Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0A027905.441ON54754728400.0
ZYRO0F10186g5.441ON51952913870.0
TDEL0D026005.441ON52353013740.0
NDAI0B057105.441ON56349413111e-176
Kpol_1062.255.441ON53349712931e-173
TPHA0E017205.441ON53747712581e-168
SAKL0G02684g5.441ON53949412221e-162
NCAS0F034205.441ON52552412111e-161
KNAG0C048705.441ON45851011431e-152
KAFR0E038105.441ON49047711381e-150
Suva_2.5435.441ON51152311391e-150
Skud_4.6405.441ON51152311331e-150
Smik_4.6375.441ON51152311301e-149
YDR371W (CTS2)5.441ON51152311221e-148
KLLA0E02333g5.441ON48052611051e-146
CAGL0A02904g5.441ON50148010901e-143
Ecym_45125.441ON52748310361e-135
Kwal_55.214025.441ON51649110271e-133
KLTH0F15906g5.441ON51549910171e-132
ACL166W5.441ON4905309651e-124
AAL098W8.693ON17245703.5
NCAS0C014408.625ON431146706.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0A02790
         (547 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...  1098   0.0  
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   538   0.0  
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   533   0.0  
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   509   e-176
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   502   e-173
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   489   e-168
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   475   e-162
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   471   e-161
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   444   e-152
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   442   e-150
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   443   e-150
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   441   e-150
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   439   e-149
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   436   e-148
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   430   e-146
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   424   e-143
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   403   e-135
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   400   e-133
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   396   e-132
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   376   e-124
AAL098W Chr1 (170289..170807) [519 bp, 172 aa] {ON} Syntenic hom...    32   3.5  
NCAS0C01440 Chr3 complement(266268..267563) [1296 bp, 431 aa] {O...    32   6.2  

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score = 1098 bits (2840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/547 (97%), Positives = 533/547 (97%)

Query: 1   MRNDNKAYWRXXXXXXXXXXXXXXEMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNE 60
           MRNDNKAYWR              EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNE
Sbjct: 1   MRNDNKAYWRATIILTFIAITLITEMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNE 60

Query: 61  IKDNKNTNLTVANPQGYTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGK 120
           IKDNKNTNLTVANPQGYTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGK
Sbjct: 61  IKDNKNTNLTVANPQGYTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGK 120

Query: 121 VELGDKWSDIEMDLYKPLSIKLGKLKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSK 180
           VELGDKWSDIEMDLYKPLSIKLGKLKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSK
Sbjct: 121 VELGDKWSDIEMDLYKPLSIKLGKLKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSK 180

Query: 181 LLPTINTENSKNFKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLD 240
           LLPTINTENSKNFKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLD
Sbjct: 181 LLPTINTENSKNFKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLD 240

Query: 241 WEFPKNNTQEPAVYLKIMQQLRQGMNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLS 300
           WEFPKNNTQEPAVYLKIMQQLRQGMNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLS
Sbjct: 241 WEFPKNNTQEPAVYLKIMQQLRQGMNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLS 300

Query: 301 VLPIKEMNKVLDYWNMMTYDYNGEWSEKTGYHSNLYDGSKVKHDEEVLNADSAIKYMIET 360
           VLPIKEMNKVLDYWNMMTYDYNGEWSEKTGYHSNLYDGSKVKHDEEVLNADSAIKYMIET
Sbjct: 301 VLPIKEMNKVLDYWNMMTYDYNGEWSEKTGYHSNLYDGSKVKHDEEVLNADSAIKYMIET 360

Query: 361 QGVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGE 420
           QGVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGE
Sbjct: 361 QGVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGE 420

Query: 421 PGMWMYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGF 480
           PGMWMYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGF
Sbjct: 421 PGMWMYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGF 480

Query: 481 MWESCGDVHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAK 540
           MWESCGDVHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAK
Sbjct: 481 MWESCGDVHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAK 540

Query: 541 LLNKDKM 547
           LLNKDKM
Sbjct: 541 LLNKDKM 547

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/529 (49%), Positives = 365/529 (68%), Gaps = 45/529 (8%)

Query: 25  EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQGYTSGVYYS 84
           EMCFY K+F    E  VL+ +      E  +    + KD+     TV   +GYTSG+YYS
Sbjct: 25  EMCFYRKIFKSSAEHDVLDHVH-----EVGDGSLQQFKDHH----TVIGDEGYTSGLYYS 75

Query: 85  NWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGK 144
           +WSPY PRKHFPHDIDFS++SH+YY+FFL++G  G+++  D+WSD +MDLYKPL++KL +
Sbjct: 76  DWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQ 135

Query: 145 LKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMIMTIGGWSN 204
           L+ K D        +++   LPKGC+GE FYLR++ +L   + +  ++FK++M +GGWSN
Sbjct: 136 LQLKND-----DVHASMGV-LPKGCVGELFYLRHTGIL---DRDKGRHFKVMMAVGGWSN 186

Query: 205 RDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQG 264
           RD +PKM + P+++ NF+ S +E MF+YGFDGIDLDWEFP+N+  EP +YL++ +++R  
Sbjct: 187 RDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLK 246

Query: 265 MNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGE 324
            +ELEE I+            FQLS+A+PAF++KL+VLPIKE+++ +D WNMMTYDY+GE
Sbjct: 247 FDELEEVIFAGEP----NHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGE 302

Query: 325 WSEKTGYHSNLYDG-----SKVKHD----EEVLNADSAIKYMIETQGVEPNKLVLGLAGY 375
           WS  TGYH NLYDG     S+ KHD    +E L+A+SAI  MI   GV+  K+ LG+A Y
Sbjct: 303 WSPVTGYHCNLYDGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAY 362

Query: 376 GRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGEPGMWMYNQLPIKGSI 435
           GRG+T+V  +              + D+ FID  + GVGG SEGEPGMW+YNQLPIKGS 
Sbjct: 363 GRGFTHVKAS--------------SNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSK 408

Query: 436 EQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPKRS 495
           E++DP++VS +C+D KT T V YDNVES+ VK  YVK+ GL GGF WESCGD H +P+RS
Sbjct: 409 EEYDPEYVSGFCFDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRS 468

Query: 496 LITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAKLLNK 544
           L+ AFT  +  I K E+S++   +   +YLE+FG + +LS  I ++++K
Sbjct: 469 LLNAFTGRIKTIAKNENSVYHKPEALRYYLEKFGQDEFLSPFIIRIISK 517

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/530 (49%), Positives = 352/530 (66%), Gaps = 49/530 (9%)

Query: 25  EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQGYTSGVYYS 84
           EMCFY K+F++  +++V++ +Q   +   L            TN     P  Y SG+YYS
Sbjct: 23  EMCFYKKIFHRSAQRKVVDYVQSQPQQAQLV-----------TNPGTVEPGQYLSGLYYS 71

Query: 85  NWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGK 144
           NWSPYSPR HFPHDID SR+SH+YY+FFLV+G  G ++LGD+WSD+ MDLYKP++IKL K
Sbjct: 72  NWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPMAIKLNK 131

