Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A028005.437ON45345324180.0
KAFR0E038205.437ON3964336131e-74
TDEL0B021805.437ON4184465784e-69
Kpol_1016.45.437ON4133975574e-66
TPHA0J026005.437ON4413855342e-62
Smik_4.6365.437ON4463835124e-59
Suva_2.5425.437ON4423995072e-58
NDAI0B056905.437ON4233805019e-58
YDR370C5.437ON4423904993e-57
NCAS0F034005.437ON4153834956e-57
Skud_4.6395.437ON4423814872e-55
CAGL0A02860g5.437ON4023364763e-54
ZYRO0F10098g5.437ON3734024455e-50
SAKL0G02596g5.437ON4003924388e-49
Kwal_55.214155.437ON3893733843e-41
KNAG0C048905.437ON4053793802e-40
KLTH0F15994g5.437ON3903143591e-37
KLLA0E02245g5.437ON4033373486e-36
AER404C5.437ON3863673274e-33
NDAI0I032603.570ON3772011142e-05
Kpol_380.83.570ON3792941043e-04
KLLA0E12893g3.570ON384118890.024
Suva_11.1912.541ON104486870.056
YMR319C (FET4)1.537ON55283741.8
Skud_11.1942.541ON104086732.4
Kpol_1018.735.669ON62182722.5
KAFR0J029003.570ON381182713.7
TBLA0B072902.347ON737203705.2
YKL033W (TTI1)2.541ON103886705.9
Smik_11.2152.541ON107286696.6
TBLA0A10410singletonON39699688.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A02800
         (453 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   936   0.0  
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   240   1e-74
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   227   4e-69
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   219   4e-66
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   210   2e-62
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   201   4e-59
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   199   2e-58
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   197   9e-58
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   196   3e-57
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   195   6e-57
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   192   2e-55
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   187   3e-54
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   176   5e-50
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   173   8e-49
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   152   3e-41
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   150   2e-40
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   142   1e-37
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   138   6e-36
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   130   4e-33
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     49   2e-05
Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON} (14034..15...    45   3e-04
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    39   0.024
Suva_11.191 Chr11 (358366..361500) [3135 bp, 1044 aa] {ON} YKL03...    38   0.056
YMR319C Chr13 complement(912880..914538) [1659 bp, 552 aa] {ON} ...    33   1.8  
Skud_11.194 Chr11 (354989..358111) [3123 bp, 1040 aa] {ON} YKL03...    33   2.4  
Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa] ...    32   2.5  
KAFR0J02900 Chr10 (552553..553698) [1146 bp, 381 aa] {ON} Anc_3....    32   3.7  
TBLA0B07290 Chr2 (1734701..1736914) [2214 bp, 737 aa] {ON} Anc_2...    32   5.2  
YKL033W Chr11 (375456..378572) [3117 bp, 1038 aa] {ON}  TTI1Subu...    32   5.9  
Smik_11.215 Chr11 (361755..364973) [3219 bp, 1072 aa] {ON} YKL03...    31   6.6  
TBLA0A10410 Chr1 complement(2559651..2560841) [1191 bp, 396 aa] ...    31   8.5  

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  936 bits (2418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/453 (100%), Positives = 453/453 (100%)

Query: 1   MTNLEDNFSKMSLDGNDKNSHNIHKLPVCSHSLPGKKYQGGSIRFNSFVKPSKTHFSDLY 60
           MTNLEDNFSKMSLDGNDKNSHNIHKLPVCSHSLPGKKYQGGSIRFNSFVKPSKTHFSDLY
Sbjct: 1   MTNLEDNFSKMSLDGNDKNSHNIHKLPVCSHSLPGKKYQGGSIRFNSFVKPSKTHFSDLY 60

Query: 61  RTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKSLLDSKKYKAKYIGADLFK 120
           RTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKSLLDSKKYKAKYIGADLFK
Sbjct: 61  RTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKSLLDSKKYKAKYIGADLFK 120

Query: 121 DYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVLAPF 180
           DYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVLAPF
Sbjct: 121 DYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVLAPF 180

Query: 181 KKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNSMRKIVNSGFAFEDLVIKD 240
           KKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNSMRKIVNSGFAFEDLVIKD
Sbjct: 181 KKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNSMRKIVNSGFAFEDLVIKD 240

Query: 241 YTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTNSYTELKCF 300
           YTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTNSYTELKCF
Sbjct: 241 YTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTNSYTELKCF 300

Query: 301 TRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDLVTKCDSYY 360
           TRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDLVTKCDSYY
Sbjct: 301 TRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDLVTKCDSYY 360

Query: 361 SPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLIVEKNRTITL 420
           SPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLIVEKNRTITL
Sbjct: 361 SPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLIVEKNRTITL 420

Query: 421 LPLKKVPASVPIPDFYYKINVTESESSSPSTKR 453
           LPLKKVPASVPIPDFYYKINVTESESSSPSTKR
Sbjct: 421 LPLKKVPASVPIPDFYYKINVTESESSSPSTKR 453

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  240 bits (613), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 155/433 (35%), Positives = 230/433 (53%), Gaps = 50/433 (11%)

Query: 6   DNFSKMSLDGNDKNSHNIHKLPVCSHSLPGKKYQGGSIRFNSFVKPSKTHFSDLYRTSKE 65
           +NF  +SL      S    K P+ S   P K++Q  SI +         H ++ ++ S+E
Sbjct: 11  ENFHGLSL-----GSGKTQKTPIVS---PFKRFQHRSIAY------FPNHPANFFQISRE 56

Query: 66  VATYHLGNLNINTDPTIEHTKGVPCLKDDICQIA-GKSLLDSKKYKAKYIGADLFKDYEK 124
           VATYH G +    +P       +P L  DI +IA G S +D++KYK KYIG+DL++ +E 
Sbjct: 57  VATYHDGRI---YEPNETSQDILPLLNKDISKIAQGVSAIDARKYKVKYIGSDLYQGFEN 113

Query: 125 YHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVLAPFKKIS 184
           + +M +E L   + CF YI+ ++  H     KY  +K++ I+++RHHI +L+++ F   +
Sbjct: 114 FESMSREELDSALPCFAYIKKWEAHH---HCKYTENKKYTIVSARHHIVNLIMSIFD--T 168

Query: 185 DPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYN-SMRKIVNSGFAFEDLVIKDYTS 243
             E  V  TYLG+  +  SQD + +P    E     N +++KI  SGFA EDL+ K    
Sbjct: 169 SKETIVNSTYLGNGLLTFSQDTS-DPMTMNEGIFTKNKNLKKICYSGFALEDLLTKS--- 224

