTMHSGDDVRKGLQFGVGLSFL 461

>NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 37.0 bits (84), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 22/101 (21%), Positives = 44/101 (43%), Gaps = 7/101 (6%)

Query: 388 NDGIAFYNVCLNASVPL--FSKCKFSPLRFQNSIQLERYN-----NCCPHKQRKPDITGT 440
            D    Y V + + +P+  +S   F    F N   L  +N     +C     R+   +  
Sbjct: 361 GDAFVSYGVSVFSRLPIEKWSASNFRLHGFINGGNLIDHNGQALTDCLAALSRQHSTSAG 420

Query: 441 LGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISFL 481
           +G++ +   A F++ +++P+   +G D + G      +SFL
Sbjct: 421 VGIILRHPMARFELNFSVPLTMHSGDDVRKGLQFGVGLSFL 461

>Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar to
           Ashbya gossypii AGR392C
          Length = 495

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 44/106 (41%), Gaps = 17/106 (16%)

Query: 388 NDGIAFYNVCLNASVPL--FSKCKFSPLRFQNSIQLERYNN----------CCPHKQRKP 435
            D    Y + + + +P+  +S   F    F N  +L  +NN          C  H     
Sbjct: 395 GDTFVAYGISVFSRLPVNKWSNSGFRLHWFLNGGRLINHNNSDLSGVLDQLCMEHS---- 450

Query: 436 DITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISFL 481
            I   +G+++K   A F++ +TLP+   +    + GF     +SFL
Sbjct: 451 -IATGIGILFKHPVARFELNFTLPLAAHSSDSVRKGFQYGIGLSFL 495

>KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 495

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 44/106 (41%), Gaps = 9/106 (8%)

Query: 385 HEKNDGIAF--YNVCLNASVPL--FSKCKFSPLRFQNSIQL-----ERYNNCCPHKQRKP 435
           H+   G AF  Y V L + +P   +S   F    F N  +L     ++  NC     R+ 
Sbjct: 390 HDSLGGDAFVSYGVSLFSRLPFKRWSDSNFRLHAFFNGARLINTNGDQLKNCISSLAREH 449

Query: 436 DITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISFL 481
             +  +GLV     A F++ + +P+        + GF     +SFL
Sbjct: 450 STSTGIGLVLGHPVARFELNFGIPLTAHTSDSARKGFQYGIGLSFL 495

>KAFR0A08120 Chr1 complement(1634616..1636997) [2382 bp, 793 aa]
           {ON} 
          Length = 793

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%)

Query: 298 FNIYYEYVLNGLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAIL 344
            N+Y+ Y  + +N    LSP  LHL  V   GI+ EK F + Q  IL
Sbjct: 691 MNLYFHYWTSNMNTYPTLSPLALHLLYVKSSGIDTEKMFFMCQSLIL 737

>Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 43/102 (42%), Gaps = 9/102 (8%)

Query: 388 NDGIAFYNVCLNASVPLFSKCKFSPLR---FQNSIQLERYNN-----CCPHKQRKPDITG 439
            D    Y V + + +P + K K S  R   F N  +L  ++N     C     ++   + 
Sbjct: 384 GDAFVSYGVSVFSRLP-WEKVKKSNFRLHWFFNGGKLINHDNMSLSNCMGRLSKEHSTST 442

Query: 440 TLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISFL 481
            LGLV +   A F++ ++LPI        + GF     + FL
Sbjct: 443 GLGLVLRHPMARFELNFSLPIAAHENDLMRKGFQFGLGLVFL 484

>KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 441 LGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISFL 481
            GLV++   A F++ +T+PI       T+ GF     ISFL
Sbjct: 452 FGLVFRHPVARFELNFTVPITAHTSDATRKGFQYGIGISFL 492

>TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON}
           Anc_2.304 YNL026W
          Length = 503

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/41 (29%), Positives = 24/41 (58%)

Query: 441 LGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISFL 481
           +G+V++   A F++ + +P+   +G  T+ GF     +SFL
Sbjct: 463 MGIVFRHPMARFELNFAIPVVTHSGDITRKGFQYGIGLSFL 503

>Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON}
           (117089..118525) [1437 nt, 479 aa]
          Length = 478

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 45/110 (40%), Gaps = 12/110 (10%)

Query: 384 PHEKNDGIA-----FYNVCLNASVPL--FSKCKFSPLRFQNSIQLERYNNCCPHKQ---- 432
           P + ND I       Y + L + +P   FS   F    F N  +L   N     +     
Sbjct: 369 PKQINDAIGGDMFSAYGISLFSKLPFKKFSDSNFRLHAFFNGGKLVNQNTNTFDRNLQSL 428

Query: 433 -RKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFAMNASISFL 481
            ++  +    G+++K   A F++ +TLP+   +    + GF     +SFL
Sbjct: 429 FKENSLAIGTGIIFKHPVARFELNFTLPLTSYSTDHVRKGFQYGIGMSFL 478

>Kpol_1009.21 s1009 complement(50805..54185) [3381 bp, 1126 aa] {ON}
            complement(50805..54185) [3381 nt, 1127 aa]
          Length = 1126

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 3/48 (6%)

Query: 257  CLVLNKTILENMQIY--KKTSILSKFSTDSRIFVKGIPRYGSYFNIYY 302
            CLV+N+ I+  ++IY   +  ++S+  T +  F+  IP  G YF++ Y
Sbjct: 1035 CLVINELIMVALEIYTWHRAMVISEIVTFA-FFILSIPFLGEYFDLKY 1081

>Suva_14.85 Chr14 complement(155326..159018) [3693 bp, 1230 aa] {ON}
           YNL257C (REAL)
          Length = 1230

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 2/64 (3%)

Query: 258 LVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFNIYYEYVLNGLNDSKKLSP 317
           L L+K + E+M++ K  SIL+  + DS   +   P    Y + Y  +V N +  SK LS 
Sbjct: 205 LSLDKFVYESMKVLKCRSILA--TKDSGKKIDLSPCMNEYLDSYAIWVENSIEGSKVLSS 262

Query: 318 ELLH 321
           +++H
Sbjct: 263 DIIH 266

>AGL156W Chr7 (403828..406560) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR148W (PEP3)
          Length = 910

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 57/132 (43%), Gaps = 12/132 (9%)

Query: 120 NIFIKPNKPLVDPNYTWTISNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKWKNF 179
           +I  K NK  V    +W I        W  N++N LNRA++  I A    D +  + KN 
Sbjct: 421 SILQKANKIQVFIMTSWII--------W--NFMNQLNRAEE--IIAEEATDTNLDELKNA 468

Query: 180 KFDGLSTYPLVPFTSVKSVSGISLFKPLQQSKDYIQYLVESGFRKDMRFPEEVGVKSSNL 239
           K    S +     T V+ +   ++++ + Q     + L  +   +D R+     ++S N 
Sbjct: 469 KAKLESQFQEFVRTHVEYLDRDTVYQIVSQQNRKAELLFYANIIEDYRYVLCYWIRSDNW 528

Query: 240 YTGLAINGAIKD 251
           Y  L I   +KD
Sbjct: 529 YESLKILVTLKD 540

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,294,806
Number of extensions: 2720853
Number of successful extensions: 8977
Number of sequences better than 10.0: 71
Number of HSP's gapped: 9300
Number of HSP's successfully gapped: 72
Length of query: 481
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 368
Effective length of database: 40,524,141
Effective search space: 14912883888
Effective search space used: 14912883888
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)