Query: 145 LKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMIMTIGGWSN 204
           L  +V    E Q     +  LP GC+GE FY+RN+ L P     N ++FK+IM +GGWSN
Sbjct: 132 LNPEVKNDLERQ-----RRILPNGCLGELFYMRNANLFPN---RNIRDFKVIMCVGGWSN 183

Query: 205 RDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQG 264
           R+ FPKM ++P+++  F+ S IE MF+YGFDGIDLDWEFP+++  EP +YL++ ++L++ 
Sbjct: 184 REEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKER 243

Query: 265 MNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGE 324
           MNELE+ I+     P      FQLS+A+PAF EKL +LPI EM+K +D WNMMTYDY+GE
Sbjct: 244 MNELEDAIFG----PNMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGE 299

Query: 325 WSEKTGYHSNLYDGSKVKHDE------------EVLNADSAIKYMIETQGVEPNKLVLGL 372
           WSEKTGYH NLY+GS    DE            E L+A SAI++M+   GV  +K+ LG+
Sbjct: 300 WSEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGM 359

Query: 373 AGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGEPGMWMYNQLPIK 432
           A YGRG+TNV                 + D+ FID  + GVGG S+GEPGMW+YNQLPI+
Sbjct: 360 AAYGRGFTNVVAQ--------------STDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQ 405

Query: 433 GSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNP 492
           G+ E FDP +VS +CY   + T V YD+VES+  K QYV++K LAGGF WESCGD H N 
Sbjct: 406 GTHELFDPDYVSGFCYSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQ 465

Query: 493 KRSLITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAKLL 542
            RSL+ AFTNE+  + K +  +++      +Y+ +FGN+ +LS  I  LL
Sbjct: 466 SRSLLNAFTNEIKFVSKFDDLMYRQTPVLRYYVNKFGNDAFLSPFILNLL 515

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  509 bits (1311), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 255/494 (51%), Positives = 335/494 (67%), Gaps = 52/494 (10%)

Query: 77  YTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYK 136
           + SGVYYS+WSPY PR HFPHDID ++I+HVYYSFFLVNG  G V   D+WSD++MDLYK
Sbjct: 93  FVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMDLYK 152

Query: 137 PLSIKLGKLKNKVDVYEEP------QTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENS 190
           PLS+KL  L     V  +       +T   +K  LP GC+GE FYL+  +          
Sbjct: 153 PLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLKKFQ---------- 202

Query: 191 KNFKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQE 250
            NFK+IM+IGGWSNR+ FP M +   K++ F+ S++E MF+YGFDGIDLDWEFP+++  E
Sbjct: 203 -NFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFE 261

Query: 251 PAVYLKIMQQLRQGMNELEEEIYKNSAVPVEERKH------FQLSVASPAFEEKLSVLPI 304
           P  YL+I+Q+LR+ M++LE +I++ S +   +  H      F+LSVA+PAF EKL++LPI
Sbjct: 262 PGKYLEIVQRLRKRMDKLEHDIFQKSKISPHDYDHDYHHPKFELSVATPAFIEKLNILPI 321

Query: 305 KEMNKVLDYWNMMTYDYNGEWSEKTGYHSNLYDG-------SKVKHDEEV----LNADSA 353
           KEMNK +DYWNMMTYDY G+WSE+TGYH NLY+G       ++ KH+       LNA+ A
Sbjct: 322 KEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGLNANDA 381

Query: 354 IKYMIETQGVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGV 413
           I YM+    V   KLVLGLA YGRG+T V VN                DE+FI+ ++ GV
Sbjct: 382 INYMLYNNNVSSRKLVLGLAAYGRGFTKVKVN--------------KNDELFINKKFDGV 427

Query: 414 GGESEGEPGMWMYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKD 473
           GG S GEPGMW+YNQLPIK S E FDP +VSA+CYD KT T V YDNV++M VK +YV+D
Sbjct: 428 GGASAGEPGMWLYNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQD 487

Query: 474 KGLAGGFMWESCGDVHDNPKRSLITAFTNEL--GKIKKQESS--IFQDEKTFEFYLEEFG 529
           + LAGGF WESCGD H +P+RSL+ AFTN+L    + K E S  I++   T ++YL  FG
Sbjct: 488 RHLAGGFWWESCGDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFG 547

Query: 530 NEGYLSEAIAKLLN 543
           N+G+LS    ++++
Sbjct: 548 NDGFLSPFFIQIMS 561

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  502 bits (1293), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 247/497 (49%), Positives = 342/497 (68%), Gaps = 45/497 (9%)

Query: 73  NP-QGYTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIE 131
           NP  GY  GVYYSNWSPY+PR H PHD+DFSR++HVYY+FF+V+   G +   D WSD E
Sbjct: 59  NPDSGYDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFE 118

Query: 132 MDLYKPLSIKLGKLKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSK 191
           MD YKPL++KL KL+  +D +  P+     K  LP GCIGE FYLR+S+L    ++ NS+
Sbjct: 119 MDCYKPLAMKLKKLQ--LDHFFNPK----FKNGLPMGCIGELFYLRHSQLF---DSNNSR 169

Query: 192 NFKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEP 251
            FK+IM++GGWSNR++FP+M +  +K+  FV S IE MF YGFDGI+LDWEFPK++  EP
Sbjct: 170 KFKLIMSVGGWSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEP 229

Query: 252 AVYLKIMQQLRQGMNELEEEIYKNSAVP-VEERKHFQLSVASPAFEEKLSVLPIKEMNKV 310
            +YL+++++L+   NELE++I+ NS      +R  F LS+A+PAF+EKL +L ++EM+  
Sbjct: 230 KMYLELVKKLKWKQNELEQKIFNNSGNGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHY 289

Query: 311 LDYWNMMTYDYNGEWSEKTGYHSNLYDGSKVKHDEEV--------------------LNA 350
           +D WNMMTYDY+GEWSEKTGYHSNLY   + +++++                     LN 
Sbjct: 290 VDVWNMMTYDYHGEWSEKTGYHSNLYSPQETRNEDDDDDDRDEDNEDDDDDEDDESNLNG 349

Query: 351 DSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEY 410
           D AI Y+I+   + P K+ LG+A YGRG+T VN +              + D  FI+  Y
Sbjct: 350 DYAINYVIKKYHINPKKINLGMAAYGRGFTKVNAS--------------SQDTRFINKPY 395

Query: 411 KGVGGESEGEPGMWMYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQY 470
           +GVGG SEGEPGMW+YNQLPIK S+E+FDP +VSA+CYD K+ T V YDN +SM VK QY
Sbjct: 396 RGVGGASEGEPGMWLYNQLPIKNSLEEFDPDYVSAFCYDKKSKTFVGYDNRDSMKVKAQY 455

Query: 471 VKDKGLAGGFMWESCGDVHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGN 530
           VK+  L GGF WESCGD H NP++SL+ AFT+E+G + ++  ++F + +  ++YL+  G+
Sbjct: 456 VKEHNLKGGFWWESCGDDHKNPEKSLLNAFTDEIGSVTEKNETMFTNIEVLKYYLKTKGD 515