Query: 244 SKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTNSYTELKCFTRL 303
                      +K+P      FS+ EN +   +T+LLR EMD YN LT +YTELKC+  L
Sbjct: 225 -----------QKEP-----LFSITENQLDDNITLLLRCEMDAYNQLTQNYTELKCYAPL 268

Query: 304 NMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDLVTKCDSYYSPR 363
            M SP HR+KLLKTW+Q G LP+SDL+ G R    G L DI W+SRD L  + ++   P 
Sbjct: 269 KMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRRFNNRNLPE 328

Query: 364 LRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLIVEKNRTITLLPL 423
            +   N     A  W +H +  I  L  D L+         P  F++ V+  R I++  L
Sbjct: 329 NKKSLNFNANIAVEWSHHCIKTICELISDNLQ------GDAPQAFQIKVDTFRNISIRNL 382

Query: 424 KKVPASVPIPDFY 436
            K+P +  IP  Y
Sbjct: 383 SKIPQNAQIPRQY 395

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  227 bits (578), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 159/446 (35%), Positives = 231/446 (51%), Gaps = 45/446 (10%)

Query: 1   MTNLEDNFSKMSLD----GNDKNSHNIHKLPVCSHSLPGKKYQGG----SIRFNSFVKPS 52
           M+   D+ +  SL+    GN  NS  +   P    S   +K Q G     I F+ F    
Sbjct: 1   MSKTSDSSTASSLEVHLLGNKLNSLGLQDSPH-GPSKQRRKQQSGKRTVCIPFSKFEHSD 59

Query: 53  KTHF----SDLYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKSLLDSKK 108
             +F    +D +   +EVATY  G L +            PCL+     IA        K
Sbjct: 60  LDYFPDDTADFFEGCEEVATYQNGYLFMKDS---SKKPLYPCLQMFAALIAENR---GPK 113

Query: 109 YKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITS 168
            K  YIG DL++ +E+Y  +    L   I+CF+YI+ ++++  ++    G   +  II+ 
Sbjct: 114 NKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSG---KVTIISP 170

Query: 169 RHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNSM-RKIV 227
           RHH+ DLV+A F    D EVS++ T +G  +++ S D + E  +   +K   NSM RKI 
Sbjct: 171 RHHVVDLVMALFH---DDEVSIICTNIGKGKLIFSGDRSKEERNGLNSK---NSMTRKIC 224

Query: 228 NSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGY 287
            SGFA ED         KLT S +E+          ++S+VE  I+ +L++LLR EMD Y
Sbjct: 225 YSGFALED---------KLTTSHDERM-------GPFYSIVEGKINERLSLLLRCEMDAY 268

Query: 288 NPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWF 347
           NP+ N YTELKCFT+LN+    HR+KLLKTWVQIG +P+SDL++G+RDTQ G L D+TW+
Sbjct: 269 NPIFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWY 328

Query: 348 SRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVP 407
           SR  L  K ++    R   + N     A  W +H + +I  L       +P  P      
Sbjct: 329 SRGSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYES 388

Query: 408 FRLIVEKNRTITLLPLKKVPASVPIP 433
           F++IV+K+  I +  L KVP  V IP
Sbjct: 389 FKVIVDKSHNIIVKKLTKVPRHVQIP 414

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  219 bits (557), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 143/397 (36%), Positives = 219/397 (55%), Gaps = 42/397 (10%)

Query: 43  IRFNSFVKPSKTHF----SDLYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQI 98
           I F+ FV  +   F     DL+  SK VA +    L IN +        +P LK DI  I
Sbjct: 41  IPFHRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFINVEDA-----ALPLLKKDIANI 95

Query: 99  AGKSLLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYG 158
           +GKS+L+SKKYK  Y+G+DL+   +KY  + ++ L  P  CF +I++++ +H  E   YG
Sbjct: 96  SGKSVLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEH--YG 153

Query: 159 MDKEFVIITSRHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENK- 217
              ++ I++ RHHI ++V++ F+   +  V +L TYL +  ILLS+D A    +      
Sbjct: 154 AHADYTILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDASSSSNSNTTGL 213

Query: 218 QFYNSM-RKIVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKL 276
              N M RKI  SGFAFEDLV++D   +                    FSVVE+ ++  +
Sbjct: 214 NSSNPMTRKICYSGFAFEDLVLEDIAEN----------------ARPIFSVVESKLTESI 257

Query: 277 TILLRSEMDGYNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDT 336
            +LLR+E+DGYN +TN +TELKCF  L     F  +++LKTWVQ G +P SD+++G RDT
Sbjct: 258 NLLLRNELDGYNNVTNMFTELKCFAPLKCM--FSAKEVLKTWVQTGLIPESDIVIGIRDT 315

Query: 337 QTGLLNDITWFSRDDLVTKCDSYYSPRL---RFHQNTTPTNASAWYYHVLSAITSLTRDY 393
           Q+GLL D+ W++R DL   C ++ +P L     H N     A  W    + +I SL    
Sbjct: 316 QSGLLEDLVWYNRKDL---CRTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLV--- 369

Query: 394 LKKTPKAPSSVPVPFRLIVEKNRTITLLPLKKVPASV 430
              +  A S+ P  F+L ++ ++TI++  L ++P +V
Sbjct: 370 --SSSIADSNHPCSFKLKIDNHKTISIQKLSRIPQTV 404

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  210 bits (534), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 130/385 (33%), Positives = 218/385 (56%), Gaps = 32/385 (8%)

Query: 58  DLYRTSKEVATYHLGNLN--INTDPTIEHTKGVPCLKDDICQIAGKSLLDSKKYKAKYIG 115
           ++++ +K VA Y+   +    N +  + +    P L  DI  ++  SLLDSKK+K  Y+G
Sbjct: 81  NIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDISNLSEISLLDSKKFKLPYMG 140

Query: 116 ADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDL 175
            +L+ + EK+  M+   L   + CF+Y++    K + E K Y  +  +  +T RHH+ +L
Sbjct: 141 YNLYDEIEKFGPMDSTLLDSTVPCFEYLRTL--KISEEDKLY--NTPYTFMTPRHHLTEL 196

Query: 176 VLAPFKKISDPEV---SVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNSM-RKIVNSGF 231
           ++  ++   + E+   S L T + D+ I++S+D A E     +N +  NS  +K++NSGF
Sbjct: 197 MMTVYES-RESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNHKLQNSFSKKVINSGF 255

Query: 232 AFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLT 291
            FE+LVI+++           Q+   P     YF + EN ++PK T ++RSEMD YN  T
Sbjct: 256 TFEELVIENF-----------QECHKP-----YFYISENRLTPKSTFIIRSEMDSYNNKT 299

Query: 292 NSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDD 351
            ++TELKCF +L++G   HR+KLLKTW Q G  PN D+++G RDT +G+L D+ W+SR++
Sbjct: 300 ETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSREN 359

Query: 352 LVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLI 411
           +  K      P+ +   +  P     W  H + AI S    + K T    S+ P+ +++I
Sbjct: 360 MYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESA---FTKDTSDTASN-PMTYKVI 415

Query: 412 VEKNRTITLLPLKKVPASVPIP-DF 435
           ++K+++I +  L  VP +V IP DF
Sbjct: 416 IDKHKSIIIKKLSIVPKNVEIPTDF 440

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  201 bits (512), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 130/383 (33%), Positives = 204/383 (53%), Gaps = 37/383 (9%)

Query: 58  DLYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKSLLDSKKYKAKYIGAD 117
           D++  SKEVA +  G         I     +P LK DI ++  +SLLD+++ K  Y+G D
Sbjct: 86  DIFHESKEVALFTNGQAYTTVRKDI-----LPNLKGDIAELCERSLLDARERKLPYLGHD 140

Query: 118 LFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVL 177
           LF +  ++  M    L   + C  YI+ +   +  E  K G  ++F ++T+RHHI D+ +
Sbjct: 141 LFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIG--RKFTVVTTRHHIVDMTM 198

Query: 178 APFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQ-FYNS---MRKIVNSGFAF 233
             F +  + + S++ TY+G   I  S++   +  D R +K+  Y+S   M+KI  SGF F
Sbjct: 199 HLFDR-RNKKRSLVATYMGAGLISFSRN---QKNDSRMSKEGIYSSDPNMKKICYSGFEF 254

Query: 234 EDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTNS 293
           E+ V +   ++ L  S      K P      FSVVE+ +S ++ +L+R EMD +NP++ +
Sbjct: 255 ENWVTEGIKAADLNGS------KLP-----VFSVVESKLSEEIGLLIRCEMDAFNPVSGA 303

Query: 294 YTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDLV 353
            TELKCF  L+M +  HR+KLLKTW+Q G  PNSD+++G RD+ +G L DI W+SRD L 
Sbjct: 304 NTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLC 363

Query: 354 TKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSL----TRDYLKKTPKAPSSVPVPFR 409
            K +    P  +   N     A  W  H + +I  L      DY  K P++       F 
Sbjct: 364 MKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPES-------FE 416

Query: 410 LIVEKNRTITLLPLKKVPASVPI 432
           + ++ N TI +  LK +P  V +
Sbjct: 417 ISIDSNNTIAITKLKNIPKHVEL 439

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  199 bits (507), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 131/399 (32%), Positives = 213/399 (53%), Gaps = 34/399 (8%)

Query: 43  IRFNSFVKPSKTHFS-----DLYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQ 97
           + ++SF+  S  +F      D++  SKEVA +    L +     +     +P LK+DI  
Sbjct: 66  VPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDV-----IPNLKEDISH 120

Query: 98  IAGKSLLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKY 157
           +    LL+++K K  Y+G DLF + ++   M    L     C  YI+  D +  N  K +
Sbjct: 121 LYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIE--DWRLNNSGKPF 178

Query: 158 GMDKEFVIITSRHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENK 217
            + K+F ++T+RHHI DL + PF +  + + S++ TY+G+  I LS++  +   D + +K
Sbjct: 179 KIGKKFTVVTTRHHIVDLTMHPFDR-RNKQKSIIATYMGNGFISLSRNPKY---DHKASK 234

Query: 218 QFYNS----MRKIVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDIS 273
           +   S    ++KI +SGF FE+ + ++  +S  + S      K P      FS+VE  +S
Sbjct: 235 EGIYSGDPNIKKICHSGFEFENCLTENTKNSGSSAS------KCP-----VFSIVEGKLS 283

Query: 274 PKLTILLRSEMDGYNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGS 333
             + +L+R EMD +NP++ + TELKCF  L+M +  HR+KLLKTW+Q G LPNSD++VG 
Sbjct: 284 EDIGLLMRCEMDAFNPVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGL 343

Query: 334 RDTQTGLLNDITWFSRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDY 393
           RD+ +G L DI W+SRD L  K +    P  +   N     A  W  H + +I  L    
Sbjct: 344 RDSYSGQLLDIQWYSRDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEAN 403

Query: 394 LKKTPKAPSSVPVPFRLIVEKNRTITLLPLKKVPASVPI 432
           +    +   + P PF + ++ N TI +  L  +P +V I
Sbjct: 404 IS---RYNCNKPEPFEINIDANGTIIITKLSTIPRNVEI 439

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  197 bits (501), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 126/380 (33%), Positives = 200/380 (52%), Gaps = 21/380 (5%)

Query: 57  SDLYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKS--LLDSKKYKAKYI 114
           S  + TSK+VA YH   L  + D     T  +P L+  I ++A  S  L +++  K  Y+
Sbjct: 57  SSFFETSKDVALYHNKQLYSSDD-----TNLIPQLEPAIAKLANPSCSLNEARDLKLPYL 111

Query: 115 GADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHIND 174
           G+DL+  YE +  M+ + L     CFKYI+ ++ ++   K  Y +  +F I+++RHHI +
Sbjct: 112 GSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQN---KHDYQLGNKFTIVSARHHIVE 168

Query: 175 LVLAPFKKISDPEVSVLLTYLG--DNRILLSQDYAHEPPDWRENKQFYNSMRKIVNSGFA 232
           + +  F K    +  + +TY G  +  +L S+D   +      +K     +RKI  SGFA
Sbjct: 169 MTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGIYSKD--GVVRKISYSGFA 226

Query: 233 FEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTN 292
            EDL+  +        S       D ++    F+++EN ++  +++LLR EMD YNP+  
Sbjct: 227 LEDLLTTNKNDHNADNSDVTLVGGDKAV----FAIIENKLNDDISLLLRCEMDSYNPVNK 282

Query: 293 SYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDL 352
            +TE+KCF RL M +  HR+KLLK WVQ G +PNSD+L+G RD   G LNDI WFSR +L
Sbjct: 283 CFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFSRMNL 342

Query: 353 VTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLIV 412
             + ++   P  +   N     A  W  H + +I  L  + + KT    S     F++ +
Sbjct: 343 YRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLNTSQ---SFQIRI 399

Query: 413 EKNRTITLLPLKKVPASVPI 432
             +R I +  LK VP +V +
Sbjct: 400 NASRAIQIKKLKSVPNNVTM 419

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  196 bits (499), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 130/390 (33%), Positives = 206/390 (52%), Gaps = 31/390 (7%)

Query: 46  NSFVKPSKTHFSDLYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKSLLD 105
           N   KP +    D++  SKEVA +  G        TI     +P LK+ I ++   SLL+
Sbjct: 78  NFLTKPPR----DIFHESKEVALFTNGRAY-----TILRKDLIPNLKESIAELYESSLLE 128

Query: 106 SKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVI 165
           +KK K  Y+G DLF + +++  M    L     CF YI+ +     N  K + + K+F +
Sbjct: 129 AKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILD--NPGKDFKIGKKFTV 186

Query: 166 ITSRHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNS--- 222
           +T+RHHI DL +  F +  + + S+++TY+G   +   ++   +    +E    Y++   
Sbjct: 187 VTTRHHIVDLTMHLFNR-RNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEG--IYSNDPN 243

Query: 223 MRKIVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRS 282
           M+KI  SGF FE+ V ++   + LT S      K P      FS+VE+ +S ++ +L+R 
Sbjct: 244 MKKICYSGFEFENWVTENSKVADLTGS------KCP-----IFSLVESKLSEEIGLLIRC 292

Query: 283 EMDGYNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLN 342
           EMD +NP++ + TELKCF  L+M +  HR+KLLKTWVQ G LPNSD+++G RD+ +G L 
Sbjct: 293 EMDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLL 352

Query: 343 DITWFSRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPS 402
           DI W+SRD L  K +    P  +   N     A  W ++ + AI  L    +       S
Sbjct: 353 DIQWYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANIS---DYSS 409

Query: 403 SVPVPFRLIVEKNRTITLLPLKKVPASVPI 432
           + P  F + ++ N  I +  LK  P +V +
Sbjct: 410 TKPESFEIGIDTNNAIVITKLKTTPRNVEL 439

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  195 bits (495), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 124/383 (32%), Positives = 203/383 (53%), Gaps = 28/383 (7%)

Query: 59  LYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKSLLDSKKYKAKYIGADL 118
            Y +S +VA YH   L   +   I     +P LK+DI Q+  KS  +++  K  Y+G+DL
Sbjct: 46  FYESSNQVALYHNHKLYPASQYDI-----IPHLKNDIAQLPKKSASEARTLKRSYLGSDL 100

Query: 119 FKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVLA 178
           +  +E +  M  + L     C  +I+ +++K +    KY   ++F I+++RHHI ++ + 
Sbjct: 101 YDGFETFVPMSAKDLDSLEPCMSFIKDWERKAST---KYKPGRKFNIVSTRHHIVEMTMK 157

Query: 179 PF----------KKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNS-MRKIV 227
            F          KK+ D  ++V+ T     R+L ++D+++      E     N  +++I 
Sbjct: 158 LFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLLFTKDWSNTGNSMNEGIYSKNIILKRIC 217

Query: 228 NSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGY 287
            SGFA EDL+      ++ T  LE++ +K        F+VVEN +   + ILLR E+D +
Sbjct: 218 YSGFALEDLM------TETTSELEKEGEKLTGGEKAVFAVVENKLDDDICILLRCELDAF 271

Query: 288 NPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWF 347
           N     +TELKCF+ L M +  HR+KLLK WVQ G LP+SD+L+G RD+  G L D+ W+
Sbjct: 272 NGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWY 331

Query: 348 SRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVP 407
           SRD L +K ++   P  +   N     A+ W  H + +I  L  + L +  KA S+ P  
Sbjct: 332 SRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQ--KAISN-PQG 388

Query: 408 FRLIVEKNRTITLLPLKKVPASV 430
           F++ ++  R I +  L KVP  +
Sbjct: 389 FQIRIDSRRNIRIKCLSKVPKDI 411

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  192 bits (487), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 126/381 (33%), Positives = 204/381 (53%), Gaps = 31/381 (8%)

Query: 57  SDLYRTSKEVATYHLGNLNINTDP-TIEHTKGVPCLKDDICQIAGKSLLDSKKYKAKYIG 115
            D+++ SKEVA +       N    T      +P L+D I ++   SLL++++ K  Y+G
Sbjct: 85  GDIFQDSKEVALF------TNYQAYTTARKDLIPSLRDGITELYESSLLEARRRKVPYLG 138

Query: 116 ADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDL 175
            DLF + +++  M    L     C  Y++ +  K +N  K + + K+F I+++RHHI DL
Sbjct: 139 HDLFANIDQFVPMTISELDSISPCISYVENW--KLSNHGKNFKIGKKFTIVSARHHIVDL 196

Query: 176 VLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQ-FYNS---MRKIVNSGF 231
            +  F +  +   S+++TY+G   I  S++  +   D++ +K+  Y+S   M+KI  SGF
Sbjct: 197 TMHRFDR-RNKRKSLIVTYMGAGLISFSRNPKN---DFQMSKEGIYSSDPNMKKICYSGF 252

Query: 232 AFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLT 291
            FE  V +D  ++ L         K P      FSVVE+ +S  + +L+R E+D +NP++
Sbjct: 253 EFEHWVTEDIKATDL------NGPKHP-----IFSVVESKLSEDIGLLMRCEIDAFNPVS 301

Query: 292 NSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDD 351
            + TELKCF  L+M +  HR+KLLKTW+Q G LPNSD+++G RD+ +G L DI W+SRD 
Sbjct: 302 RTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDS 361

Query: 352 LVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLI 411
           L  K +    P  +   N     A  W  H + +I  L    +       S+ P  F + 
Sbjct: 362 LYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANIS---HYNSTRPESFEVS 418

Query: 412 VEKNRTITLLPLKKVPASVPI 432
           ++ N TI +  L  VP +V +
Sbjct: 419 IDANGTIAITKLNTVPKNVEL 439

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  187 bits (476), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 113/336 (33%), Positives = 183/336 (54%), Gaps = 31/336 (9%)

Query: 89  PCLKDDICQIAGKSLLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDK 148
           P LKD I  IA  +  +  +    ++G  L+++++KY  M  + L    +C  Y+  Y+ 
Sbjct: 87  PQLKDPIAHIAKSTPAEKTQLVRPFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYEN 146

Query: 149 KHANEKKKYGMDKEFVIITSRHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAH 208
            H    +KYG D++FVI+T+RHH+ DL + PF +     V++L  Y   N + +SQD   
Sbjct: 147 SHG---QKYGEDRDFVIVTARHHMIDLAILPFSR-QFTNVNLLCAYTPGNLLEISQD--- 199

Query: 209 EPPDWRENKQFYNS----MRKIVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNY 264
            P D   +K   N+    ++KI  SGFA ED+         LT S  ++++      N  
Sbjct: 200 -PADNTNDKVGVNTDNPILKKICFSGFALEDI---------LTESANDEER------NPT 243