Query: 531 EGYLSEAIAKLLNKDKM 547
            G+LS  I KLL +D++
Sbjct: 516 TGFLSTFIMKLLYRDEI 532

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  489 bits (1258), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 238/477 (49%), Positives = 329/477 (68%), Gaps = 30/477 (6%)

Query: 77  YTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYK 136
           Y+ GVYYSNWSPYSPR  FPHDID SR+SHVYYSF LV+GD G ++  D WSD ++D+YK
Sbjct: 78  YSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYK 137

Query: 137 PLSIKLGKLKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMI 196
           PL + LG++ N  D        S  K  LP GCIGEFFYLRN+++   I+   S +FK+ 
Sbjct: 138 PLYLSLGQVDNDFD----SVPISMKKELLPMGCIGEFFYLRNTRI--PIHGPKSTDFKVF 191

Query: 197 MTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLK 256
           M++GGWSNR++FPKM + PQK+  F+ S I+ MF YGFDGIDLDWEFP+++  EP +YL 
Sbjct: 192 MSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLD 251

Query: 257 IMQQLRQGMNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNM 316
           I+++L+  M ELE  IYK++        HF+LS+A+PAF+EKL +LP+++M+K +D WNM
Sbjct: 252 IIKRLKMKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNM 311

Query: 317 MTYDYNGEWSEKTGYHSNLY-----DGSKVKHDE----EVLNADSAIKYMIETQGVEPNK 367
           MTYDY+GEWS+ TGYHSNL+      GS +K  +    E L  D+A+KYM +   +   K
Sbjct: 312 MTYDYSGEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRK 371

Query: 368 LVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGEPGMWMYN 427
           ++LG+A YGRG++ V+ +   G        +LTG       ++ GV G S  EPG+W+YN
Sbjct: 372 IILGMAAYGRGFSGVSKSKTNG--------KLTGK------KFNGVSGSSPDEPGVWLYN 417

Query: 428 QLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGD 487
           +LPIKGS E+FD + VSAYCYD K+   V YDN +SM +K +YV+D  L GGF+WE+CG+
Sbjct: 418 KLPIKGSKEEFDKESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGE 477

Query: 488 VHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAKLLNK 544
             +NPK SLI +FT ++  I KQ+ S+F + K  E+YL ++G +G+LS  I  +LN+
Sbjct: 478 KLNNPKLSLINSFTFDMNNIDKQK-SMFSNRKVLEYYLMKYGKQGFLSGYILSVLNR 533

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  475 bits (1222), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 230/494 (46%), Positives = 328/494 (66%), Gaps = 31/494 (6%)

Query: 54  LNNVDNEIKDNKNTNLTVANPQGYTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFL 113
           +N+ DN     +       + Q Y SGVYY+NWSPY+PR HFPHD++F RI++V+YSFF+
Sbjct: 66  MNSNDNNQNLQEEVGPASNDSQSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFV 125

Query: 114 VNGDNGKVELGDKWSDIEMDLYKPLSIKLGKLKNKVDVYEEPQT-QSTIKTNLPKGCIGE 172
           V+  +G V+  D+WSD +MDLYK       + K  +       T QS  K  LP GCIGE
Sbjct: 126 VDPKSGTVKSSDEWSDFQMDLYKKF---YPQFKAALLSSSSSSTFQSHKKEMLPMGCIGE 182

Query: 173 FFYLRNSKLLPTINTEN-SKNFKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFE 231
            FYL+ S +LP+++ +   +NFK+ M++GGWSNRD+FP + +   K   F+ + +E MF+
Sbjct: 183 LFYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQ 242

Query: 232 YGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQGMNELEEEIYKNSAVPVEERKHFQLSVA 291
           YGFDG+D+DWEFP+N+  EP +YL ++++LR+ +++LE +I+++        +HF L+VA
Sbjct: 243 YGFDGLDIDWEFPQNDGLEPKMYLTMIRRLREALDDLERDIFQDE----HHSEHFFLTVA 298

Query: 292 SPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGEWSEKTGYHSNLY--DGSKV-----KHD 344
            PAF+EKL VLP+++M+  +D+WN+M YDY+GEWSE TGYHSNLY  D + V     + +
Sbjct: 299 VPAFKEKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLYSEDSNHVHRRHFRDE 358

Query: 345 EEVLNADSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEV 404
           E  LNADSA+KY+++  G+   K+VLG+A YGRG+T V      G               
Sbjct: 359 ENQLNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTTANSG--------------S 404

Query: 405 FIDLEYKGVGGESEGEPGMWMYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESM 464
           +I   Y GVGG SEGEPGMW+YNQLP+ G++E FDP+ VSAY +D K+ T V YDNV+SM
Sbjct: 405 YIGKPYNGVGGASEGEPGMWLYNQLPLPGTLENFDPRSVSAYSFDPKSKTFVGYDNVDSM 464

Query: 465 NVKGQYVKDKGLAGGFMWESCGDVHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFY 524
             K QYVK+  LAGGF WESCGD H + ++SL+ AFTN+LG + KQ+ SI+       +Y
Sbjct: 465 RCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGSLAKQQPSIYTSAHVIRYY 524

Query: 525 LEEFGNEGYLSEAI 538
           L+ +  +G+LS   
Sbjct: 525 LKNYP-QGFLSRVF 537

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  471 bits (1211), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 244/524 (46%), Positives = 343/524 (65%), Gaps = 44/524 (8%)

Query: 25  EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQGYTSGVYYS 84
           +MC + KL+ K+K  Q L Q        P     + + +  N+N      +GY SG+YYS
Sbjct: 27  QMCLH-KLYFKQKATQDLIQSHFRNGTIPNRQEIDYLMNQTNSN----GEKGYLSGLYYS 81

Query: 85  NWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGK 144
           +WSPY PR HFPHDID +R+SH+YY+FFLV+   GK+   D+WSD++MDLYKPLS+KL  
Sbjct: 82  SWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHN 141

Query: 145 LKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMIMTIGGWSN 204
           L N  D   E   Q   K  LP GCIGE FYL++S ++P        + KMI++IGGWSN
Sbjct: 142 L-NLAD--NEKPVQLRDKRKLPLGCIGELFYLKHSGIIP-----GGSSTKMILSIGGWSN 193

Query: 205 RDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQG 264
           RD FP + +  +K  NF+ SA+E MF YGFDGIDLDWEFPK++  EP  YL+++ +LR+ 
Sbjct: 194 RDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRK 253

Query: 265 MNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGE 324
           M++LE EI+  +    ++   FQLSVA+PAF  KLS+LPI +M++ +DYWNMMTYDY G 
Sbjct: 254 MDDLELEIFGET----KDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGS 309

Query: 325 WSEKTGYHSNLYDG------SKVKHDEEV----LNADSAIKYMIETQGVEPNKLVLGLAG 374
           WSE TGYH NL++G      +  KH+       LNA+ AI +MI++  V  +K+VLG+A 
Sbjct: 310 WSEATGYHCNLFNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAA 369