Query: 265 FSVVENDISPKLTILLRSEMDGYNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQL 324
           F +VEN+I+    +L+R E+D YNP+T+ YTELKC+ + N G+P HR+KLLK+W+Q G +
Sbjct: 244 FLIVENEIA-NTRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKSWIQTGVI 302

Query: 325 PNSDLLVGSRDTQTGLLNDITWFSRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLS 384
           P +D+++G RDT++G L D+  ++R+ L  K  S   PR     N  P  +  WY  +++
Sbjct: 303 PTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVVWYRSLIN 362

Query: 385 AITSLTRDYLKKTPKAPSSVPVPFRLIVEKNRTITL 420
            +T+     L K  +     P  F + V+ N  I +
Sbjct: 363 TLTTTIASLLDKFGRDE---PQLFSIKVDNNCNIRI 395

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  176 bits (445), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 117/402 (29%), Positives = 204/402 (50%), Gaps = 45/402 (11%)

Query: 37  KYQGGSIRFNSFVKPSKTHF----SDLYRTSKEVATYHLGNLNINTDPTIE-HTKGVPCL 91
           + Q  S+ FN F   S   F     +L+   KE + Y+ G L+ +   +I   + G    
Sbjct: 10  RAQLPSVPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSIGLKSPGNKLS 69

Query: 92  KDDICQIAGKSLLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHA 151
            D  C             K  ++G+DL++ +E +  +  E L     C+++I  ++    
Sbjct: 70  HDRSC-----------SNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWEN--- 115

Query: 152 NEKKKYGMDKEFVIITSRHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPP 211
           +    Y     FV+I+ RH++ +L +  F++    + S+L T+LGD +I+LSQ   ++  
Sbjct: 116 DNHTSYSQRSPFVVISPRHYLVELTMQLFQQ---SKYSILCTHLGDGKIVLSQ-VENDKK 171

Query: 212 DWRENKQFYNSMRKIVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVEND 271
             +   +     +KI++SG+A EDL+ +        P +E+    DP     +F+++E +
Sbjct: 172 SHQHTSRNTTMTKKILHSGYALEDLLTRG-------PRVED----DP-----FFAIIEAE 215

Query: 272 ISPKLTILLRSEMDGYNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLV 331
           +   ++++LR E+D YN LT ++TELKC+  LNM + +HR+KLLKTW+Q+   P  DLL+
Sbjct: 216 LDANISLVLRCELDSYNELTETFTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLI 275

Query: 332 GSRDTQTGLLNDITWFSRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTR 391
           G R+T  GLL D+ +F+  +L  K +    P+     N     A  W  H + +I  L  
Sbjct: 276 GVRNTHMGLLQDLQYFTNKELYRKINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVG 335

Query: 392 DYLKKTPKAPSSVPVPFRLIVEKNRTITLLPLKKVPASVPIP 433
           + + +      S P  F+L ++++  I L  LK VPA V +P
Sbjct: 336 ENVDR------SSPQCFKLTIDESHKIQLEKLKHVPAHVELP 371

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  173 bits (438), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 114/392 (29%), Positives = 202/392 (51%), Gaps = 34/392 (8%)

Query: 47  SFVKPSKTHF----SDLYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKS 102
            FV  + +HF       ++ S+E+ T+    +  +     +   G+  LKDDIC+     
Sbjct: 29  GFVHSNVSHFPSVPCKFFQESREIGTF--TRMVSSGKYLFDDKLGLRPLKDDICEYIHNP 86

Query: 103 LLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKE 162
             ++ K K +Y+G DL   +E Y  + ++ L++      +I  +++K+    KKYG + +
Sbjct: 87  AKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNG---KKYGSENK 143

Query: 163 FVIITSRHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNS 222
           F I+++RHH+ DL++ PF   S  E ++++T+L D  +++S D +    D     +    
Sbjct: 144 FTIVSNRHHLIDLIMCPF---SLEEANLIVTHL-DGLLIISSDKSKPKVDSGIRSK-DTR 198

Query: 223 MRKIVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRS 282
           +RK+  +GF  E+LV K    S             P +   ++S+VEN ++  +++LL++
Sbjct: 199 VRKLCYTGFELENLVTKGKVDS-------------PGMHTCFYSIVENKLTEGVSLLLQA 245

Query: 283 EMDGYNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLN 342
           EMD YNP T++Y ELKC     + +  HR+KLL+ W+Q G +P +DLLVG RD     L+
Sbjct: 246 EMDSYNPKTDNYVELKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLD 305

Query: 343 DITWFSRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPS 402
            +  ++RD++  K  +      R + N   T A  W +HV++ IT L    L   P    
Sbjct: 306 ALKPYTRDEIYKKFSTRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPLQ-- 363

Query: 403 SVPVPFRLIVEKNRTITLLPLKKVPASVPIPD 434
                F+L + ++  ++L  L   PA + IP+
Sbjct: 364 ----SFKLTLTRDLQLSLTKLANTPAGL-IPE 390

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  152 bits (384), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 110/373 (29%), Positives = 191/373 (51%), Gaps = 48/373 (12%)

Query: 64  KEVATY-HLGNLNINTDPTIEHTK-GVPCLKDDICQIAGKSLLDSKKYKAKYIGADLFKD 121
           +EVAT  HL    ++TD  +   K G+P L  D+C+      L +K    KYIG DL   
Sbjct: 44  QEVATITHL----LDTDEFLLDDKLGMPELVQDLCEFTESGKLANK---GKYIGHDLLDH 96

Query: 122 YEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVLAPFK 181
           +++Y  +  + L D      +++ + + H    + +  + +F I+ SRH++ DL++ PF 
Sbjct: 97  FDEYVPITPKQLEDMAGVQAFLERWKQLHG---RSFCDNADFTIVCSRHNLIDLIMMPF- 152

Query: 182 KISDPEVSVLLTYLGDNRILLSQDYAHEPPD--WRENKQFYNS----MRKIVNSGFAFED 235
             SD +V +        +I  S  Y +  PD  +++  Q  +S    ++KI  +GF  E+
Sbjct: 153 --SDEDVHL--------KIQFSNGYLNLSPDAQYQKTDQGIHSGDTKIKKICYTGFELEN 202

Query: 236 LVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTNSYT 295
           L+     +SK            P + ++++S+VE  +   + +LL++EMD +N  T SYT
Sbjct: 203 LIT---ATSK------------PDVRSSFYSLVEGKLGDGIKLLLKAEMDCFNSSTRSYT 247

Query: 296 ELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDLVTK 355
           E+KC + L + S +HR+KLL+ WVQ   +P+++LLVG RD     L     ++R  L  K
Sbjct: 248 EIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRK 307