Query: 375 YGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEG-EPGMWMYNQLPIKG 433
           YGR + +V            K R+  G +  I+ ++KGVG    G EPGMW+YNQLP+KG
Sbjct: 370 YGREFKHV------------KSRQ--GVDTLINQKFKGVGKGGLGDEPGMWLYNQLPLKG 415

Query: 434 SIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPK 493
           ++E +DP + +A+CYD K+ T + YDNV+S+ +K QYV+ + L GGF WESCGD H N +
Sbjct: 416 TVEMYDPNYGAAFCYDKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKR 475

Query: 494 RSLITAFTNELGKIKK--QESSIFQDEKTFEFYLEEFGNEGYLS 535
           RSL+  F+NE+ +I+K   +  IF+ ++   +YL  +G +G+LS
Sbjct: 476 RSLLYNFSNEVTEIRKFSDQDLIFRRKECIAYYLNRYGTDGFLS 519

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  444 bits (1143), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 234/510 (45%), Positives = 316/510 (61%), Gaps = 78/510 (15%)

Query: 26  MCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQGYTSGVYYSN 85
           MCF  +L +KK E    +  QPP +              +N N      Q Y SGVYYS+
Sbjct: 23  MCF-TQLLHKKTE----HHHQPPAQCP------------QNVN------QKYVSGVYYSD 59

Query: 86  WSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGKL 145
           WSPY PR HFP +ID S+I+H+YYSFFLV+ D+  ++LGD WSDIEM             
Sbjct: 60  WSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEM------------- 106

Query: 146 KNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMIMTIGGWSNR 205
                    P  ++T+     KGCIG    LR+ K            FK IM +GGWSN+
Sbjct: 107 ---------PMGKNTVL----KGCIGALNSLRDEK----------PGFKNIMAVGGWSNK 143

Query: 206 DSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQGM 265
           D+FP   +    +     S +E MF+YGFDGIDLDWE+PK++ +EP +YL++M+++RQ M
Sbjct: 144 DAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKIRQHM 203

Query: 266 NELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGEW 325
           NELE  I+       ++++ F LSVA+PAF +KL   PIKEM++ +DYWNMMTYDY GEW
Sbjct: 204 NELEIAIWG------DKKRRFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEW 257

Query: 326 SEKTGYHSNLYDGSKVKHDEEVLNADSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNVN 385
           S  TG+HSNLYDG+  K  E  L AD AI+YM    G+   K+VLG+A YGRG+TNV   
Sbjct: 258 SSGTGFHSNLYDGTN-KFSEHSLCADGAIRYMTNKIGINSRKVVLGMALYGRGFTNV--- 313

Query: 386 HIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGEPGMWMYNQLPIKGSIEQFDPKFVSA 445
                 K    ++ +G    I+ ++KGVGGESEGEPGMW+YNQLPI+G+ E FD ++ SA
Sbjct: 314 ------KEGDPKKTSG---LINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQYGSA 364

Query: 446 YCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPKRSLITAFTNELG 505
           YC+D KT TLV YDNV+S   K QYV+   LAGGF WESCG+  DN ++SL+  F  ++ 
Sbjct: 365 YCFDPKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIE 424

Query: 506 KIKKQESSIFQDEKTFEFYLEEFGNEGYLS 535
           ++ + E++++QD K  E YL+ F   G+L+
Sbjct: 425 RLDRNETNLYQDPKLREHYLQIFAKSGFLA 454

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  442 bits (1138), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 228/477 (47%), Positives = 315/477 (66%), Gaps = 64/477 (13%)

Query: 75  QGYTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDL 134
           + ++ G+YYSNWS Y PR HFPH+I+F  ISHVYY+FFLV+G NGK+  GDKW+D +   
Sbjct: 56  RSFSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQ--- 112

Query: 135 YKPLSIKLGKLKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFK 194
            +P+      LKN                 L KG +GE F L+    +           K
Sbjct: 113 -RPI------LKN---------------NKLVKGNVGELFDLKMKNRV-----------K 139

Query: 195 MIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVY 254
            IM IGGWSNR+++   +  P KI +F   A++MMFEYGFDGIDLDWE+P+++  EP +Y
Sbjct: 140 CIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLY 199

Query: 255 LKIMQQLRQGMNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYW 314
           L+IM++++  MN+LE EI+K+++       +F+LSVA+PAF++KL + P+KEM+ V+DYW
Sbjct: 200 LEIMRRIKHHMNKLESEIFKDTSATTS---YFELSVATPAFKDKLEIFPLKEMDTVIDYW 256

Query: 315 NMMTYDYNGEWSEKTGYHSNLYDGSK--------VKH---DEEVLNADSAIKYMIETQGV 363
           NMMTYDY GEWSE+TGYHSNLYDGSK        ++H   + E LN D A+KYMI  QG+
Sbjct: 257 NMMTYDYYGEWSERTGYHSNLYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMI-NQGI 315

Query: 364 EPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGEPGM 423
           + +K++LG+A YGRG+TNV+V   +    N   R       +I   + GVGG SEGEPGM
Sbjct: 316 KKDKIILGMAAYGRGFTNVDVPTPR---PNESPR-------YIGRTFDGVGGASEGEPGM 365

Query: 424 WMYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWE 483
           W Y+QLPI G++EQFDP++VS YC++  T T V YD ++S+ VK QY+K K + GGF WE
Sbjct: 366 WRYDQLPIPGTVEQFDPRYVSGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWE 425

Query: 484 SCGDVHDNPKRSLITAFTNELGK--IKKQESSIFQDEKTFEFYLEEFGNEGYLSEAI 538
           SCGD H NP+RSL+ A+  ELG+  IKK E SI+++      Y + F  +G+LS+ +
Sbjct: 426 SCGDTHKNPERSLVNAYVKELGRDNIKKPE-SIYKNLHCVSHYKQSFHGKGFLSKYL 481

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  443 bits (1139), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 231/523 (44%), Positives = 328/523 (62%), Gaps = 51/523 (9%)

Query: 25  EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQGYTSGVYYS 84
           EMC Y+KLF  ++ + + +  Q        + V N +++ K +     +  GY SGVYYS
Sbjct: 30  EMCLYNKLFKNQRSEDIRDNFQ-----NGRHQVPNMVQNQKPS----GDDDGYVSGVYYS 80

Query: 85  NWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGK 144
           NWSPY PR HFPHDI+  ++SHVYY+FF ++   G +   D WSD+EMDLYKPL+IK  +
Sbjct: 81  NWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQ 140

Query: 145 LKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMIMTIGGWSN 204
           L +  D  ++   QS     LP GCIGE FYL+N+         + + FK IM+IGGWS+
Sbjct: 141 LVD--DNLDDNNMQSI----LPLGCIGELFYLKNAC--------SGRKFKSIMSIGGWSD 186