Query: 356 CDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLIVEKN 415
            ++     +R + N   T +  W+ HV+  +  + + +++K  K      V FRL + KN
Sbjct: 308 FNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFIEKGSKE----EVNFRLTLRKN 363

Query: 416 RTITLLPLKKVPA 428
            TI L  + + PA
Sbjct: 364 LTIKLRKMPETPA 376

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  150 bits (380), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 114/379 (30%), Positives = 172/379 (45%), Gaps = 25/379 (6%)

Query: 57  SDLYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIA-GKSLLDSKKYKAKYIG 115
           + +++ SKEVA Y  G L IN   T   T  +P LK+DI  +A  K+   S  +K+KY+G
Sbjct: 46  AHIFQKSKEVACYTGGKLYINDGNTTNLTI-LPLLKEDIAALAQSKNTQKSGSFKSKYLG 104

Query: 116 ADLFKDYEKY-HAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHIND 174
             L+  +E Y   M  + L     C  YI  +++    EKK +G     +I+  RHH+ +
Sbjct: 105 LSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKK-FGESYRHIIVGPRHHLVE 163

Query: 175 LVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNSMRKIVNSGFAFE 234
           L +A F   +D +  ++ T L    I+LSQ              F +  ++  N G    
Sbjct: 164 LTMALFA--NDSDYKLVCTVLRGKFIVLSQ--------------FDDGSQRNRNEGITLS 207

Query: 235 DLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTNSY 294
           D   +    S     + +    +  I  + F      I          EMD YN + N Y
Sbjct: 208 DRRTRMLCYSGFV--ICKIWSLNRGIIPSQFFYYGTPIRRGHLATFTCEMDAYNQIENHY 265

Query: 295 TELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDLVT 354
           TELKC+  LNM S +H+ KLL+TWVQ    P++D+++G R+   G L DIT  SR+ L  
Sbjct: 266 TELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQLSRESLYR 325

Query: 355 KCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLIVEK 414
           K ++ + PR   + N     A  W  + + AI  L    L +        P  F + V +
Sbjct: 326 KFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVLE---PQAFVVTVYR 382

Query: 415 NRTITLLPLKKVPASVPIP 433
              I +  LK VP    IP
Sbjct: 383 GHDIGIRKLKGVPKYAEIP 401

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  142 bits (359), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/314 (30%), Positives = 156/314 (49%), Gaps = 39/314 (12%)

Query: 113 YIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHI 172
           Y+G DL + Y+ +  +    L D    F+++  ++  H    K Y    +F I+ SRH++
Sbjct: 88  YVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHG---KPYSSGSDFTIVCSRHNL 144

Query: 173 NDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQ---FYNS---MRKI 226
            DL++APF   SD +V   + Y+          Y H  PD +  K+    Y+S   +R+I
Sbjct: 145 IDLIMAPF---SDEDVHFNVKYING--------YLHIFPDKQFQKKDDGIYSSESNIRRI 193

Query: 227 VNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDG 286
             +GF  EDLV              E Q   P   + ++S+V+  IS  + +L ++EMD 
Sbjct: 194 CYTGFELEDLVT-------------ETQPGAPK--SAFYSLVQGKISKNIKLLFKAEMDC 238

Query: 287 YNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITW 346
           +NP   SYTE+KC T L + S FHR+KLL+ WVQ   +P++DLL+G RD     L+    
Sbjct: 239 FNPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFEC 298

Query: 347 FSRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPV 406
           ++R +L  K ++     L+   N     +  W+ H++  +      Y++KTP    +  V
Sbjct: 299 YTRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYVEKTP----TEAV 354

Query: 407 PFRLIVEKNRTITL 420
            F+L + K   + L
Sbjct: 355 SFKLTLTKQLELRL 368

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  138 bits (348), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 96/337 (28%), Positives = 177/337 (52%), Gaps = 35/337 (10%)

Query: 89  PCLKDDICQIAGKSLLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDK 148
           P L+ ++C     S  ++K  K  +IG DL K Y+ Y  +++  L+  +   +  Q Y+K
Sbjct: 90  PRLRPEVCTYIKDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEK 149

Query: 149 KHANEKKKYGMDKEFVIITSRHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAH 208
               EK  +        ++ RHHI D+++ PF    D  +S+L+T   D  IL+S D + 
Sbjct: 150 TLNPEKTTF--------VSLRHHIIDIIMCPF---LDEPLSLLMTVQPDKNILISVDKSK 198

Query: 209 EPPDW-RENKQFYNSMRKIVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSV 267
           + P+   E +  +N  +KI  +GFA EDL+I+  T   +   LE +          Y+S+
Sbjct: 199 DKPNGIHETRNSFN--KKICYTGFALEDLLIESPTEGHI---LEHEL---------YYSI 244

Query: 268 VENDISPKLTILLRSEMDGYNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNS 327
           V   ++ ++ +L+++EMD  N LT++YTE+K      +G+ +HR+KLL+ W+Q   LP S
Sbjct: 245 VHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKS 304

Query: 328 DLLVGSRDTQTGLLNDITWFSRDDLVTKCD--SYYSPRLRFHQNTTPTNASAWYYHVLSA 385
           DLL+G R++ +  L  +  +   D+  K +  S      +F++   P  A+ W+ H+   
Sbjct: 305 DLLIGFRNSYSNELEQLKAYKIQDIYHKINNSSIVGKPGKFYK-FNPNVANDWFQHIFQV 363

Query: 386 ITSLTRDYLKKTPKAPSSVPVPFRLIVEKNRTITLLP 422
              L ++ L  + ++ S+    F++ ++ N T+++ P
Sbjct: 364 ---LKQNLLLLSQESTSTT---FKVQIDTNLTLSISP 394

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  130 bits (327), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 102/367 (27%), Positives = 162/367 (44%), Gaps = 42/367 (11%)

Query: 59  LYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKSLLDSKKYKAKYIGADL 118
           ++  S+EV T     L  + D      K +P L D+IC+        SK     Y+G+DL
Sbjct: 46  IFSESREVGTAFRQGLVYDLD----DKKNLPLLNDEICEYISHR---SKSKLIGYVGSDL 98

Query: 119 FKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVLA 178
             + E +H +  E LH      K+I  ++   A+ +  Y    +F I++ RHHI D+++ 
Sbjct: 99  SVESETFHPVTSEELHCLHGLLKFIAKWE---ADNEVNYASRSKFTIVSPRHHILDILMI 155

Query: 179 PFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNSMRKIVNSGFAFEDLVI 238
           PF      E   L+        +++   +  P          ++ RKI  +GF  E L+ 
Sbjct: 156 PFGN----ERCRLVFTAHRGLFVITLAPSQRPTGINSPS---SATRKICYTGFELERLLT 208