Query: 205 RDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQG 264
            ++F  + K+ + + NFV S++E MF+ GFDGID+DWEFP+NN  EP  YLK+++ LR  
Sbjct: 187 SENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLK 246

Query: 265 MNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGE 324
           +N LE +I+  S      + HF+LS+A+PAF++KL  LPI E+++ +D+WNMMTYDY G 
Sbjct: 247 LNSLESQIFGGST-----KDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGS 301

Query: 325 WSEKTGYHSNLYDGSKVKHDEEVLNADSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNV 384
           WSE TGYHSNL+        E  L+ + AI YMI   GV P KLVLG+A YGR +     
Sbjct: 302 WSETTGYHSNLFS-------ETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSF----- 349

Query: 385 NHIQGFGKNNKERELTGDEVFIDLEYKGVG------GESEGEPGMWMYNQLPIKGSIEQF 438
            HI    K++K R  T + V I+ ++KGVG       +++G+ G+W Y  LP KG+ EQ+
Sbjct: 350 -HI----KDDKFRPFTKNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQY 404

Query: 439 DPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPKRSLIT 498
           DPK+VSAYC+D K +  + YDN ES+  K  YV    L GGF WESCG+ + +  RSLI 
Sbjct: 405 DPKYVSAYCFDEKNSIFIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLIN 464

Query: 499 AFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAKL 541
           AF   L      + S+FQD++  ++YL ++G+ G+L+  +  L
Sbjct: 465 AFNEALHFNVSSKPSMFQDKRVMKYYLSKYGDGGFLAPYLKHL 507

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  441 bits (1133), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 226/523 (43%), Positives = 326/523 (62%), Gaps = 52/523 (9%)

Query: 25  EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQGYTSGVYYS 84
           EMC Y+K+F  ++   + +  +         N  +++             +GY SGVYYS
Sbjct: 30  EMCLYNKIFKSQRSDDIRDNFR---------NGGDQVPSMVQNQKPHDGGKGYVSGVYYS 80

Query: 85  NWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGK 144
           NWSPY+PR HFPHDI+  ++SHVYY+FF +N   G +E  D WSD+EM+LYKPL+IK  +
Sbjct: 81  NWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQ 140

Query: 145 LKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMIMTIGGWSN 204
           L        E     +++  LP GC+GE FYL+N+         + K FK+IM+IGGWS+
Sbjct: 141 LV-------ENNLNDSVQNILPLGCVGELFYLKNAC--------SEKKFKVIMSIGGWSD 185

Query: 205 RDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQG 264
            ++F  +    + + NFV S++E MF+ GFDGID+DWEFP+NN  EP  YLK+++ LR  
Sbjct: 186 SENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLK 245

Query: 265 MNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGE 324
           +N LE +I+  S   +E+  HFQ+S+A+PAF++KL  LPI E+++ +DYWNMMTYDY G 
Sbjct: 246 LNNLESQIFGES---IED--HFQISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGS 300

Query: 325 WSEKTGYHSNLYDGSKVKHDEEVLNADSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNV 384
           WSE TGYHSNL+        E  L+ + A+ YMI+   V+ +KLVLG+A YGR +     
Sbjct: 301 WSETTGYHSNLFS-------ETELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSF----- 348

Query: 385 NHIQGFGKNNKERELTGDEVFIDLEYKGVG------GESEGEPGMWMYNQLPIKGSIEQF 438
            HI    K++K +  T + V I+  +KGVG       +++G+ G+W Y  LP KG+IEQ+
Sbjct: 349 -HI----KDSKFQPFTQNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQY 403

Query: 439 DPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPKRSLIT 498
           DPK+VSAYC+D K +  ++YDN +S   K +YV    L GGF WESCG+ H N  RSLI 
Sbjct: 404 DPKYVSAYCFDEKNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLIN 463

Query: 499 AFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAKL 541
           AF   +      + S+FQD +  +FYL ++G++G+LS  +  L
Sbjct: 464 AFNEGIRFNVSSKPSMFQDMRVIKFYLNKYGDDGFLSPYLKHL 506

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  439 bits (1130), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 227/523 (43%), Positives = 327/523 (62%), Gaps = 52/523 (9%)

Query: 25  EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQGYTSGVYYS 84
           EMC Y K+F  ++  ++ +           NN  +++ +   T     + +G+ SGVYYS
Sbjct: 30  EMCLYKKIFKNQRSNKIRDSF---------NNGGHKVPNMDQTQGPNVDGEGFVSGVYYS 80

Query: 85  NWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGK 144
           NWSPY PR HFPHDI+ +++SHVYY+FF +N   G +E  D WSD+EM+LYKPL+IK  +
Sbjct: 81  NWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSE 140

Query: 145 LKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMIMTIGGWSN 204
           L        +  + + I+  LP GCIGE FYL++S         + K FK+IM+IGGWS+
Sbjct: 141 LI-------DGNSSNDIQKILPLGCIGELFYLKHSC--------SGKKFKVIMSIGGWSD 185

Query: 205 RDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQG 264
            ++F  + K+   +  FV S++E MF+ GFDGIDLDWEFP+NN  EP  YLK+++ LR  
Sbjct: 186 SENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSK 245

Query: 265 MNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGE 324
           +N LE +I+      VE+  HFQLS+A+PAF++KL  LPI E+++ +DYWNMMTYDY G 
Sbjct: 246 LNSLESQIFGEG---VED--HFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGS 300

Query: 325 WSEKTGYHSNLYDGSKVKHDEEVLNADSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNV 384
           WSE TGYHSNL+        E  L+ + AI YMI+  G+   KLVLG+A YGR +     
Sbjct: 301 WSETTGYHSNLFS-------ETELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSF----- 348

Query: 385 NHIQGFGKNNKERELTGDEVFIDLEYKGVG------GESEGEPGMWMYNQLPIKGSIEQF 438
            HI+G G     +  T + + I+  +KGVG       +++G+ G+W Y  LP KG+IE++
Sbjct: 349 -HIKGSG----FQPFTQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERY 403

Query: 439 DPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPKRSLIT 498
           DPK+VSAYC+D K +  ++YDN +S+  K +YV    L GGF WESCG+ + N  RSLI 
Sbjct: 404 DPKYVSAYCFDEKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIH 463

Query: 499 AFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAKL 541
           AF   L      + S+F++E+   FYL ++GN G+L+  +  +
Sbjct: 464 AFNEGLRSNVSTKPSMFENERVVNFYLNKYGNNGFLTPYLKHM 506

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  436 bits (1122), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 228/523 (43%), Positives = 318/523 (60%), Gaps = 52/523 (9%)

Query: 25  EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQGYTSGVYYS 84
           EMC Y+K+F  ++   + +           NN  + +  N   + T    + + SGVYYS
Sbjct: 30  EMCLYNKIFKNQRSDDIRDNF---------NNGGHRVPSNVQNHGTHIRDEAFISGVYYS 80

Query: 85  NWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGK 144
           NWSPY PR HFPHDI+  ++SH+YY+FF +N   G +E  D WSD+EM+LYK L+IK  +
Sbjct: 81  NWSPYKPRFHFPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEMNLYKSLAIKNSE 140

Query: 145 LKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMIMTIGGWSN 204
           L        +  + ++++  LP GCIGE FYL+N        T + K FK+IM+IGGWS+
Sbjct: 141 LI-------KESSNNSVQNILPLGCIGELFYLKN--------TCSDKKFKVIMSIGGWSD 185

Query: 205 RDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQG 264
            ++F  + K  + + NFV S++E MF  GFDGIDLDWEFP NN  EP  YLK+++ LR  
Sbjct: 186 SENFKIIIKDDKLLQNFVDSSVETMFRLGFDGIDLDWEFPGNNESEPRGYLKLVRMLRLK 245

Query: 265 MNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGE 324
           +N LE +I+           HFQLS+A+PAF++KL  LPI E+++ +DYWNMMTYDY G 
Sbjct: 246 LNSLESQIFGKRT-----EDHFQLSIAAPAFKDKLFYLPITEIDQYVDYWNMMTYDYYGS 300

Query: 325 WSEKTGYHSNLYDGSKVKHDEEVLNADSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNV 384
           WSE TGYHSNL+        E  LN + A+ YMI+  GV   KLVLG+A YGR +     
Sbjct: 301 WSETTGYHSNLFS-------ETELNGNFAMHYMIDRFGVNSRKLVLGMAAYGRSF----- 348

Query: 385 NHIQGFGKNNKERELTGDEVFIDLEYKGVG------GESEGEPGMWMYNQLPIKGSIEQF 438
            HI    K+NK      + V I+  +KGVG       +++G+ G+W Y  LP  G+IEQ+
Sbjct: 349 -HI----KDNKFEPFNQNTVLINKIFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQY 403

Query: 439 DPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPKRSLIT 498
           DPK+VSAYC+D K +  ++YDN +S+  K +YV    L GGF WESCG+ + N  RSLI 
Sbjct: 404 DPKYVSAYCFDEKNSIFISYDNTKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSLIN 463

Query: 499 AFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAKL 541
           AF   L      + SIFQD +  ++YL ++G+ G+LS  +  L
Sbjct: 464 AFNEGLHFNVSSKPSIFQDVRVKKYYLNKYGDGGFLSPYLKHL 506

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  430 bits (1105), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 227/526 (43%), Positives = 323/526 (61%), Gaps = 80/526 (15%)

Query: 25  EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQGYTSGVYYS 84
           EMC    LF  K ++      +PPT+I+P   V +E             P G++   YYS
Sbjct: 26  EMCIVPWLFLDKIKKGGSAGRRPPTEIDPDTRVPSE------------GPDGFSVATYYS 73

Query: 85  NWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGK 144
           NWSPY+ R H P DI  S+++HVYY+FF+V+  +G V+  D WSD E+    PLS+ +  
Sbjct: 74  NWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFEL----PLSVGV-- 127

Query: 145 LKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMIMTIGGWSN 204
                                 KGCI E         L  I  E+   FK I+ +GGWSN
Sbjct: 128 ----------------------KGCIKE---------LQKIKLESKHEFKTILCLGGWSN 156

Query: 205 RDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQG 264
           R+++ K+AKS +K+  F+ +A++ MF YGFDGIDLDWEFP+ ++ EP VYL++M+ +R+G
Sbjct: 157 REAYKKIAKSEKKVKKFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREG 216

Query: 265 MNELEEEIYKNSAVPVEERKH--FQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYN 322
           M++LE +I+ +   P EE+ H  FQLSVA+PAF EKL++LPI EM+K +D WNMM YD++
Sbjct: 217 MDQLERQIFGS---PAEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFH 273

Query: 323 GEWSEKTGYHSNLY-DGSKVKHD------EEVLNADSAIKYMIETQGVEPNKLVLGLAGY 375
           GEWS+ TGYHSNLY  G   +           L++D+A+K M +   +   ++ LG+A Y
Sbjct: 274 GEWSDVTGYHSNLYLQGHSHRRSLSNRISNSSLSSDTAVKLMTDRHNISSRRIALGMAAY 333

Query: 376 GRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGEPGMWMYNQLPIKGSI 435
           GRG+TNV  N                D+ ++  +Y GVGG SEGEPG+W+YNQLPI GS 
Sbjct: 334 GRGFTNVETN----------------DDNYLGKKYHGVGGGSEGEPGIWLYNQLPIDGSK 377

Query: 436 EQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPKRS 495
           EQFD   VSAYC+D K+ T V YDNV+SM++KG+Y+K K L GGF WESCGD  D P++S
Sbjct: 378 EQFDSNAVSAYCFDPKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDSKD-PRKS 436

Query: 496 LITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAKL 541
           L+ AF+ E+G + +   S+F+ +K  +F+L+++  + Y+S    KL
Sbjct: 437 LVNAFSKEIG-LSEGFVSLFKSDKVKQFHLQKYPKD-YISSLFQKL 480

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  424 bits (1090), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 211/480 (43%), Positives = 304/480 (63%), Gaps = 39/480 (8%)

Query: 71  VANPQGYTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDI 130
           V +   Y +G+YYSNWSPY PR HFPHDIDF ++SH+YY+F L++ + G +   D+WSD 
Sbjct: 50  VLSNTSYIAGLYYSNWSPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDT 109

Query: 131 EMDLYKPLSIKLGKLKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRN--SKLLPTINTE 188
           +++L K     + K       +   + ++      P GCIGE  YLR   SK+       
Sbjct: 110 QLNLAKQCREYMFKR------FTGDELKAVTNIRAPPGCIGELNYLRYIYSKI------- 156

Query: 189 NSKNFKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNT 248
             +N K+IM++GGWSNR+SFP M +   K  NF+ S IE M  YGFDGIDLDWEFP++++
Sbjct: 157 KKRNVKLIMSVGGWSNRESFPIMVRDELKFKNFINSCIETMVYYGFDGIDLDWEFPEDDS 216

Query: 249 QEPAVYLKIMQQLRQGMNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMN 308
            EP  YL++ ++L+  + +LE  I  + +      K FQLS+A+PAF++KLS+LPI +++
Sbjct: 217 YEPDAYLRMARELKLQLQKLEANILGDHS-----NKTFQLSMATPAFKDKLSILPIHKLD 271

Query: 309 KVLDYWNMMTYDYNGEWSEKTGYHSNLYD--GSKV---KHDEEV-LNADSAIKYMIETQG 362
           K +D WN+MTYDY GEWSE+TG H+NLY+  G  +   +HDE+  L+ D+AI YM+    
Sbjct: 272 KYIDLWNLMTYDYYGEWSERTGLHANLYNEKGKLLHLHRHDEDAGLSGDAAINYMVNRCK 331

Query: 363 VEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGEPG 422
           ++P K++LG+A YGRG+TNV++       K+       G      L++ GVGG SEGEPG
Sbjct: 332 IDPRKVILGMAAYGRGFTNVDM-------KSTNPHNPYG------LKFSGVGGASEGEPG 378