Query: 239 KDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTNSYTELK 298
               + +                 +++S +E  + P +TILL+ EMD YNP    YTE+K
Sbjct: 209 ATSGTER----------------GSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIK 252

Query: 299 CFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDLVTKCDS 358
                N+ +  H  KLLK W Q   LP++D+LVG RD  T +L  +  +S D +  K   
Sbjct: 253 SSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKL-- 310

Query: 359 YYSPRLRFHQ---NTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLIVEKN 415
           Y   R R H    N  P  A  W ++ +  I     + L     A SS P  F + ++KN
Sbjct: 311 YIRDRTRSHPSYFNFNPEVAKDWTHYAIREIC----ERLSSLVDATSSSPQSFLVEIDKN 366

Query: 416 RTITLLP 422
             + + P
Sbjct: 367 LQMKIRP 373

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 90/201 (44%), Gaps = 32/201 (15%)

Query: 229 SGFAFEDLVIKDYTSSKLTP-----SLEEQQKKDPSITNNYFSVVENDISPKLTILLRSE 283
           +G+ FE L     T S+  P     +LE++ KK  S  + Y +VV+  +     ++L +E
Sbjct: 155 TGYKFESLA----TLSQPLPLVSRTTLEKRPKKISSNGDEYIAVVKTGVGSS-KLVLGAE 209

Query: 284 MDGYNPLTNS-------YTELKCFTRLNMGSPFHR--QKLLKTWVQIGQLPNSDLLVGSR 334
           +D               Y ELKC T++   +  HR  +KL KTW+Q   +    ++ G R
Sbjct: 210 IDCIFDFKEENKDNLRHYAELKCSTQIITAADAHRFERKLFKTWLQCFLVGIPRIIYGFR 269

Query: 335 DTQTGLLNDITWFSRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYL 394
           D +   L  +  FS +++       ++P++    NT+  +A  WY         LT   L
Sbjct: 270 D-ENYTLKSVEEFSTEEVPILLKE-HNPKM----NTSCIDAIKWY-------GLLTEWLL 316

Query: 395 KKTPKAPSSVPVPFRLIVEKN 415
           K  P+       P+RL+ E N
Sbjct: 317 KLIPRDSGDEIRPYRLVFENN 337

>Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON}
           (14034..15173) [1140 nt, 380 aa]
          Length = 379

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 122/294 (41%), Gaps = 50/294 (17%)

Query: 138 SCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVLAPFKKISDPEVSVLLTYLGD 197
              K IQ Y++    ++KK  +D    IIT R  I  L+ + F      +V++ +  L D
Sbjct: 81  GLLKTIQAYEEI---KQKKVKVD----IITFRGVIRKLISSAFDSPKFNQVNLRIV-LFD 132

Query: 198 NRILLSQ--DYAHEPPDWRENKQFYNSMRKIVNSGFAFEDLVIKDYTSSKLTP-----SL 250
            +I + +      EP D +     Y        SG+ FE+LV    T SK  P     ++
Sbjct: 133 GQIFMKEVPRKEEEPKDGKIAPPVY--------SGYKFENLV----TVSKPIPYTSRTTI 180

Query: 251 EEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTNS-------YTELKCFTRL 303
           E++ KK  S  + Y SVV   +     ++L +E+D               Y ELK    +
Sbjct: 181 EKRPKKIVSNGDEYISVVRTGVG-NCKLMLGAEVDAIFDFKEEDKDNLKHYVELKTTNAV 239

Query: 304 NMGSPFHR--QKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDLVTKCDSYYS 361
              S   +  QK+ KTW+Q   +    ++ G RD    +L  +  FS D++     S  S
Sbjct: 240 LTPSDARKFEQKIFKTWIQCFLVGIPRIIYGFRDNNF-ILKSVEEFSTDEVPLLLKS-NS 297

Query: 362 PRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLIVEKN 415
           P+L      +  +A  WY          T   L + P+   S+   ++L+ E N
Sbjct: 298 PQL----GNSCVDAIKWY-------GVFTEWLLNQIPRDDPSIKKAYKLVYENN 340

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 56/118 (47%), Gaps = 13/118 (11%)

Query: 229 SGFAFEDLVIKDYTSSKLTP--SLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDG 286
           SG+ FE L         L P  +LE++ KK  +  + + S+V   I  K  IL+ +E+D 
Sbjct: 163 SGYKFEALATLSLPLP-LVPRTTLEKRPKKIINNGDQFISMVRTGIG-KCKILIGAEVDC 220

Query: 287 YNPLTNS-------YTELKCFTRLNMGSPFHR--QKLLKTWVQIGQLPNSDLLVGSRD 335
                         Y ELKC T +N  S  H+  +KL KTW+Q   +  + ++ G RD
Sbjct: 221 IFDFKEDSDDNLKHYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYGFRD 278

>Suva_11.191 Chr11 (358366..361500) [3135 bp, 1044 aa] {ON} YKL033W
           (REAL)
          Length = 1044

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 11/86 (12%)

Query: 95  ICQIAGKSLLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEK 154
           ICQ+AG   ++S K   + I    FK  + YH   +        C ++ Q ++      K
Sbjct: 701 ICQLAGYETIESFKDVIETI----FKLLDYYHGYSE-------LCLQFFQLFETIILEMK 749

Query: 155 KKYGMDKEFVIITSRHHINDLVLAPF 180
           KKY  D E ++  +  H++    AP+
Sbjct: 750 KKYASDDEMILKIANQHLSQSTFAPW 775

>YMR319C Chr13 complement(912880..914538) [1659 bp, 552 aa] {ON}
           FET4Low-affinity Fe(II) transporter of the plasma
           membrane
          Length = 552

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 35/83 (42%), Gaps = 10/83 (12%)

Query: 246 LTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTNSYTELKCFTRLNM 305
           LT S  E++K D ++  N  S VEN I P       S ++G  P+ N Y  L       M
Sbjct: 171 LTRSTPEEEKADCTVEANEVSSVENHIDP-------SAINGELPVENWYDRLSNVASRYM 223

Query: 306 GSPFHRQKL---LKTWVQIGQLP 325
           GS          +  W+  G +P
Sbjct: 224 GSIAAMVIFWIGIFVWIGCGAIP 246

>Skud_11.194 Chr11 (354989..358111) [3123 bp, 1040 aa] {ON} YKL033W
           (REAL)
          Length = 1040

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 11/86 (12%)

Query: 95  ICQIAGKSLLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEK 154
           ICQ+AG   ++S K   + I    FK  + YH            C ++ Q ++      K
Sbjct: 694 ICQLAGYETIESFKDVIETI----FKLLDYYHGYSD-------LCLQFFQLFEVIILEMK 742