Query: 423 MWMYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMW 482
           MW+YNQLPI GS E++D + V AYCYD +T+TLV YDN  S+  K  Y+    L G F W
Sbjct: 379 MWLYNQLPIPGSNEKYDYRHVGAYCYDDRTHTLVGYDNPTSVIEKANYIMSNSLGGAFWW 438

Query: 483 ESCGDVHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAKLL 542
           ESCGD H NPKRSL+  +   +  +K  + +I+   K  ++YLE +   G+L+  I  ++
Sbjct: 439 ESCGDTHKNPKRSLLNTYIRVIRNVKNNKETIYSTTKLHDYYLENYDTNGFLTGFIKDII 498

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  403 bits (1036), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 220/483 (45%), Positives = 303/483 (62%), Gaps = 70/483 (14%)

Query: 77  YTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYK 136
           Y  GVYY++WSPY PR HFPHDIDF R+++V Y+FF+V+   GKV+  D WSD+EM  + 
Sbjct: 63  YAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHA 122

Query: 137 PLSIKLGKLKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMI 196
           P                 PQ  +        G IGE  YL+          + + NF++ 
Sbjct: 123 P---------------GIPQGVT--------GMIGELNYLK---------LQRNTNFRLF 150

Query: 197 MTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLK 256
           M +GGWSNR++FPK+ +S +K+ NFV S I+ MFEYGFDGIDLDWEFPK++  EP +YL+
Sbjct: 151 MAVGGWSNREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLE 210

Query: 257 IMQQLRQGMNELEEEIY--KNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYW 314
           +  +LR  M++LE+EI+   N+  P      F+LSVA+PAF + L +LPI EMNK +  W
Sbjct: 211 MCSRLRSKMDKLEDEIWGANNTDYP-----KFELSVATPAFSQTLKILPIIEMNKFVSIW 265

Query: 315 NMMTYDYNGEWSEKTGYHSNLYDGSK-------------VKHDEEVLNADSAIKYMIETQ 361
           NMMTYD++G WS++TGYHSNLYDG+K             V  D E LNAD AIK M+E  
Sbjct: 266 NMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKKRRFEGMVIDDNEGLNADDAIKIMVENF 325

Query: 362 GVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGEP 421
            V   K+ LG+  YGRG+TNV               +   D+  ++ +Y GVGG SEGEP
Sbjct: 326 KVHAKKVRLGMPAYGRGFTNV---------------QTKDDDDLLNKKYSGVGGGSEGEP 370

Query: 422 GMWMYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFM 481
           G+W+YNQLP+  + E+FD ++VSAYC+D    T V YDN++SM VK  YVK K L+GGF 
Sbjct: 371 GIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFF 430

Query: 482 WESCGDVHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAKL 541
           WESCGD H++PKR+L+ AF+ EL +++    +IF+D +   +YL+    +G+L    ++ 
Sbjct: 431 WESCGDTHNDPKRNLVRAFSQELSEMRI--PTIFKDPRAIAYYLKH-RQKGFLYSLFSQH 487

Query: 542 LNK 544
           L K
Sbjct: 488 LQK 490

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  400 bits (1027), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 207/491 (42%), Positives = 307/491 (62%), Gaps = 35/491 (7%)

Query: 57  VDNEIKDNKNTNLTVANPQGYTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNG 116
           + + +KD K+ +L +++ +G TSG+YYSNWSPY  RKHFPHDIDF R++ V+YSF +VNG
Sbjct: 52  MQSTVKD-KDNSLLISSERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNG 110

Query: 117 DNGKVELGDKWSDIEMDLYKPLSIKLGKLKNKVDVYEE-PQTQSTIKTNLPKGCIGEFFY 175
           + G+ +L D+WSD++MDLYK +         KVD+  + PQ+    + +LP GCIGE FY
Sbjct: 111 ETGECQLSDEWSDVQMDLYKQMFSAF----EKVDLKRQFPQSS---RNDLPLGCIGELFY 163

Query: 176 LRNSKLLPTIN-TENSKNFKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGF 234
           L+ +  L  +   E+ KNFK IM++GGWSNR++F  + +SP K+  F+ S ++ MF+YGF
Sbjct: 164 LKYTDFLSKMGGPEDVKNFKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGF 223

Query: 235 DGIDLDWEFPKNNTQEPAVYLKIMQQLRQGMNELEEEIYKNSAVPVEERKHFQLSVASPA 294
           DGID+DWEFPKN++ EP  YL +M+ LR+ +++LE +I+       +  +HF L+ A  A
Sbjct: 224 DGIDIDWEFPKNDSTEPKAYLDMMRSLRKKLDDLESDIFGTE----KHTQHFLLTSAISA 279

Query: 295 FEEKLSVLPIKEMNKVLDYWNMMTYDYNGEWSEKTGYHSNLYDGS---KVKHDEEVLNAD 351
               L  LP+ E+++ +D WN+M YD++G WS  T Y SNLY  S   K   + E  +AD
Sbjct: 280 DPSCLEYLPLGEIDRYVDQWNLMAYDFSGAWSRHTAYQSNLYSRSSLGKRSENSEGGSAD 339

Query: 352 SAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYK 411
           +A++ ++    +   K+VLG+  YGRG+  V+V H       + E  + G        ++
Sbjct: 340 TAVRLLLNKHKLPAKKIVLGMPAYGRGFKGVSVPH-------HSEHNVIGQ------SFQ 386

Query: 412 GVGGESEGEPGMWMYNQLPIKGSIEQFDPKFVSAYCYDLKTNT----LVTYDNVESMNVK 467
            V G SEGE G+ +YNQLP+KG  E FD   VSAY   L +N     LV YDNV+SM +K
Sbjct: 387 QVSGLSEGESGISLYNQLPLKGGQEWFDQDAVSAYSVKLASNKEMAELVVYDNVQSMKIK 446

Query: 468 GQYVKDKGLAGGFMWESCGDVHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFYLEE 527
            QYV    L GGF WESCG+ + +  RSL  AFT E+  + K   +I+   +  E+Y ++
Sbjct: 447 AQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFTQEIKYLNKTVPTIYALPQVGEYYHKK 506

Query: 528 FGNEGYLSEAI 538
           +  +G+L+  I
Sbjct: 507 Y-PDGFLASII 516

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  396 bits (1017), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 206/499 (41%), Positives = 300/499 (60%), Gaps = 41/499 (8%)

Query: 44  QLQPPTKI----EPLNNVDNE-----IKDNKNTNLTVANPQGYTSGVYYSNWSPYSPRKH 94
           ++Q  TK+    E  NN+          ++  T L+  N  G+ +G+YYSNWSPY+ RKH
Sbjct: 29  RIQTSTKMRAFQEHFNNLGRSGAMLSTSNDAGTGLSADNESGFVTGMYYSNWSPYAARKH 88

Query: 95  FPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGKLKNKVDVYEE 154
           FPHDIDF +++HVYY+F +VN + G+ +L D+WSD++MDLYK +     KL    D+  +
Sbjct: 89  FPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYKQMISSFKKL----DLRAQ 144