Query: 155 KKYGMDKEFVIITSRHHINDLVLAPF 180
           KKY  D E ++  +  H++    +P+
Sbjct: 743 KKYINDDEMILKIADQHVSHSTFSPW 768

>Kpol_1018.73 s1018 complement(205615..207480) [1866 bp, 621 aa]
           {ON} complement(205615..207480) [1866 nt, 622 aa]
          Length = 621

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 34/82 (41%), Gaps = 8/82 (9%)

Query: 207 AHEPPDWRENKQFYNSMRKIVNSGFAFEDLVIKDYTSSKLTPS--------LEEQQKKDP 258
           A+  P++     F + +  +V   F +    I  + SS L PS        +EE      
Sbjct: 349 AYWAPNFWAIYSFLDKILAVVMLKFPYVHRFISKFISSPLIPSSIAEIKLRMEENNNGSK 408

Query: 259 SITNNYFSVVENDISPKLTILL 280
            +  + F V+   I PKLT LL
Sbjct: 409 GLVEDVFFVILPQIQPKLTFLL 430

>KAFR0J02900 Chr10 (552553..553698) [1146 bp, 381 aa] {ON} Anc_3.570
           YGL246C
          Length = 381

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 77/182 (42%), Gaps = 35/182 (19%)

Query: 249 SLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMD--------GYNPLTNSYTELKCF 300
           +LE++ KK  +  + + S V   +     +LL SE+D        G + L + YT+L C 
Sbjct: 181 TLEKRTKKISNNGDQFVSAVRTGVGSS-KLLLGSEIDCIFDFKTDGKDNLKH-YTKLACT 238

Query: 301 TRLNMGSPFHR--QKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDLVTKCDS 358
           + +N  S   +    + +TW+    +    ++ G +D +  +L  +  F+ D++      
Sbjct: 239 STINSSSETLKFENNIFRTWLSCFVVGIQRVIYGFKD-KNSILKTVEEFATDEI------ 291

Query: 359 YYSPRLRFHQNTTPTNASA-----WYYHVLSAITSLTRDYLKKTPKAPSSVPVPFRLIVE 413
              P +   QN +  +A       WY          T   LK  P+  +    PF+LI+E
Sbjct: 292 ---PVI-LKQNNSKVSAKCLDAIKWY-------GLFTEWLLKMIPRDDTKSVRPFKLILE 340

Query: 414 KN 415
            N
Sbjct: 341 NN 342

>TBLA0B07290 Chr2 (1734701..1736914) [2214 bp, 737 aa] {ON}
           Anc_2.347 YMR163C
          Length = 737

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 79/203 (38%), Gaps = 26/203 (12%)

Query: 217 KQFYNSMRKIVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKL 276
           KQF  ++  I  +    + L++++  +  L PS+    K++ +IT N ++          
Sbjct: 486 KQFNKNLSHITETLNTSKKLILREMNNKSLYPSISSYPKQNHNITKNEYT---------- 535

Query: 277 TILLRSEMDGYNP-LTNSYTELKCFTRLNM--GSPFHRQKL------LKTWVQIGQLPNS 327
            I    E+  YN  +TNS  +L+   +  M    PF            K ++ + +L   
Sbjct: 536 NIYANYEIFRYNEKITNSIQKLQMIEKYLMKKNQPFDSNNFDNIKHYDKEYINLNRLETK 595

Query: 328 DLLVGSRDTQTGLLNDITWFSRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAIT 387
           + + G   T   LL    W  RDD+    D Y   +   +  +   N   +    L   +
Sbjct: 596 EYIKG---TMINLLK--LWTERDDVEESYDHYIIAKGEKYIKSNKNNRRHFSLSALKKPS 650

Query: 388 SLTRD--YLKKTPKAPSSVPVPF 408
             + D  ++ + PK     P+P 
Sbjct: 651 EFSSDKSFISQIPKRQRQQPIPL 673

>YKL033W Chr11 (375456..378572) [3117 bp, 1038 aa] {ON}  TTI1Subunit
           of the ASTRA complex, involved in chromatin remodeling;
           telomere length regulator involved in the stability or
           biogenesis of PIKKs such as TORC1; similar to S. pombe
           Tti1p; detected in highly purified mitochondria in
           high-throughput studies
          Length = 1038

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 37/86 (43%), Gaps = 11/86 (12%)

Query: 95  ICQIAGKSLLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEK 154
           ICQ+AG   +++     K +   +FK  + YH            C ++ Q +       K
Sbjct: 690 ICQLAGYETIEN----FKDVIETIFKLLDYYHGYSD-------LCLQFFQLFKIIILEMK 738

Query: 155 KKYGMDKEFVIITSRHHINDLVLAPF 180
           KKY  D E ++  +  HI+    +P+
Sbjct: 739 KKYINDDEMILKIANQHISQSTFSPW 764

>Smik_11.215 Chr11 (361755..364973) [3219 bp, 1072 aa] {ON} YKL033W
           (REAL)
          Length = 1072

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 37/86 (43%), Gaps = 11/86 (12%)

Query: 95  ICQIAGKSLLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEK 154
           IC++AG   +++ K   + I    FK  + YH            C ++ Q ++      K
Sbjct: 727 ICKLAGYETIENFKDVIETI----FKLLDYYHGYSD-------LCLQFFQLFEIIIVEMK 775

Query: 155 KKYGMDKEFVIITSRHHINDLVLAPF 180
           K Y  D E ++  S  HI+    +P+
Sbjct: 776 KNYINDDEMILAISNQHISQSTFSPW 801

>TBLA0A10410 Chr1 complement(2559651..2560841) [1191 bp, 396 aa]
           {ON} 
          Length = 396

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 44/99 (44%), Gaps = 10/99 (10%)

Query: 132 PLHDP-ISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVLAPFKKISDPEVSV 190
           P  DP +    +I  Y K + NEK        F +I      +D+V  P++ + DP+ SV
Sbjct: 246 PYDDPNMPTRDHILKYIKDNNNEK--------FDLIADCVGSSDVVDIPYQVLRDPKTSV 297

Query: 191 LLTYLGDNRILLSQDYAHEPPDWRENKQFYNSMRKIVNS 229
             T  GD +I   Q    +   WR   +   + RKI N+
Sbjct: 298 YSTLAGDKKIKYGQAGKFDMLQWRTILRLL-TRRKIFNN 335

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,356,298
Number of extensions: 2763814
Number of successful extensions: 7751
Number of sequences better than 10.0: 52
Number of HSP's gapped: 7995
Number of HSP's successfully gapped: 54
Length of query: 453
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 340
Effective length of database: 40,524,141
Effective search space: 13778207940
Effective search space used: 13778207940
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)