Query: 155 PQTQSTIKTNLPKGCIGEFFYLRNSKLLP-TINTENSKNFKMIMTIGGWSNRDSFPKMAK 213
             T S  K  LP GCIGE F+L+ S  L     +    NFK IM++GGWSNR++F  + +
Sbjct: 145 FPTGS--KDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVGGWSNREAFTSLVE 202

Query: 214 SPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQGMNELEEEIY 273
           SP K+  F+ S +  MFEYGFDGID+DWEFPKN+ +EP VYL++++ LR+ ++ LE +I+
Sbjct: 203 SPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKALRERLDTLESQIF 262

Query: 274 KNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGEWSEKTGYHS 333
            +     + + HF L+ A  A EE L  LP++E ++ +DYWN+M YD++G WS +T Y S
Sbjct: 263 GSK----DHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSGAWSAQTAYQS 318

Query: 334 NLYDGSKV--KHDEEVLNADSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNVNHIQGFG 391
           NLY  +K   +      +AD A++++ +   +   K+VLG+  YGRG+  V V+H     
Sbjct: 319 NLYTPAKTNKRSTNGRGSADKAVRFLTDKSKLASKKIVLGMPAYGRGFKGVEVSH----- 373

Query: 392 KNNKERELTGDEVFIDLEYKGVGGESEGEPGMWMYNQLPIKGSIEQFDPKFVSAYCYDLK 451
                      E  I   ++ V G SEGE G+ +Y QLP+KG +E FD   VSAYC  L 
Sbjct: 374 --------KSIENVIGKPFQDVSGSSEGEEGISLYKQLPLKGGMEFFDHNAVSAYCVKLS 425

Query: 452 TNT----LVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPKRSLITAFTNELGKI 507
            N     L+ YDNV+SM  K  YV+   L GGF WESCG+  D   +SL+ AFT E+  +
Sbjct: 426 HNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGE--DYKGKSLVGAFTKEIKCL 483

Query: 508 KKQESSIFQDEKTFEFYLE 526
            K E +I+   +  + YL+
Sbjct: 484 NKTEPTIYSLPEVVQHYLK 502

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  376 bits (965), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 226/530 (42%), Positives = 306/530 (57%), Gaps = 91/530 (17%)

Query: 25  EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQG-YTSGVYY 83
           EM F  KL  +K  +++        + +PL     E+ +          P G YT GVYY
Sbjct: 23  EMTFLPKLIKEKLSRRI--------RPKPL-----EVHEETRPVPDAPYPDGEYTVGVYY 69

Query: 84  SNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLG 143
           S+WSPY PR H+P +IDF R++HVYY+FF+V+   GK+   DKWSD +M    P+++   
Sbjct: 70  SSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKM----PMNL--- 122

Query: 144 KLKNKVDVYEEPQTQSTIKTNLPKG---CIGEFFYLRNSKLLPTINTENSKNFKMIMTIG 200
                              T +P+G    IGE  YL+         T    +FK++M +G
Sbjct: 123 -------------------TGMPRGLNGAIGELNYLK---------TRPGTDFKLMMAVG 154

Query: 201 GWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQ 260
           GWSNR+ F K+ +  +K +NF+ SAI+ MFEYGFDGIDLDWEFPK++  EP +YL++  +
Sbjct: 155 GWSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSR 214

Query: 261 LRQGMNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYD 320
           LR  M+ELE+ I+       E R  F LS+A+PAF + L + P++EMNK L  WNMMTYD
Sbjct: 215 LRHKMDELEDNIWGPGGT-TEPR--FHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYD 271

Query: 321 YNGEWSEKTGYHSNLYDGSKVKHDEEV---------------LNADSAIKYMIETQGVEP 365
           Y+G WSE+TGYHSNLY+ +   +   +               LNA  AI  M E   V P
Sbjct: 272 YHGAWSERTGYHSNLYNATNSPYKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSP 331

Query: 366 NKLVLGLAGYGRGYTNVNVNHIQGFGKNNKERELTGD-EVFIDLEYKGVGGESEGEPGMW 424
            K+ LG+A YGRG+TNV                  GD E  I  +Y GVGG SEGEPGMW
Sbjct: 332 RKIALGMAAYGRGFTNVR-----------------GDGEQLIGQKYSGVGGGSEGEPGMW 374

Query: 425 MYNQLPIKGSIEQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWES 484
           +YNQLP+    E+FD  +VSAY YD  T TLV YDNV+SM +K +YVKDK LAG F+WES
Sbjct: 375 LYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWES 434

Query: 485 CGDVHDNPKRSLITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYL 534
           CGD   +  R+L+ AFT  +   +K  ++ ++D K  ++YL     EG+L
Sbjct: 435 CGDNFKDKDRNLVEAFTENMKGARK--ATAYKDSKLIQYYLRT-RPEGFL 481

>AAL098W Chr1 (170289..170807) [519 bp, 172 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL166W
          Length = 172

 Score = 31.6 bits (70), Expect = 3.5,   Method: Composition-based stats.
 Identities = 13/45 (28%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 235 DGIDLDWEFPKNNTQEPAVYL--KIMQQLRQGMNELEEEIYKNSA 277
           D  D+DW+   N T  P  ++  ++ Q  R  +  +E+EIY +++
Sbjct: 45  DKDDIDWQLLSNQTNAPEFFIRKRVYQLFRVHLKSIEQEIYSHTS 89

>NCAS0C01440 Chr3 complement(266268..267563) [1296 bp, 431 aa] {ON}
           Anc_8.625 YOR209C
          Length = 431

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 60/146 (41%), Gaps = 31/146 (21%)

Query: 353 AIKYMIETQGVEPNKLVLGLAGYGRGYTNVNVNH----IQGFGKNNKERELT---GDEVF 405
           A+KY ++  G   ++ V+G+A     Y N N N     I+ FGK N    LT   G + F
Sbjct: 220 AMKYGVKPIGTVAHEWVMGIASISNDYINANKNSMDYWIKTFGKENSGLALTDTFGTDDF 279

Query: 406 IDL-------EYKGVGGESEGEPGMWMYNQLPIKGSIEQFD----PKFVSAYCYDLKTNT 454
           +          Y GV  +S G+P      +  IK +    D    PKF    C+   +++
Sbjct: 280 LKSFKPPYSDAYTGVRQDS-GDP-----EKYTIKVAHHYHDVLKLPKFSKIICF---SDS 330

Query: 455 LVTYDNVESMNVKGQYVKDKGLAGGF 480
           L    NVE      +   D GL   F
Sbjct: 331 L----NVEKAIKYNKIAHDNGLIATF 352

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.134    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,612,908
Number of extensions: 3295768
Number of successful extensions: 8009
Number of sequences better than 10.0: 43
Number of HSP's gapped: 8141
Number of HSP's successfully gapped: 43
Length of query: 547
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 432
Effective length of database: 40,294,809
Effective search space: 17407357488
Effective search space used: 17407357488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)